Basic Information | |
---|---|
Family ID | F086936 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 110 |
Average Sequence Length | 49 residues |
Representative Sequence | LEIRRIAQQMSLGLAPIDEHKQRRPFWASLLKKQSAQPNFKLQASMEKV |
Number of Associated Samples | 93 |
Number of Associated Scaffolds | 110 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 97.27 % |
% of genes from short scaffolds (< 2000 bps) | 98.18 % |
Associated GOLD sequencing projects | 86 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.26 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (92.727 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (10.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (50.909 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (65.455 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.38% β-sheet: 0.00% Coil/Unstructured: 76.62% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 110 Family Scaffolds |
---|---|---|
PF00437 | T2SSE | 68.18 |
PF00482 | T2SSF | 0.91 |
PF02880 | PGM_PMM_III | 0.91 |
PF00512 | HisKA | 0.91 |
COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
---|---|---|---|
COG0033 | Phosphoglucomutase/phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.91 |
COG1109 | Phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.91 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 92.73 % |
Unclassified | root | N/A | 7.27 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000953|JGI11615J12901_10129524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 745 | Open in IMG/M |
3300004643|Ga0062591_101478898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 678 | Open in IMG/M |
3300004643|Ga0062591_102869864 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
3300005093|Ga0062594_101565891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 680 | Open in IMG/M |
3300005175|Ga0066673_10524105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 696 | Open in IMG/M |
3300005294|Ga0065705_10784878 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
3300005294|Ga0065705_10906941 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
3300005331|Ga0070670_100892256 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
3300005331|Ga0070670_100954550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. FeAm09 | 779 | Open in IMG/M |
3300005332|Ga0066388_101534016 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1168 | Open in IMG/M |
3300005336|Ga0070680_100686070 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
3300005343|Ga0070687_100674629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 719 | Open in IMG/M |
3300005365|Ga0070688_101329578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
3300005366|Ga0070659_100491699 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1045 | Open in IMG/M |
3300005441|Ga0070700_101775252 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
3300005444|Ga0070694_100659410 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
3300005457|Ga0070662_100485563 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1029 | Open in IMG/M |
3300005459|Ga0068867_101750027 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
3300005518|Ga0070699_100638535 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 971 | Open in IMG/M |
3300005548|Ga0070665_102665698 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
3300005549|Ga0070704_100607300 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 962 | Open in IMG/M |
3300005564|Ga0070664_102272362 | Not Available | 515 | Open in IMG/M |
3300005614|Ga0068856_100961001 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 873 | Open in IMG/M |
3300005718|Ga0068866_10185207 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1233 | Open in IMG/M |
