Basic Information | |
---|---|
Family ID | F087339 |
Family Type | Metagenome |
Number of Sequences | 110 |
Average Sequence Length | 49 residues |
Representative Sequence | VNNTDLKEIRMNVGRGLVNDDNFRDDITVDGKVNHGDTTLEKSKL |
Number of Associated Samples | 67 |
Number of Associated Scaffolds | 110 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 10.91 % |
% of genes near scaffold ends (potentially truncated) | 76.36 % |
% of genes from short scaffolds (< 2000 bps) | 86.36 % |
Associated GOLD sequencing projects | 58 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.13 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (70.909 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere (15.454 % of family members) |
Environment Ontology (ENVO) | Unclassified (53.636 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (73.636 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.13 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 110 Family Scaffolds |
---|---|---|
PF13517 | FG-GAP_3 | 10.00 |
PF13418 | Kelch_4 | 5.45 |
PF12951 | PATR | 3.64 |
PF00801 | PKD | 2.73 |
PF04966 | OprB | 1.82 |
PF13415 | Kelch_3 | 1.82 |
PF01344 | Kelch_1 | 1.82 |
PF01839 | FG-GAP | 1.82 |
PF07593 | UnbV_ASPIC | 1.82 |
PF14870 | PSII_BNR | 0.91 |
PF14559 | TPR_19 | 0.91 |
PF01479 | S4 | 0.91 |
PF01894 | UPF0047 | 0.91 |
PF13884 | Peptidase_S74 | 0.91 |
PF14023 | DUF4239 | 0.91 |
PF13927 | Ig_3 | 0.91 |
PF13964 | Kelch_6 | 0.91 |
PF13895 | Ig_2 | 0.91 |
PF00884 | Sulfatase | 0.91 |
PF01797 | Y1_Tnp | 0.91 |
COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
---|---|---|---|
COG3659 | Carbohydrate-selective porin OprB | Cell wall/membrane/envelope biogenesis [M] | 1.82 |
COG0432 | Thiamin phosphate synthase YjbQ, UPF0047 family | Coenzyme transport and metabolism [H] | 0.91 |
COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.91 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 70.91 % |
Unclassified | root | N/A | 29.09 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300004114|Ga0062593_100770184 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
3300004156|Ga0062589_100718916 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
3300004463|Ga0063356_100041862 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 4534 | Open in IMG/M |
3300004463|Ga0063356_101940572 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
3300004480|Ga0062592_101324297 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
3300005093|Ga0062594_103029692 | Not Available | 525 | Open in IMG/M |
3300005093|Ga0062594_103396584 | Not Available | 501 | Open in IMG/M |
3300005290|Ga0065712_10463042 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300005328|Ga0070676_10042648 | Not Available | 2635 | Open in IMG/M |
3300005328|Ga0070676_10509373 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 856 | Open in IMG/M |
3300005328|Ga0070676_11269304 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300005330|Ga0070690_100450239 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 954 | Open in IMG/M |
3300005338|Ga0068868_100623407 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
3300005338|Ga0068868_100631712 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 952 | Open in IMG/M |
3300005347|Ga0070668_100049081 | All Organisms → cellular organisms → Bacteria | 3247 | Open in IMG/M |
3300005347|Ga0070668_101076603 | Not Available | 725 | Open in IMG/M |
