NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F087227

Metagenome / Metatranscriptome Family F087227

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F087227
Family Type Metagenome / Metatranscriptome
Number of Sequences 110
Average Sequence Length 42 residues
Representative Sequence VIFNAINVIPQKSDIYVSGKASSTSSASASFDLLLVQDGY
Number of Associated Samples 72
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 78.18 %
Associated GOLD sequencing projects 51
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (46.364 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(69.091 % of family members)
Environment Ontology (ENVO) Unclassified
(84.545 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(82.727 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 27.50%    Coil/Unstructured: 72.50%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 110 Family Scaffolds
PF00534Glycos_transf_1 18.18
PF03237Terminase_6N 1.82
PF13578Methyltransf_24 1.82
PF11753DUF3310 0.91
PF00011HSP20 0.91
PF05050Methyltransf_21 0.91
PF136402OG-FeII_Oxy_3 0.91
PF02794HlyC 0.91
PF11651P22_CoatProtein 0.91

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 110 Family Scaffolds
COG0071Small heat shock protein IbpA, HSP20 familyPosttranslational modification, protein turnover, chaperones [O] 0.91
COG2994ACP:hemolysin acyltransferase (hemolysin-activating protein)Posttranslational modification, protein turnover, chaperones [O] 0.91

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms53.64 %
UnclassifiedrootN/A46.36 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10276300Not Available514Open in IMG/M
3300005239|Ga0073579_1531273Not Available723Open in IMG/M
3300006025|Ga0075474_10021574All Organisms → cellular organisms → Bacteria2329Open in IMG/M
3300006025|Ga0075474_10022088All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2298Open in IMG/M
3300006025|Ga0075474_10026483All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales2065Open in IMG/M
3300006025|Ga0075474_10030014All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-20111918Open in IMG/M
3300006025|Ga0075474_10197755All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae617Open in IMG/M
3300006026|Ga0075478_10087206Not Available1003Open in IMG/M
3300006027|Ga0075462_10072153All Organisms → Viruses → Predicted Viral1085Open in IMG/M
3300006027|Ga0075462_10201448All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon598Open in IMG/M
3300006401|Ga0075506_1788251Not Available1250Open in IMG/M
3300006802|Ga0070749_10324647Not Available859Open in IMG/M
3300006810|Ga0070754_10456095Not Available554Open in IMG/M
3300006867|Ga0075476_10010783All Organisms → cellular organisms → Bacteria4087Open in IMG/M
3300006867|Ga0075476_10059057Not Available1534Open in IMG/M
3300006870|Ga0075479_10002389All Organisms → cellular organisms → Bacteria8566Open in IMG/M
3300006874|Ga0075475_10015306All Organisms → Viruses → Predicted Viral3820Open in IMG/M
3300006874|Ga0075475_10303281All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae658Open in IMG/M
3300006916|Ga0070750_10041961All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2241Open in IMG/M
3300006919|Ga0070746_10154826All Organisms → Viruses → Predicted Viral1114Open in IMG/M
3300006920|Ga0070748_1358005Not Available514Open in IMG/M
3300007234|Ga0075460_10162279All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon774Open in IMG/M
3300007344|Ga0070745_1104622All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon1104Open in IMG/M