3300005841|Ga0068863_100443790 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1273 | Open in IMG/M |
3300005842|Ga0068858_100808830 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 914 | Open in IMG/M |
3300005844|Ga0068862_101718834 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
3300006794|Ga0066658_10119882 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1282 | Open in IMG/M |
3300006806|Ga0079220_11201153 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
3300006845|Ga0075421_100604295 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1288 | Open in IMG/M |
3300006845|Ga0075421_101819672 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
3300006846|Ga0075430_100211435 | Not Available | 1609 | Open in IMG/M |
3300006847|Ga0075431_101453127 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
3300006853|Ga0075420_101155158 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 665 | Open in IMG/M |
3300006880|Ga0075429_100158855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1979 | Open in IMG/M |
3300006969|Ga0075419_10636234 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 752 | Open in IMG/M |
3300009093|Ga0105240_11091714 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 849 | Open in IMG/M |
3300009098|Ga0105245_11063646 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 855 | Open in IMG/M |
3300009101|Ga0105247_11452050 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
3300009147|Ga0114129_11440182 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 849 | Open in IMG/M |
3300009147|Ga0114129_13144696 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
3300009162|Ga0075423_10299705 | Not Available | 1685 | Open in IMG/M |
3300009162|Ga0075423_11326890 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
3300009174|Ga0105241_10301020 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1376 | Open in IMG/M |
3300009174|Ga0105241_12614964 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
3300009176|Ga0105242_12624425 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
3300009551|Ga0105238_11625297 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
3300009789|Ga0126307_11722949 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
3300009840|Ga0126313_11576905 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
3300010037|Ga0126304_11146447 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
3300010039|Ga0126309_10763397 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
3300010044|Ga0126310_11153922 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
3300010362|Ga0126377_11680839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 710 | Open in IMG/M |
3300010375|Ga0105239_12797725 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
3300010399|Ga0134127_12496860 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
3300010401|Ga0134121_10277853 | Not Available | 1475 | Open in IMG/M |
3300010401|Ga0134121_11050223 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
3300010401|Ga0134121_11378412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 714 | Open in IMG/M |
3300010403|Ga0134123_10892078 | Not Available | 894 | Open in IMG/M |
3300010403|Ga0134123_12572954 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
3300011119|Ga0105246_11162164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 708 | Open in IMG/M |
3300011119|Ga0105246_11335785 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
3300011119|Ga0105246_11801933 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
3300012896|Ga0157303_10083540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. FeAm09 | 738 | Open in IMG/M |