3300005353|Ga0070669_100064354 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2700 | Open in IMG/M |
3300005353|Ga0070669_100704958 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
3300005353|Ga0070669_101423901 | Not Available | 602 | Open in IMG/M |
3300005353|Ga0070669_101894808 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300005354|Ga0070675_100558256 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
3300005356|Ga0070674_100985303 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
3300005364|Ga0070673_100120854 | All Organisms → cellular organisms → Bacteria | 2185 | Open in IMG/M |
3300005543|Ga0070672_100096759 | All Organisms → cellular organisms → Bacteria | 2389 | Open in IMG/M |
3300005618|Ga0068864_100857703 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
3300005843|Ga0068860_102712847 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300006237|Ga0097621_101970728 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300006954|Ga0079219_11085001 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
3300009094|Ga0111539_11018678 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 963 | Open in IMG/M |
3300009101|Ga0105247_10818932 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
3300009137|Ga0066709_102487604 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 699 | Open in IMG/M |
3300009176|Ga0105242_11313667 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
3300009176|Ga0105242_12005186 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 621 | Open in IMG/M |
3300009800|Ga0105069_1022100 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
3300010399|Ga0134127_11054378 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
3300010399|Ga0134127_12490959 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300010400|Ga0134122_12038085 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 613 | Open in IMG/M |
3300010401|Ga0134121_11516069 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
3300012908|Ga0157286_10395383 | Not Available | 535 | Open in IMG/M |
3300012951|Ga0164300_10273820 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 869 | Open in IMG/M |
3300012951|Ga0164300_10784906 | Not Available | 588 | Open in IMG/M |
3300012951|Ga0164300_11018834 | Not Available | 534 | Open in IMG/M |
3300012951|Ga0164300_11030494 | Not Available | 532 | Open in IMG/M |
3300012957|Ga0164303_11327023 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300012958|Ga0164299_10269535 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1028 | Open in IMG/M |
3300012960|Ga0164301_10457023 | Not Available | 910 | Open in IMG/M |
3300012960|Ga0164301_11390357 | Not Available | 573 | Open in IMG/M |
3300012961|Ga0164302_10194795 | All Organisms → cellular organisms → Bacteria | 1240 | Open in IMG/M |
3300012961|Ga0164302_11107546 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 626 | Open in IMG/M |
3300012985|Ga0164308_11415915 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 635 | Open in IMG/M |
3300012985|Ga0164308_12243342 | Not Available | 508 | Open in IMG/M |
3300012989|Ga0164305_10948013 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
3300013102|Ga0157371_10869356 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 682 | Open in IMG/M |
3300013296|Ga0157374_10137798 | Not Available | 2367 | Open in IMG/M |