3300007345|Ga0070752_1089253Not Available1336Open in IMG/M
3300007539|Ga0099849_1138848All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales946Open in IMG/M
3300007539|Ga0099849_1181658Not Available800Open in IMG/M
3300007539|Ga0099849_1193781All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon767Open in IMG/M
3300007540|Ga0099847_1064816All Organisms → Viruses1136Open in IMG/M
3300007960|Ga0099850_1175648Not Available852Open in IMG/M
3300008012|Ga0075480_10146197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium1287Open in IMG/M
3300009001|Ga0102963_1321407Not Available608Open in IMG/M
3300009001|Ga0102963_1435259Not Available514Open in IMG/M
3300009035|Ga0102958_1322153Not Available542Open in IMG/M
3300009124|Ga0118687_10027256All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1876Open in IMG/M
3300009124|Ga0118687_10049003Not Available1410Open in IMG/M
3300009515|Ga0129286_10270298Not Available602Open in IMG/M
3300010296|Ga0129348_1016582All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2681Open in IMG/M
3300010296|Ga0129348_1092980All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium1066Open in IMG/M
3300010296|Ga0129348_1209907Not Available661Open in IMG/M
3300010299|Ga0129342_1326789Not Available524Open in IMG/M
3300010300|Ga0129351_1354120Not Available550Open in IMG/M
3300010316|Ga0136655_1024635Not Available1984Open in IMG/M
3300010354|Ga0129333_10006225Not Available11292Open in IMG/M
3300010354|Ga0129333_10309279Not Available1413Open in IMG/M
3300010354|Ga0129333_10658173All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium904Open in IMG/M
3300010368|Ga0129324_10000819Not Available21473Open in IMG/M
3300010368|Ga0129324_10088697All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium1349Open in IMG/M
3300010368|Ga0129324_10438476Not Available502Open in IMG/M
3300010430|Ga0118733_108228962Not Available539Open in IMG/M
3300013010|Ga0129327_10206251Not Available993Open in IMG/M
3300017697|Ga0180120_10009776All Organisms → cellular organisms → Bacteria → Proteobacteria4630Open in IMG/M
3300017697|Ga0180120_10049191All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1906Open in IMG/M
3300017697|Ga0180120_10400217Not Available539Open in IMG/M
3300019756|Ga0194023_1103582Not Available575Open in IMG/M
3300019764|Ga0193963_1181061Not Available537Open in IMG/M
3300019937|Ga0194022_1002923Not Available2218Open in IMG/M
3300019938|Ga0194032_1034362Not Available532Open in IMG/M
3300021958|Ga0222718_10016637All Organisms → cellular organisms → Bacteria5213Open in IMG/M
3300021958|Ga0222718_10330076All Organisms → Viruses782Open in IMG/M
3300022050|Ga0196883_1029880Not Available662Open in IMG/M
3300022057|Ga0212025_1001067Not Available2609Open in IMG/M
3300022057|Ga0212025_1021338All Organisms → cellular organisms → Bacteria1052Open in IMG/M
3300022063|Ga0212029_1014792All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium1003Open in IMG/M
3300022069|Ga0212026_1026106All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon843Open in IMG/M
3300022069|Ga0212026_1061312Not Available570Open in IMG/M
3300022071|Ga0212028_1013444Not Available1353Open in IMG/M
3300022071|Ga0212028_1072571Not Available644Open in IMG/M
3300022158|Ga0196897_1021767All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon783Open in IMG/M
3300022167|Ga0212020_1016901All Organisms → Viruses1150Open in IMG/M
3300022169|Ga0196903_1009753All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1198Open in IMG/M