3300012907|Ga0157283_10320111 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
3300013100|Ga0157373_11524033 | Not Available | 511 | Open in IMG/M |
3300013102|Ga0157371_11386940 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
3300013306|Ga0163162_12369533 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
3300014325|Ga0163163_12295186 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
3300014497|Ga0182008_10661525 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
3300014745|Ga0157377_11362004 | Not Available | 558 | Open in IMG/M |
3300014968|Ga0157379_11847292 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
3300021445|Ga0182009_10648379 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
3300025796|Ga0210113_1010791 | All Organisms → cellular organisms → Bacteria | 1940 | Open in IMG/M |
3300025901|Ga0207688_10294594 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
3300025911|Ga0207654_11019268 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
3300025918|Ga0207662_10335484 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
3300025923|Ga0207681_10735360 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
3300025925|Ga0207650_10463676 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1055 | Open in IMG/M |
3300025925|Ga0207650_11802321 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
3300025932|Ga0207690_10479550 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1004 | Open in IMG/M |
3300025933|Ga0207706_11551742 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
3300025935|Ga0207709_10762403 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
3300025937|Ga0207669_11100810 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
3300025938|Ga0207704_10209150 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1434 | Open in IMG/M |
3300025940|Ga0207691_10976269 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 707 | Open in IMG/M |
3300025941|Ga0207711_12129175 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
3300025945|Ga0207679_11333035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 659 | Open in IMG/M |
3300025945|Ga0207679_11522906 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
3300025960|Ga0207651_10968335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. FeAm09 | 759 | Open in IMG/M |
3300026035|Ga0207703_10464068 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1185 | Open in IMG/M |
3300026095|Ga0207676_10282733 | Not Available | 1507 | Open in IMG/M |
3300026095|Ga0207676_10429642 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1241 | Open in IMG/M |
3300026116|Ga0207674_10045652 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4505 | Open in IMG/M |
3300026116|Ga0207674_10948500 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
3300027775|Ga0209177_10402761 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
3300031538|Ga0310888_10760924 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
3300031716|Ga0310813_10429609 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1142 | Open in IMG/M |
3300031901|Ga0307406_11117248 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 681 | Open in IMG/M |
3300031911|Ga0307412_10896845 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 777 | Open in IMG/M |
3300032002|Ga0307416_100088195 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2652 | Open in IMG/M |
3300032002|Ga0307416_103049713 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
3300032126|Ga0307415_100472511 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1089 | Open in IMG/M |
3300033412|Ga0310810_11085371 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 669 | Open in IMG/M |