3300013296|Ga0157374_10474068 | Not Available | 1254 | Open in IMG/M |
3300013297|Ga0157378_10047774 | All Organisms → cellular organisms → Bacteria | 3805 | Open in IMG/M |
3300013297|Ga0157378_10828783 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
3300013297|Ga0157378_12849690 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300013306|Ga0163162_10162271 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 2357 | Open in IMG/M |
3300013306|Ga0163162_10915333 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 989 | Open in IMG/M |
3300013306|Ga0163162_12083002 | Not Available | 651 | Open in IMG/M |
3300013308|Ga0157375_11141417 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 913 | Open in IMG/M |
3300014326|Ga0157380_12120293 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 625 | Open in IMG/M |
3300014969|Ga0157376_10030235 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 4323 | Open in IMG/M |
3300014969|Ga0157376_10138412 | All Organisms → cellular organisms → Bacteria | 2181 | Open in IMG/M |
3300014969|Ga0157376_11490230 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
3300015371|Ga0132258_13501963 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1075 | Open in IMG/M |
3300015372|Ga0132256_102827800 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300015372|Ga0132256_103620060 | Not Available | 520 | Open in IMG/M |
3300015373|Ga0132257_100457400 | All Organisms → cellular organisms → Bacteria | 1560 | Open in IMG/M |
3300015373|Ga0132257_103423929 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 577 | Open in IMG/M |
3300015373|Ga0132257_104295231 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300015374|Ga0132255_100545759 | All Organisms → cellular organisms → Bacteria | 1708 | Open in IMG/M |
3300015374|Ga0132255_101258936 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
3300015374|Ga0132255_102085567 | Not Available | 864 | Open in IMG/M |
3300015374|Ga0132255_102590922 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
3300015374|Ga0132255_103185591 | Not Available | 700 | Open in IMG/M |
3300015374|Ga0132255_104393142 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 598 | Open in IMG/M |
3300022756|Ga0222622_10105357 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 1743 | Open in IMG/M |
3300022756|Ga0222622_11307577 | Not Available | 534 | Open in IMG/M |
3300025315|Ga0207697_10511193 | Not Available | 530 | Open in IMG/M |
3300025893|Ga0207682_10566807 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300025903|Ga0207680_10036542 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2829 | Open in IMG/M |
3300025903|Ga0207680_10691423 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
3300025907|Ga0207645_10075808 | Not Available | 2153 | Open in IMG/M |
3300025907|Ga0207645_10633676 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 726 | Open in IMG/M |
3300025907|Ga0207645_11006321 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 564 | Open in IMG/M |
3300025923|Ga0207681_10137164 | Not Available | 1817 | Open in IMG/M |
3300025923|Ga0207681_11089070 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 671 | Open in IMG/M |
3300025923|Ga0207681_11790292 | Not Available | 512 | Open in IMG/M |
3300025925|Ga0207650_10444986 | Not Available | 1078 | Open in IMG/M |
3300025925|Ga0207650_10587729 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