3300022198|Ga0196905_1016136All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2394Open in IMG/M
3300022198|Ga0196905_1030820All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1612Open in IMG/M
3300022198|Ga0196905_1063595All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon1026Open in IMG/M
3300022198|Ga0196905_1104660All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon752Open in IMG/M
3300022198|Ga0196905_1121126Not Available686Open in IMG/M
3300022200|Ga0196901_1046004All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1647Open in IMG/M
3300025508|Ga0208148_1110801Not Available578Open in IMG/M
3300025508|Ga0208148_1122657Not Available534Open in IMG/M
3300025543|Ga0208303_1008475All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3291Open in IMG/M
3300025543|Ga0208303_1013629All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2443Open in IMG/M
3300025543|Ga0208303_1077194Not Available745Open in IMG/M
3300025610|Ga0208149_1032092All Organisms → Viruses1434Open in IMG/M
3300025610|Ga0208149_1066259Not Available908Open in IMG/M
3300025630|Ga0208004_1015369All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium TMED562472Open in IMG/M
3300025646|Ga0208161_1000797Not Available17444Open in IMG/M
3300025646|Ga0208161_1036936All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1668Open in IMG/M
3300025647|Ga0208160_1057216Not Available1090Open in IMG/M
3300025647|Ga0208160_1154876Not Available551Open in IMG/M
3300025652|Ga0208134_1104530All Organisms → cellular organisms → Bacteria777Open in IMG/M
3300025655|Ga0208795_1095303Not Available805Open in IMG/M
3300025671|Ga0208898_1046177Not Available1622Open in IMG/M
3300025671|Ga0208898_1060922All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium1308Open in IMG/M
3300025671|Ga0208898_1155889Not Available610Open in IMG/M
3300025687|Ga0208019_1039236All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1705Open in IMG/M
3300025751|Ga0208150_1035836All Organisms → Viruses → Predicted Viral1722Open in IMG/M
3300025759|Ga0208899_1053960All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1704Open in IMG/M
3300025771|Ga0208427_1193036Not Available651Open in IMG/M
3300025803|Ga0208425_1057828All Organisms → Viruses956Open in IMG/M
3300025810|Ga0208543_1076559All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon809Open in IMG/M
3300025818|Ga0208542_1105042All Organisms → Viruses808Open in IMG/M
3300025853|Ga0208645_1007350All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales7178Open in IMG/M
3300025889|Ga0208644_1338860All Organisms → Viruses579Open in IMG/M
3300026187|Ga0209929_1130510Not Available628Open in IMG/M
3300027917|Ga0209536_100847684All Organisms → cellular organisms → Bacteria1131Open in IMG/M
3300031565|Ga0307379_10603671All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon1005Open in IMG/M
3300034374|Ga0348335_036630All Organisms → Viruses2069Open in IMG/M
3300034374|Ga0348335_103699All Organisms → cellular organisms → Bacteria886Open in IMG/M
3300034375|Ga0348336_002790Not Available13893Open in IMG/M
3300034375|Ga0348336_005875Not Available8392Open in IMG/M
3300034375|Ga0348336_006130All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria8171Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous69.09%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient14.55%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater2.73%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water2.73%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment2.73%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.82%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater Microbial Mat0.91%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.91%