3300034172|Ga0334913_079586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 691 | Open in IMG/M |
3300034479|Ga0314785_021098 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
3300034659|Ga0314780_047918 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 845 | Open in IMG/M |
3300034668|Ga0314793_103820 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
3300034669|Ga0314794_040158 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 846 | Open in IMG/M |
3300034673|Ga0314798_045439 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 807 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.00% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 6.36% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 6.36% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 5.45% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.45% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.45% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 5.45% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 5.45% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 4.55% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 4.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.64% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.64% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.73% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.73% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.73% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.73% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.82% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.82% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.82% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.82% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.82% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.91% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.91% |
Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.91% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.91% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.91% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.91% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.91% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.91% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.91% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.91% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.91% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.91% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300025796 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300034172 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 9HMS | Environmental | Open in IMG/M |
3300034479 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034659 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034668 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034669 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034673 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI11615J12901_101295241 | 3300000953 | Soil | SKIALEIRRVAQQMALGLAPIDESKQRRPFWAGLLKKQAAQPNFKLQASMEKV* |
Ga0062591_1014788982 | 3300004643 | Soil | RVAQQLSLGLAPIDESKQKRPFWAGLLKKQSAQPNFKLQPSVEKV* |
Ga0062591_1028698642 | 3300004643 | Soil | PTSKIALEIRRIAQQMSLGVAPIDESKQRRPFWASLLKKQSAQPNFKLQASMEKV* |
Ga0062594_1015658911 | 3300005093 | Soil | EQMSVGLAPIDESKQRKSFFGSLLKKQPAPSQFKLQASMEKV* |
Ga0066673_105241051 | 3300005175 | Soil | RVAQQISISVAPIYESKQRRPFWAALLRKQSAQPNFNLQTSMEKV* |
Ga0065705_107848781 | 3300005294 | Switchgrass Rhizosphere | TSKIALEIRRIAQQMSLGVAPIDESKQRRPFWASLLKKQSAQPNFPLQTSMEKV* |
Ga0065705_109069411 | 3300005294 | Switchgrass Rhizosphere | MSMGLAPIDESKQKRPFWAALLKKQSAQPNFKLQASMEKV* |
Ga0070670_1008922561 | 3300005331 | Switchgrass Rhizosphere | QAEPTSKIALEIRRIAQQMSLGLAPIDEHKQRRPFWASLLKKQSAQPNFKLQASMEKV* |