3300025926|Ga0207659_11074397 | Not Available | 692 | Open in IMG/M |
3300025930|Ga0207701_10388348 | Not Available | 1204 | Open in IMG/M |
3300025930|Ga0207701_10413808 | Not Available | 1160 | Open in IMG/M |
3300025931|Ga0207644_10379033 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
3300025931|Ga0207644_10729561 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
3300025936|Ga0207670_11181881 | Not Available | 647 | Open in IMG/M |
3300025937|Ga0207669_11747857 | Not Available | 531 | Open in IMG/M |
3300025940|Ga0207691_10037264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4505 | Open in IMG/M |
3300025972|Ga0207668_10420464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1134 | Open in IMG/M |
3300026035|Ga0207703_11034236 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
3300026035|Ga0207703_12312830 | Not Available | 513 | Open in IMG/M |
3300026088|Ga0207641_10627684 | Not Available | 1054 | Open in IMG/M |
3300026089|Ga0207648_10367572 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1299 | Open in IMG/M |
3300026121|Ga0207683_10116970 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 2390 | Open in IMG/M |
3300026121|Ga0207683_10437603 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
3300027717|Ga0209998_10192335 | Not Available | 532 | Open in IMG/M |
3300028381|Ga0268264_10452455 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
3300028587|Ga0247828_10213296 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 15.45% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.73% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 11.82% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 9.09% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 8.18% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.45% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.55% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.64% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.73% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.73% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.73% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.82% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 1.82% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.82% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.82% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.82% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.82% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.91% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.91% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.91% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.91% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.91% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.91% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.91% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.91% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.91% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.91% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009800 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_30_40 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0062593_1007701841 | 3300004114 | Soil | MTLRTGDVNGDGVVNNTDLKEIRMNVGRGLVNGDNFRDDITVDGKVNHGDT |
Ga0062589_1007189162 | 3300004156 | Soil | DLDEIRMEVGRGLVTEDNFRDDITVDGKVNHGDTTLEKSKL* |