Marine SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment0.91%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment0.91%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.91%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.91%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.91%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300005239Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of MaineEnvironmentalOpen in IMG/M
3300006025Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006026Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006401Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006867Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300006870Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006874Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300007234Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNAEnvironmentalOpen in IMG/M
3300007344Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4EnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007960Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaGEnvironmentalOpen in IMG/M
3300008012Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300009001Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MGEnvironmentalOpen in IMG/M
3300009035Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_D1_MGEnvironmentalOpen in IMG/M
3300009124Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsfEnvironmentalOpen in IMG/M
3300009515Microbial community of beach aquifer sediment core from Cape Shores, Lewes, Delaware, USA - CF-2EnvironmentalOpen in IMG/M
3300010296Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNAEnvironmentalOpen in IMG/M
3300010299Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010300Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNAEnvironmentalOpen in IMG/M
3300010316Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNAEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010430Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samplesEnvironmentalOpen in IMG/M
3300013010Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNAEnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300019756Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MGEnvironmentalOpen in IMG/M
3300019764Microbial mat bacterial communities from the Broadkill River, Lewes, Delaware, United States - FB_6_MGEnvironmentalOpen in IMG/M
3300019937Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW29Aug16_MGEnvironmentalOpen in IMG/M
3300019938Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW8Nov16_MGEnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300022050Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v3)EnvironmentalOpen in IMG/M
3300022057Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2)EnvironmentalOpen in IMG/M
3300022063Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022069Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2)EnvironmentalOpen in IMG/M
3300022071Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2)EnvironmentalOpen in IMG/M
3300022158Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v3)EnvironmentalOpen in IMG/M
3300022167Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v2)EnvironmentalOpen in IMG/M