Ga0070670_1009545501 | 3300005331 | Switchgrass Rhizosphere | EPTSKIALEIRRIAQQMSLGLAPIDEHKQRRPFWASLLKKQSAQPNFKLQASMEKV* |
Ga0066388_1015340161 | 3300005332 | Tropical Forest Soil | AQQMSLGVAPIDESKQRRPFWAGLLKKQSAQPNFKLHASMEKV* |
Ga0070680_1006860702 | 3300005336 | Corn Rhizosphere | PTSKIALEIRRIAEQMSVGLAPIDESKQRKSFFGSLLKKQPAPSQFKLQASMEKV* |
Ga0070687_1006746291 | 3300005343 | Switchgrass Rhizosphere | KIALEIRRIAQQISLGLAPIDEHKQRRPFWAGLLKKQAAQPNFKLQTSMEKV* |
Ga0070688_1013295781 | 3300005365 | Switchgrass Rhizosphere | SLGLAPIDEHKQRRPFWASLLKKQSAQPNFKLQASMEKV* |
Ga0070659_1004916992 | 3300005366 | Corn Rhizosphere | LEIRRIAQQMSLGLAPIDEHKQRRPFWASLLKKQSAQPNFKLQASMEKV* |
Ga0070700_1017752521 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | RIAEQMSLGIAPIDHSKQRRPFWASLLKKQSAQPNFKLQASMEKV* |
Ga0070694_1006594102 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | EPTSKIALEIRRIAQQISLGLAPIDEHKQRRPFWAGLLKKQAAQPNLKLQASMEKV* |
Ga0070662_1004855631 | 3300005457 | Corn Rhizosphere | LIQAEPTSKIALEIRRIAQQISLGVAPIDESKQRRPFWASLLKKQSAQPNFKLQASMEKV |
Ga0068867_1017500271 | 3300005459 | Miscanthus Rhizosphere | EQMSLSIAPIDHSKQRRPFWASLLKKQSAQPNLKLQASMEKV* |
Ga0070699_1006385352 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | ALEIRRIAQQISLGLAPIDEHKQRRPFWAGLLKKQAAQPNLKLQASMEKV* |
Ga0070665_1026656981 | 3300005548 | Switchgrass Rhizosphere | RRIAEQISLGVAPIDNSKQRRPFWSSFLKKQPAQSNFKLQASMEKV* |
Ga0070704_1006073001 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | KIALEIRRIAQQMSMGLSPIDESKQRKPFWAALLKKQSAQANFKLQTSMEKV* |
Ga0070664_1022723621 | 3300005564 | Corn Rhizosphere | PLIQAEPTSKIALEIRRVAQQISLGLAPIDEHKQRRPFWAGLLKKQAAQPNFKLQTSMEKV* |
Ga0068856_1009610012 | 3300005614 | Corn Rhizosphere | RRIAQQMELGVAPIDQLKQRRPFWASLLKKQSAQPNFKLQASMEKV* |
Ga0068866_101852071 | 3300005718 | Miscanthus Rhizosphere | APIDEHKQRRPFWAGLLKKQAAQPNLKLQASMEKV* |
Ga0068863_1004437902 | 3300005841 | Switchgrass Rhizosphere | SKIALEIRRIAQQMSLGVAPIDESKQRRPFWASLLKKQSAQPNFKLQASMEKV* |
Ga0068858_1008088301 | 3300005842 | Switchgrass Rhizosphere | LEIRRIAQQISLGLAPIDEHKQRRPFWAGLLKKQAAQPNFKLQTSMEKV* |
Ga0068862_1017188342 | 3300005844 | Switchgrass Rhizosphere | SKIALEIRRIAQQMALGLAPIDESKQRRPFWAGLLKKQAAQPNFKLQASMEKV* |
Ga0066658_101198821 | 3300006794 | Soil | ISLAVAPIDQLKQRRPFWAALLRKQAAQPNFKLQTSMEKV* |
Ga0079220_112011531 | 3300006806 | Agricultural Soil | EPTSKIALEIRRIAQQMSLGVAPIDESKQRRPFWASLLKKQSAQQNFKLQASMEKV* |
Ga0075421_1006042951 | 3300006845 | Populus Rhizosphere | TSKIALEIRRIGEQISMGLAPIDQSKQRRPFWAGLLKKQSAQPNFKLQPSVE* |
Ga0075421_1018196722 | 3300006845 | Populus Rhizosphere | SKIALEIRRIGEQISMGLAPIDQSKQRRPFWAGLLKKQSAQPNFKLQTSMEKV* |
Ga0075430_1002114353 | 3300006846 | Populus Rhizosphere | EIRRIGEQISMGLAPIDQSKQRRPFWAGLLKKQSAQPNFKLQTSMEKV* |
Ga0075431_1014531272 | 3300006847 | Populus Rhizosphere | ALEIRRIGEQISMGLAPIDQSKQRRPFWAGLLKKQSAQPNFKLQTSMEKV* |
Ga0075420_1011551581 | 3300006853 | Populus Rhizosphere | PTSKIALEIRRIGEQISMGLAPIDQSKQRRPFWAGLLKKQSAQPNFKLQTSMEKV* |
Ga0075429_1001588553 | 3300006880 | Populus Rhizosphere | GEQISMGLAPIDQSKQRRPFWAGLLKKQSAQPNFKLQTSMEKV* |
Ga0075419_106362341 | 3300006969 | Populus Rhizosphere | IRRIGEQISMGLAPIDQSKQRRPFWAGLLKKQSAQPNFKLQPSVE* |
Ga0105240_110917142 | 3300009093 | Corn Rhizosphere | IAQQISLGVAPIDESKQRRPFWASLLKKQSAQPNFKLQASMEKV* |
Ga0105245_110636462 | 3300009098 | Miscanthus Rhizosphere | IAQQISLGLAPIDEHKQRRPFWAGLLKKQAAQPNLKLQASMEKV* |
Ga0105247_114520501 | 3300009101 | Switchgrass Rhizosphere | ISMGVAPLDTKQRRPFWAGLLKKQSAQPNFKLQASMEKV* |
Ga0114129_114401821 | 3300009147 | Populus Rhizosphere | RVAQQISLGLAPIDGSKQRRPFWAALLKKQSAQPNFKLQTSMEKV* |