Ga0063356_1000418623 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VNADGRVGTADLKEIKLNVGRGLVTEDNFCDDITVDGKVNHGDTTLKKSKL* |
Ga0063356_1019405721 | 3300004463 | Arabidopsis Thaliana Rhizosphere | SATMTLRTGDVNADGVVGTADLKEIRMEVGRGLVTEDNFRDDITVDGKVNHGDTTLEKSKL* |
Ga0062592_1013242972 | 3300004480 | Soil | VVGTADLKEIRMEVGRGLVTEDNFRDDITVDGKVNHGDTTLEKSKL* |
Ga0062594_1030296922 | 3300005093 | Soil | VSQISETADGVVNNTDLKEIRMNVGRGLVNEDNFRDDITVDGKVNHGDT |
Ga0062594_1033965842 | 3300005093 | Soil | DLKEIKMNVGRGLVNDDNFRDDITVDGKVNHGDTTLEKSKRN* |
Ga0065712_104630422 | 3300005290 | Miscanthus Rhizosphere | MTLRTGDVNADGVVNDTDLKEIKINAGRGLVNDDNFRDDITVDGKVKHSDTTLERSKL* |
Ga0070676_100426481 | 3300005328 | Miscanthus Rhizosphere | DVNADGVVNNTDLKEIKLNVGRGLVNEDNFRDDIRVDGKVNHGDTTLEKSKL* |
Ga0070676_105093731 | 3300005328 | Miscanthus Rhizosphere | VNNTDLKEIRMNVGRGLVNDDNFRDDITVDGKVNHGDTTLEKSKL* |
Ga0070676_112693041 | 3300005328 | Miscanthus Rhizosphere | KEIKMNVGRGLVNDDNFRDDITVDGKVNHGDTTLEKSKL* |
Ga0070690_1004502391 | 3300005330 | Switchgrass Rhizosphere | VVNNKDLMEIRMEVGRGVVTEDNYRDDITVDGKVNHGDTTLEKSKL* |
Ga0068868_1006234072 | 3300005338 | Miscanthus Rhizosphere | MKEIKMNVGQGLVNEDNFRDDITVDGKVNHGDTTLEKSKL* |
Ga0068868_1006317122 | 3300005338 | Miscanthus Rhizosphere | VSQISETADGVVNNTDLKEIRMNVGRGLVNDDNFRDDITVDGKVNHGDTTLEKSK |
Ga0070668_1000490811 | 3300005347 | Switchgrass Rhizosphere | GSVDASATMTLRTGDVNADGIVNNTDLKEIRMNVGRGLVNGDNFRDDITVDGKVNHGDTTLEKSKL* |
Ga0070668_1010766032 | 3300005347 | Switchgrass Rhizosphere | DGVVNNTDLKEIRMNVGRGLVNDDNFRNDITVDGKVNHGDTTLEKSKL* |
Ga0070669_1000643542 | 3300005353 | Switchgrass Rhizosphere | LVSQISETADGVVNNTDLKEIRMNVGRGLVNDDNFRDDITVDGKVNHGDTTLEKSKL* |
Ga0070669_1007049581 | 3300005353 | Switchgrass Rhizosphere | SATMTLRTGDVNADGVVNNTDLKEIRMNVGRGLVTDDNFRDDITVDGKVNHGDTTLEKSKL* |
Ga0070669_1014239011 | 3300005353 | Switchgrass Rhizosphere | VNADGVVGTADLKEIRMNVGRGLVTEDNFRDDITVDGKVNHGDTTLEKSKL* |
Ga0070669_1018948081 | 3300005353 | Switchgrass Rhizosphere | SGSVDASATMTLRTGDVNADGRVGTADLKEIRMNVGRGLVNDDNFRDDITVDGKVNHGDTTLEKSKL* |
Ga0070675_1005582561 | 3300005354 | Miscanthus Rhizosphere | DLKEIRMEVGRGLVTEVNFRDDITVDGKVNHGDTTLEKSKL* |
Ga0070674_1009853031 | 3300005356 | Miscanthus Rhizosphere | VDASATMTLRTGDVNADGIVGTADLKDIKMHLGRGLVDGDNFRDDITVDGKVNHGDTTLEKSKL* |
Ga0070673_1001208542 | 3300005364 | Switchgrass Rhizosphere | DLKEIKMNVGRGLVNENNFRDDITVDGKVNHGDTTLEKSKL* |
Ga0070672_1000967594 | 3300005543 | Miscanthus Rhizosphere | LKEIRMNVGRGLVNDDNFRDDITVDGKVNHGDTTLEKSKL* |
Ga0068864_1008577033 | 3300005618 | Switchgrass Rhizosphere | MEVGRGLVTEDNFRDDITVDGKVNHGDTTLEKSKL* |
Ga0068860_1027128471 | 3300005843 | Switchgrass Rhizosphere | LRTGDVNADGVVNNTDLKEIRMNVGRGLVTDDNFRDDITVDGKVNHGDTTLEKSKL* |
Ga0097621_1019707281 | 3300006237 | Miscanthus Rhizosphere | VVGTRDLKEIKMHLGRGLVGGDDFRDDITVDGKVNHGDTTLEKSKL* |
Ga0079219_110850012 | 3300006954 | Agricultural Soil | ASGSVDASATMTLRTGDVNADGVVGTADLKEIKMEVGRGLVTEDNFRDDITVDGKVNHGDTTLEKSKL* |
Ga0111539_110186781 | 3300009094 | Populus Rhizosphere | DLKEIRMNVGRGLVNDDNFRDDITVDGKVNHGDTTLEKSKL* |
Ga0105247_108189321 | 3300009101 | Switchgrass Rhizosphere | MTLWTGDVNADGVVNNTDLKQTRMNVGRGLVTEDNFRDDITVDGKVNHEDTTLEKSKL* |
Ga0066709_1024876042 | 3300009137 | Grasslands Soil | RTGDVNADGVVGTADLKEIRMNVGRGLVNGDNFRDDITVDGKVNHGDTTLEKSKL* |
Ga0105242_113136671 | 3300009176 | Miscanthus Rhizosphere | LGNYRGLVIEDNFRYDITVDGKVNHGDTTLEKSKL* |