3300022169Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022198Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022200Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300025508Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025543Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025610Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025630Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025646Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025647Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025652Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes)EnvironmentalOpen in IMG/M
3300025655Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025671Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes)EnvironmentalOpen in IMG/M
3300025687Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025751Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025771Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025818Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025853Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300026187Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300027917Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)EnvironmentalOpen in IMG/M
3300031565Soil microbial communities from Risofladan, Vaasa, Finland - UN-2EnvironmentalOpen in IMG/M
3300034374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4)EnvironmentalOpen in IMG/M
3300034375Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1027630033300000101MarineNAINVIPQKSDIYVSGKASSTSSSSASFDLLLVQDGY*
Ga0073579_153127313300005239MarineLSTVIFNAINVIPEKSDIYVSGKGSSNSSASASFDLLLVQDGY*
Ga0075474_1002157413300006025AqueousVIFNAINVIPQKSDIYVSGKASSTSSSSASFDLLLVQDGY*
Ga0075474_1002208863300006025AqueousAINVIPEKSDIYVSGKASSTSSASASFDLLLVQDGY*
Ga0075474_1002648313300006025AqueousAINVIPQKSDIYVSGKASSTSSSSASFDLLLVQDGY*
Ga0075474_1003001483300006025AqueousTTVIFNAINVIPQKSDIYISGKSSSTSSASASFDLLLVQDGY*
Ga0075474_1019775533300006025AqueousQTTVIFNAINVIPQKSDIYVSGKASSTSSASASFDLLLVQDGY*
Ga0075478_1008720613300006026AqueousNVIPQKSDIYISGKSSSTSSASASFDLLLVQDGY*
Ga0075462_1007215343300006027AqueousFLNVRGGQTTVIFNAINVIPEKSDIYVSGKASSTSSASASFDLLLVQDGY*
Ga0075462_1020144813300006027AqueousNVRGGQTTVIFNAINVIPQKSDIYVSGNASSNSSASASFDLLLVQDGY*
Ga0075506_178825143300006401AqueousGGQTTVIFNAINVIPQKSDIYVSGKASSTSSSSASFDLLLVQDGY*
Ga0070749_1032464713300006802AqueousAINVIPQKSDIYVSGKASSTSSASASFDLLLVQDGY*
Ga0070754_1045609513300006810AqueousQFLNVRGGQTTVIFNAINVIPQKSDIYVSGKASSTSSSSASFDLLLVQDGY*
Ga0075476_1001078313300006867AqueousNVIPEKSDIYVSGKASSTSSASASFDLLLVQDGY*
Ga0075476_1005905743300006867AqueousNVIPQKADIYVSGKASSTSSASASFDLLLVQDGY*
Ga0075479_1000238913300006870AqueousVRGGQTTVIFNAINVIPEKSDIYVSGKASSTSSASASFDLLLVQDGY*
Ga0075475_1001530653300006874AqueousVIFNAINVIPEKSDIYVSGKASSTSSSSASFDLLLVQDGY*
Ga0075475_1030328113300006874AqueousVRGGQTTVIFNSINVIPQKSDIYISGKSSSTSSASASFDLLLVQDGY*
Ga0070750_1004196113300006916AqueousQFLDVRGGQTTVIFNAINVIPEKSDIYVSGKASSTSSASASFDLLLVQDGY*
Ga0070746_1015482663300006919AqueousIFNAINVIPEKSDIYVSGKASSTSSASASFDLLLVQDGY*
Ga0070748_135800513300006920AqueousFLNVRGGQTTVIFNAINVIPQKSDIYVSGKASSTSSASASFDLLLVQDGY*
Ga0075460_1016227943300007234AqueousNVIPQKSDIYVSALASSTSSASASFDLLLVQDGY*
Ga0070745_110462213300007344AqueousGQTTVIFNSINVIPEKSDIYISGKSSSTSSASASFDLLLVQDGY*
Ga0070752_108925343300007345AqueousGGQTTVIFNAINVIPQKSDIYVSAISSSTSSASASFDLLLVQDGY*
Ga0099849_113884813300007539AqueousFNAINVIPEKADIYVSGKASSTSSSSASFDLLLVQDGY*
Ga0099849_118165833300007539AqueousGETTVIFNAINVIPQKSDIYVSGKASSTSSASASFDLLLVQDGY*
Ga0099849_119378113300007539AqueousKQFLDVRGGQTTVIFNAISVIPEKSDIYISALASSTSSASASFDLLLVQDGY*