Ga0114129_131446962 | 3300009147 | Populus Rhizosphere | VAEQMALGIAPIDRSKQRRPFWASLIKKQSAQPNFKLQASMEKV* |
Ga0075423_102997053 | 3300009162 | Populus Rhizosphere | PLVQAEPTSKIAMEIRRIAEQMSLAIAPIDHSKQRRPFWASLLKKQSVQPNFKLQASMEKV* |
Ga0075423_113268902 | 3300009162 | Populus Rhizosphere | LEIRRIAEQMSLGIAPIDHSKQRRPFWASLLKKQSAQPNLKLQASMEKV* |
Ga0105241_103010202 | 3300009174 | Corn Rhizosphere | VQAEPTSKIATEIRRIAEQMSLGVAPIDLSKQRRPFWASLLKKQSAQPNLKLQASMEKV* |
Ga0105241_126149641 | 3300009174 | Corn Rhizosphere | TSKIALEIRRIAQQMSLGVAPIDESKQRRPFWASLLKKQSAQPNFKLQTQMEKV* |
Ga0105242_126244252 | 3300009176 | Miscanthus Rhizosphere | GLAPIDEHKQRRPFWASLLKKQSAQPNFKLQASMEKV* |
Ga0105238_116252972 | 3300009551 | Corn Rhizosphere | PTSKIALEIRRIAQQMSLGLAPIDEHKQRRPFWASLLKKQSAQPNFKLQASMEKV* |
Ga0126307_117229492 | 3300009789 | Serpentine Soil | VAQQMSLGVAPIDESKQRRPFWASLLKKQSAQPNLKLQTSMEKV* |
Ga0126313_115769052 | 3300009840 | Serpentine Soil | LAVAPIDESKQRRPFWASLLKKQSAQPNFKLQASMEKV* |
Ga0126304_111464472 | 3300010037 | Serpentine Soil | RRIAQQMSLGVAPIDESKQRRPFWASLLKKQSAQANLKLQPSMEKV* |
Ga0126309_107633972 | 3300010039 | Serpentine Soil | IAQQMSLGLAPIDEAKQRRPFWAGLLKKQSAQPNFKLQTSMEKI* |
Ga0126310_111539221 | 3300010044 | Serpentine Soil | VAPIDEKQRRPFWASLLKKQSAQPNFKLEPSMEKV* |
Ga0126377_116808392 | 3300010362 | Tropical Forest Soil | ALEIRRIAQEMSLGLAPIDQSKKSRPFWASLLKKQSAQPNFNLQTSMEKV* |
Ga0105239_127977252 | 3300010375 | Corn Rhizosphere | PIDESKQRRPFWAGLLKKQAAQPNFKLQASMEKV* |
Ga0134127_124968601 | 3300010399 | Terrestrial Soil | QAEPTSKIALEIRRIAQQMALGLAPIDESKQRRPFWAGLLKKQAAQPNFKLQASMEKV* |
Ga0134121_102778532 | 3300010401 | Terrestrial Soil | APIDEHKQRRTFRAGLLKKQAAQPNLKLQASMEKV* |
Ga0134121_110502232 | 3300010401 | Terrestrial Soil | IRRIAQQISLGLAPIDEHKQRRPFWSSLLKKQSAQPNFKLQASMEKV* |
Ga0134121_113784122 | 3300010401 | Terrestrial Soil | PTSKIALEIRRIAQQMALGLAPIDVSKQRRPFWAGLLKKQAAQPNFKLQASMEKV* |
Ga0134123_108920782 | 3300010403 | Terrestrial Soil | IAPIDHSKQRRPFWASLLKKQSAQPNFKLQASMEKV* |
Ga0134123_125729541 | 3300010403 | Terrestrial Soil | MSLGLAPIDEHKQRRPFWANLLKKQSAQPNFKLQASMEKV* |
Ga0105246_111621642 | 3300011119 | Miscanthus Rhizosphere | IAQQMALGLAPIDESKQRRPFWAGLLKKQAAQPNFKLQASMEKV* |
Ga0105246_113357851 | 3300011119 | Miscanthus Rhizosphere | IAQQMSLGLAPIDEHKQRRPFWASLLKKQSAQPNFKLQASMEKV* |
Ga0105246_118019331 | 3300011119 | Miscanthus Rhizosphere | AEPTSKIALEIRRIAQQMSLGVAPIDESKQRRPFWASLLKKQSAQPNFKLQASMEKV* |
Ga0157303_100835402 | 3300012896 | Soil | LGLAPIDEHKQRRPFWAGLLKKQAAQPNLKLQTSMEKV* |
Ga0157283_103201112 | 3300012907 | Soil | RRVAEQMALGIAPIDHSKQRRPFWASLIKKQSAQPNFKLQASMEKV* |
Ga0157373_115240332 | 3300013100 | Corn Rhizosphere | VQAEPTSKIALEIRRIAQQMALGLAPIDESKQRRPFWAGLLKKQAAQPNFKLQASMEKV* |
Ga0157371_113869401 | 3300013102 | Corn Rhizosphere | IAQQISLGLAPIDEHKQRRPFWAGLLKKQAAQPNFKLQTSMEKV* |
Ga0163162_123695331 | 3300013306 | Switchgrass Rhizosphere | SLEIRRIAQQMSLGVAPIDESKQRRPFWASLLKKQPAQPNFNLPQMEKV* |
Ga0163163_122951861 | 3300014325 | Switchgrass Rhizosphere | QAEPTSKIALEIRRIAEQISLGVAPIDNKQRRPFWAGLLKKQAPQPKLKLQASMEKV* |
Ga0182008_106615251 | 3300014497 | Rhizosphere | LEIRRIAQQTSLGVAPIDESKKRRPFWSSLLKKQPAQQNFKLQASMEKV* |
Ga0157377_113620042 | 3300014745 | Miscanthus Rhizosphere | SKIALEIRRIAQQISLGLAPIDEHKQRRPFWAGLLKKQAAQPNLKLQTSMEKV* |
Ga0157379_118472922 | 3300014968 | Switchgrass Rhizosphere | ISLGVAPIDESKQRRPFWASLLKKQSAQPNFKLQASMEKV* |
Ga0182009_106483791 | 3300021445 | Soil | LVQAEPTSKIALEIRRIAQQMSLGVAPIDESKQRRPFWASLLKKQSAQPNFKLQASMEKV |
Ga0210113_10107914 | 3300025796 | Natural And Restored Wetlands | AQQMSLGVAPIDESKQRRPFWASLLKKQSAQPNFNLQTSMEKV |
Ga0207688_102945942 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | QAEPTSKIALEVRRIAQQMSLGVAPIEEASPRRGFLGSLLKKQQPQRQLKLQTSLEKV |