Ga0099847_106481613300007540AqueousFNAINVIPQKSDIYVSGKASSTSSASATFDLLLVQDGY*
Ga0099850_117564813300007960AqueousAINVIPQKADIYVSALANSTSSASASFDLLLVQDGY*
Ga0075480_1014619713300008012AqueousTTVIFNAINVIPEKSDIYVSGKASSTSSSSASFDLLLVQDGY*
Ga0102963_132140713300009001Pond WaterINVIPEKSDIYISGKASSTSSASASFDLLLVQDGY*
Ga0102963_143525913300009001Pond WaterQTTVIFNAINVIPEKSDIYISGKASSTSSASASFDLLLVQDGY*
Ga0102958_132215313300009035SoilRGGQTTVIFNAINVIPEKSDIYISGKASSTSSASASFDLLLVQDGY*
Ga0118687_1002725613300009124SedimentLDVRGGQTTVIFNAINVIPEKSDIYISGKASSTSSASASFDLLLVQDGY*
Ga0118687_1004900313300009124SedimentLDVRGGQTTVIFNAINVIPEKSDIYVSGKASSTSSASASFDLLLVQDGY*
Ga0129286_1027029813300009515SedimentTTVIFNAINVIPQKSDIYVSGKASSTSSSSASFDLLLVQDGY*
Ga0129348_101658263300010296Freshwater To Marine Saline GradientFNAINVIPQKSDIYVSAIASSTSSASASFDLLLVQDGY*
Ga0129348_109298013300010296Freshwater To Marine Saline GradientNVIPQKSDIYVSAIASSTSSASASFDLLLVQDGY*
Ga0129348_120990713300010296Freshwater To Marine Saline GradientVIFNAINVIPQKSDIYVSGKASSTSSASASFDLLLVQDGY*
Ga0129342_132678913300010299Freshwater To Marine Saline GradientNAINVIPQKSDIYVSAIASSTSSASASFDLLLVQDGY*
Ga0129351_135412033300010300Freshwater To Marine Saline GradientTTVIFNAINVIPQKSDIYVSAIASSTSSSSASFDLLLVQDGY*
Ga0136655_102463543300010316Freshwater To Marine Saline GradientFNAINVIPQKSDIYVSGKASSTSSASASFDLLLVQDGY*
Ga0129333_1000622513300010354Freshwater To Marine Saline GradientTVIFNAISVIPEKSDIYISALASSTSSASASFDLLLVQDGY*
Ga0129333_1030927913300010354Freshwater To Marine Saline GradientGQTTVIFNAINVIPQKSDIYVSGKASSTSSASASFDLLLIQDGY*
Ga0129333_1065817313300010354Freshwater To Marine Saline GradientINVIPQKSDIYVSAIASSTSSASASFDLLLVQDGY*
Ga0129324_1000081913300010368Freshwater To Marine Saline GradientTTVIFNAINVIPQKSDIYVSGKASSTSSASASFDLLLVQDGY*
Ga0129324_1008869753300010368Freshwater To Marine Saline GradientGGQTTVIFNAINVIPQKSDIYVSAIASSTSSASASFDLLLVQDGY*
Ga0129324_1043847623300010368Freshwater To Marine Saline GradientNAINVIPQKSDIYVSAIASSTSSASATFDLLLVQDGY*
Ga0118733_10822896213300010430Marine SedimentQFLNVRGGQTTVIFNAINVIPEKSDIYVSGKASSTSSASASFDLLLVQDGY*
Ga0129327_1020625113300013010Freshwater To Marine Saline GradientINVIPEKSDIYVSGKGSSTSSASASFDLLLVQDGY*
Ga0180120_1000977613300017697Freshwater To Marine Saline GradientTTVMFNAINVIPQKSDIYVSGKASSNSSASASFDLLLVQDGY
Ga0180120_1004919153300017697Freshwater To Marine Saline GradientNAINVIPQKSDIYVSAIASSTSSASASFDLLLVQDGY
Ga0180120_1040021713300017697Freshwater To Marine Saline GradientAINVIPQKSDIYVSGKASSTSSASATFDLLLVQDGY
Ga0194023_110358213300019756FreshwaterTVIFNAINVIPEKSDIYVSGKASSTSSASASFDLLLVQDGY
Ga0193963_118106113300019764Freshwater Microbial MatVRGGQTTVIFNAINVIPQKSDIYVSGKASSTSSSSASFDLLLVQDGY
Ga0194022_100292343300019937FreshwaterIFNAINVIPQKSDIYVSGKASSTSSSSASFDLLLVQDGY
Ga0194032_103436213300019938FreshwaterINVIPEKSDIYVSGKASSTSSASASFDLLLVQDGY
Ga0222718_1001663713300021958Estuarine WaterTTVIFNAINVIPQKSDIYVSGKASSTSSASASFDLLLVQDGY
Ga0222718_1033007643300021958Estuarine WaterVIFNAINVIPEKSDIYISGKASSTSSASASFDLLLVQDGY
Ga0196883_102988033300022050AqueousLFIFNAINVIPQKSDIYVSGKASSTSSSSASFDLLLVQDGY
Ga0212025_100106743300022057AqueousKRGGQTTVIFNAINVIPQKSDIYVSGKASSTSSASASFDLLLVQDGY
Ga0212025_102133853300022057AqueousDVRGGQTTVIFNAINVIPEKSDIYVSGKASSTSSASASFDLLLVQDGY
Ga0212029_101479243300022063AqueousNSINVIPQKSDIYVSAIASSTSSSSASFDLLLVQDGY
Ga0212026_102610643300022069AqueousNAINVIPQKSDIYVSGKASSNSSASASFDLLLVQDGY
Ga0212026_106131233300022069AqueousAINVIPEKADIYVSALASSTSSASASFDLLLVQDGY
Ga0212028_101344413300022071AqueousTVIFNAINIIPQKSDIYVSGKASSTSSASASFDLLLVQDGY