Ga0207654_110192682 | 3300025911 | Corn Rhizosphere | TSKIALEIRRIAQQMSLGVAPIDESKQRRPFWASLLKKQSAQPNFKLQTQMEKV |
Ga0207662_103354842 | 3300025918 | Switchgrass Rhizosphere | MIRRVAQQISLGLAPIDEHKQRRPFWAGLLKKQAAQPNLKLQTSMEKV |
Ga0207681_107353601 | 3300025923 | Switchgrass Rhizosphere | NLGTPLVQAEPTSKIALEIRRIAQQMALGLAPIDESKQRRPFWAGLLKKQAAQPNFKLQASMEKV |
Ga0207650_104636762 | 3300025925 | Switchgrass Rhizosphere | QMSLGLAPIDETRQRRPFWAGLLKKQSAQPNFKLQTSMEKV |
Ga0207650_118023212 | 3300025925 | Switchgrass Rhizosphere | MSLGVAPIDESKQRRPFWAGLLKKQAAQPNFKLQASMEKV |
Ga0207690_104795501 | 3300025932 | Corn Rhizosphere | APIDEHKQRRPFWASLLKKQSAQPNFKLQASMEKV |
Ga0207706_115517421 | 3300025933 | Corn Rhizosphere | LGTPLIQAEPTSKIALEIRRIAQQISLGLAPIDEHKQRRPFWAGLLKKQAAQPNLKLQASMEKV |
Ga0207709_107624032 | 3300025935 | Miscanthus Rhizosphere | IRRIAQQISLGLAPIDEHKQRRPFWAGLLKKQAAQPNLKLQASMEKV |
Ga0207669_111008101 | 3300025937 | Miscanthus Rhizosphere | QAEPTSKIALEIRRIAQQISLGLAPIDEHKQRRPFWAGLMKKQAAQPKLKLQTSMEKV |
Ga0207704_102091502 | 3300025938 | Miscanthus Rhizosphere | MSLGLAPIDEHKQRRPFWANLLKKQSAQPNFKLQASMEKV |
Ga0207691_109762692 | 3300025940 | Miscanthus Rhizosphere | IQAEPTSKIALEIRRVAQQISLGLAPIDEHKQRRPFWAGLLKKQAAQPNLKLQTSMEKV |
Ga0207711_121291751 | 3300025941 | Switchgrass Rhizosphere | LGLAPIDEHKQRRPFWASLLKKQSAQPNFKLQASMEKV |
Ga0207679_113330351 | 3300025945 | Corn Rhizosphere | APIDEHKQRRPFWAGLLKKQAAQPNFKLQTSMEKV |
Ga0207679_115229062 | 3300025945 | Corn Rhizosphere | AQQMSLGVAPIDESKQRRPFWASLLKKQSAQPNFKLQASMEKV |
Ga0207651_109683351 | 3300025960 | Switchgrass Rhizosphere | PTSKIALEIRRIAQQISLGLAPIDEHKQRRPFWAGLLKKQAAQPNFKLQTSMEKV |
Ga0207703_104640681 | 3300026035 | Switchgrass Rhizosphere | QMSLGVAPIDESKQRRPFWASLLKKQSAQPNFKLQASMEKV |
Ga0207676_102827331 | 3300026095 | Switchgrass Rhizosphere | RIAEQMSLGIAPIDHSKQRRPFWASLLKKQSAQPNFKLQASMEKV |
Ga0207676_104296422 | 3300026095 | Switchgrass Rhizosphere | ALEIRRIAQQISLGLAPIDEHKQRRPFWAGLLKKQAAQPNLKLQTSMEKV |
Ga0207674_100456525 | 3300026116 | Corn Rhizosphere | PLVQAEPTSKIALEIRRIAQQMSLGVAPIDESKQRRPFWASLLKKQSAQPNFPLQTSMEK |
Ga0207674_109485001 | 3300026116 | Corn Rhizosphere | EQMSLGIAPIDHSKQRRPFWASLLKKQSAQPNFKLQASMEKV |
Ga0209177_104027611 | 3300027775 | Agricultural Soil | QSEPTSKIALEIRRIAEQTSLGVAPIDESKQRRPFWSSLFKKQPAQSNFKLQASMEKV |
Ga0310888_107609242 | 3300031538 | Soil | EIRRIAQQMSLGVAPIDESKQRRPFWASLLKKQSAQPNFNLPQMEKV |
Ga0310813_104296091 | 3300031716 | Soil | EPTSKIAMEIRRIAEQMSLGIAPIDHSKQRRPFWASLLKKQSAQPNFKLQASMEKV |
Ga0307406_111172482 | 3300031901 | Rhizosphere | IQAEPTSKIALEIRRIAQQISLGLAPIDEHKQRRPFWAGLLKKQAAQPNLKLQTSMEKV |
Ga0307412_108968452 | 3300031911 | Rhizosphere | MEIRRIAQQMSLGLAPIDETKQRRPFWAGLIKKQSAQPNFKLQTSMEKV |
Ga0307416_1000881951 | 3300032002 | Rhizosphere | IAQQMSLGLAPIDETKQRRPFWAGLIKKQSAQPNFKLQTSMEKV |
Ga0307416_1030497132 | 3300032002 | Rhizosphere | QAEPTSKIATEIRRIAETISLGVAPIEEVSQRKGFLRSLLKKQPAQKQFKLQTSMEKV |
Ga0307415_1004725112 | 3300032126 | Rhizosphere | APIDESKQRRPFWASLLKKQSAQPNFKLQASMEKV |
Ga0310810_110853711 | 3300033412 | Soil | GTPLVQAEPTSKIAMEIRRIAEQMSLNVAPIDHSKQRRPFWASLLKKQSAQPNFKLQASMEKV |
Ga0334913_079586_563_679 | 3300034172 | Sub-Biocrust Soil | LGVAPIDESKQRRPFWAGLLKKQAAQPNFKLQTSMEKV |
Ga0314785_021098_372_533 | 3300034479 | Soil | SKIALEIRRVAQQISLGLAPIDEHKQRRPFWAGLLKKQAAQPNFKLQASMEKV |
Ga0314780_047918_9_188 | 3300034659 | Soil | VQAEPTSKIALEIRRIAQQMSLGVAPIDESKQRRPFWASLLKKQSAQPNFKLQTQMEKV |
Ga0314793_103820_478_594 | 3300034668 | Soil | LGIAPIDHSKQRRPFWASLLKKQSAQPNFKLQASMEKV |
Ga0314794_040158_1_174 | 3300034669 | Soil | AEPTSKIALEIRRIAQQMSLGVAPIDESKQRRPFWASLLKRQSAQPNFKLQTQMEKV |
Ga0314798_045439_690_806 | 3300034673 | Soil | LGVAPIDESKQRRPFWASLLKKQSAQPNFKLQASMEKV |
⦗Top⦘ |