Ga0212028_107257133300022071AqueousLDVRGGQTTVIFNAINVIPQKSDIYVSAIASSTSSASASFDLLLVQDGY
Ga0196897_102176743300022158AqueousAINVIPQKSDIYVSAISSSTSSASASFDLLLVQDGY
Ga0212020_101690113300022167AqueousVRGGQTTVIFNAINVIPQKSDIYVSAISSSTSSASASFDLLLVQDGY
Ga0196903_100975343300022169AqueousLNVRGGETTVMFNAINVIPQKSDIYVSGKASSNSSASASFDLLLVQDGY
Ga0196905_101613613300022198AqueousTTVIFNAVTVIPQKSDIYVSGKASSTSSASASFDLLLVQDGY
Ga0196905_103082053300022198AqueousINVIPQKSDIYVSAIASSTSSASATFDLLLVQDGY
Ga0196905_106359533300022198AqueousIFNAINVIPQKSDIYVSAIASSTSSASASFDLLLVQDGY
Ga0196905_110466043300022198AqueousGQTTVIFNAINVIPQKSDIYISGKSSSTSSASASFDLLLVQDGY
Ga0196905_112112633300022198AqueousVIFNAINVIPQKSDIYVSGKASSTSSASASFDLLLVQDGY
Ga0196901_104600453300022200AqueousGQTTVIFNAINVIPEKADIYVSGKASSTSSASASFDLLLVQDGY
Ga0208148_111080113300025508AqueousNAINVIPEKSDIYVSGKASSTSSSSASFDLLLVQDGY
Ga0208148_112265713300025508AqueousNAINVIPEKSDIYVSGKGSSTSSASASFDLLLVQDGY
Ga0208303_100847573300025543AqueousFNAINVIPQKSDIYVSAIASSTSSASASFDLLLVQDGY
Ga0208303_101362953300025543AqueousLDVRGGQTTVIFNAINVIPQKSDIYISALASSTSSASASFDLLLVQDGY
Ga0208303_107719443300025543AqueousINVIPQKSDIYVSGKASSTSSASASFDLLLVQDGY
Ga0208149_103209213300025610AqueousVRGGQTTVIFNSINVIPQKSDIYISGKSSSTSSASASFDLLLVQDGY
Ga0208149_106625913300025610AqueousVRGGQTTVIFNAINVIPQKSDIYVSGKASSTSSASASFDLLLIQDGY
Ga0208004_101536913300025630AqueousVRGGQTTVIFNAINVIPQKSDIYVSGKASSTSSASASFDLLLVQDGY
Ga0208161_1000797263300025646AqueousRGGQTTVIFNAINVIPQKSDIYISGKSSSTSSASASFDLLLVQDGY
Ga0208161_103693613300025646AqueousQFLNVRGGQTNVIFNAINVIPQKSDIYVSGKASSTSSASASFDLLLVQDGY
Ga0208160_105721643300025647AqueousINVISQKSDIYVSGLASSTSSASASFDLLLVQDGY
Ga0208160_115487613300025647AqueousIFNAINVIPQKSDIYVSGKASSTSSASASFDLLLVQDGY
Ga0208134_110453043300025652AqueousFNAINVIPEKSDIYVSGKASSTSSASASFDLLLVQDGY
Ga0208795_109530323300025655AqueousTVVFNAVSVIPQKSDIYVSAIASSTSSASASFDLLLVQDGY
Ga0208898_104617743300025671AqueousINVIPQKSDIYVSGLASSTSSASASFDLLLVQDGY
Ga0208898_106092213300025671AqueousVRGGQTTVIFNAINVIPEKSDIYVSGKASSTSSSSASFDLLLVQDGY
Ga0208898_115588933300025671AqueousVIFNAINIIPQKSDIYVSGKGSSTSSASASFDLLLVQDGY
Ga0208019_103923613300025687AqueousAINVIPQKADIYVSALANSTSSASASFDLLLVQDGY
Ga0208150_103583613300025751AqueousNVRGGQTTVIFNAINVISEKSDIYISGKASSTSSSSASFDLLLVQDGY
Ga0208899_105396063300025759AqueousVIFNAINVIPEKSDIYVSGKASSTSSSSASFDLLLVQDGY
Ga0208427_119303623300025771AqueousTTVIFNAINVIPHKSDIYVSGKASSTSSSSASFDLLLVQDGY
Ga0208425_105782843300025803AqueousTVIFNAINVIPEKADIYVSALASSTSSASASFDLLLVQDGY
Ga0208543_107655943300025810AqueousGQTTVIFNAINVIPEKSDIYVSGKASSTSSASASFDLLLVQDGY
Ga0208542_110504213300025818AqueousAINVIPQKSDIYVSGKASSTSSSSASFDLLLVQDGY
Ga0208645_1007350113300025853AqueousIFNAINVIPHKSDIYVSGKASSTSSSSASFDLLLVQDGY
Ga0208644_133886033300025889AqueousIFNAINVIPQKSDIYVSGKASSNSSSSASFDLLLVQDGY
Ga0209929_113051013300026187Pond WaterVRGGQTTVIFNAINVIPEKSDIYISGKASSTSSASASFDLLLVQDGY
Ga0209536_10084768413300027917Marine SedimentRGGQTTVIFNAINVIPQKSDIYVSAISSSTSSASASFDLLLVQDGY
Ga0307379_1060367143300031565SoilIFNAINIIPQKSDIYVSGKASSTSSASASFDLLLVQDGY
Ga0348335_036630_1958_20683300034374AqueousAINVIPQKSDIYVSGKASSTSSASASFDLLLVQDGY
Ga0348335_103699_1_1233300034374AqueousVIFNAINVIPQKSDIYVSGKASSTSSSSASFDLLLVQDGY
Ga0348336_002790_13760_138913300034375AqueousQTTVIFNSINVIPEKSDIYISGKSSSTSSASASFDLLLVQDGY
Ga0348336_005875_8248_83913300034375AqueousVRGGQTTVIFNAINVIPEKSDIYVSGKASSTSSASASFDLLLVQDGY
Ga0348336_006130_1_1473300034375AqueousNVRGGQTTVIFNAINVIPQKSDIYVSGKASSTSSASASFDLLLVQDGY

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.