Ga0105242_120051862 | 3300009176 | Miscanthus Rhizosphere | MTLWTGDVNADGVVNNTDLKQTRMNVGRGLVTEDNFRDDITVDGKVNHGDTTLEKSKL* |
Ga0105069_10221001 | 3300009800 | Groundwater Sand | MNVGRGLVNGDNFRDDITVDGKVNHGDTTLEKSKL* |
Ga0134127_110543781 | 3300010399 | Terrestrial Soil | MKEIKMNVGQGLVNEDNFRDDITVDGKVNHGVTTLEKSKL* |
Ga0134127_124909592 | 3300010399 | Terrestrial Soil | MTLWTGDVNADGVVNNTDLKQTRMNVGRGLVNGDNFRDDITVDGKVNHGDTTLEKS |
Ga0134122_120380852 | 3300010400 | Terrestrial Soil | VNADGVVNNTDLKEIRMNVGRGLVTDDNFRDDITVDGKVNHGDTTLEKSKL* |
Ga0134121_115160692 | 3300010401 | Terrestrial Soil | VNLTDLKEIRMNVGRGLVNEDNFRDDITVYGKVNHGDTTLEKSKL* |
Ga0157286_103953831 | 3300012908 | Soil | NNTDLKEIRMNVGRGLVNDDNFRDDITVDGKVNHGDTTLERSKM* |
Ga0164300_102738202 | 3300012951 | Soil | ATMTLRTGDVNADGVVNNKDLKEIRMNVGRGLVTEDNFRDDITVDGKVKHGDTTLEKSKL |
Ga0164300_107849061 | 3300012951 | Soil | ADGVVNNTDLKEIKMEVGRGFVTDDNFRDDITVDGKVNHGDTTLEKSKL* |
Ga0164300_110188341 | 3300012951 | Soil | MTLRTGDVNADGVVNDTDLKEIKMNVGWGLVNDDNLRDDITVDGKVNHSDTTLERSKP* |
Ga0164300_110304941 | 3300012951 | Soil | DVNADGVVNNTDLKEIRMNVGRGLVNGDNFRDDITVDGKVNHGDTTLEKSKL* |
Ga0164303_113270231 | 3300012957 | Soil | MKEIKMNVGRGLVKEDNFRDNITVDGKVNHGDTTLEKSKL* |
Ga0164299_102695352 | 3300012958 | Soil | MSVGRGLVNEDNFRDDITVDGKVNHGDTTQEKSKL* |
Ga0164301_104570231 | 3300012960 | Soil | EIRMNVGRGLVNGDNFRDDITVDGKVNHGDTTLEKSKL* |
Ga0164301_113903571 | 3300012960 | Soil | MSVGRGLVNEDNFRDDITVDGKVNHGDTTLEKSKL* |
Ga0164302_101947951 | 3300012961 | Soil | ATMTLRTGDVNADGVVNDMDLKEIRTNVGRGLVNGDNFRDDITVDGKVNHGDTTLEKSKL |
Ga0164302_111075462 | 3300012961 | Soil | EIRMNVGRGLVNDDNFRDDITVDGKVNHGDTTLEKSKL* |
Ga0164308_114159151 | 3300012985 | Soil | ADGVVNNTDLKEIKMNVGRGLVTEDNFRDDITVDGKVNHGDTTLEKSKL* |
Ga0164308_122433421 | 3300012985 | Soil | MTLRTGDVNADGVVNNTDLKEIRMNVGQGLVNDDNFRDDITVDGKVNHGDTTLEKSKL* |
Ga0164305_109480132 | 3300012989 | Soil | DGVVNNTDLKEIRMNVGRGLVNEDNFRDDIMVDGKVNHGDTTLEKSKL* |
Ga0157371_108693561 | 3300013102 | Corn Rhizosphere | EIKLEVGRGLVTEDNFRDDITVDGKVNHGDTTLERSKL* |
Ga0157374_101377981 | 3300013296 | Miscanthus Rhizosphere | MNVGRGLVTEDNFRDDITVDGKVNHGDTTLEKSKL* |
Ga0157374_104740681 | 3300013296 | Miscanthus Rhizosphere | TLRTGDVNADGALNNTDLKEIRMNVGRGLVTKDNFRDDITIDGKVNHGDTTLEKSKL* |
Ga0157378_100477743 | 3300013297 | Miscanthus Rhizosphere | SVDASATMTLRTGDVNADGVVNRTDLKEIKMSVDRGLVNDDNFRDDITVDGKVNHGDTTLEKSKL* |
Ga0157378_108287831 | 3300013297 | Miscanthus Rhizosphere | MTLWTGDVNADGVVNNTDLKQTRMNVGRGLVTEDNCQDDITVDGKVNHEDTTLEKSKL* |
Ga0157378_128496901 | 3300013297 | Miscanthus Rhizosphere | GVVNRTDLKEIKMEVGRGLVNDDNFHDDITVDGKVNHGDLTLEKSKL* |
Ga0163162_101622714 | 3300013306 | Switchgrass Rhizosphere | SGSVDASATTTLRTGDVNADGVVGTADLKEIRMNVGRGLVNGDNFRDDITVDGKVNHGDTTLEKSKL* |
Ga0163162_109153331 | 3300013306 | Switchgrass Rhizosphere | VSQISETADGVVNNTDLKEIRMNVGRGLVNDDNFRDDITVDGKVNHGDTTLEKSKL* |
Ga0163162_120830021 | 3300013306 | Switchgrass Rhizosphere | IKINAGRGLVNDDNFRDDITVDGKVKHSDTTLERSKL* |
Ga0157375_111414171 | 3300013308 | Miscanthus Rhizosphere | SVDASATMTLRTGDVNTDGHVGTADLKEIRMEVGRGLVTEDNFRDDITVDGKVNHGDTTLEKSKL* |
Ga0157380_121202931 | 3300014326 | Switchgrass Rhizosphere | DVNADGVVGTADLKEIRMNVGRGLVNEDNFRDDITVDGKVNHGDTTLEKSKL* |
Ga0157376_100302357 | 3300014969 | Miscanthus Rhizosphere | DLNEIKLNVGRGLVTEDNFRDDITVDGKVNHGDTTLEKSKL* |
Ga0157376_101384121 | 3300014969 | Miscanthus Rhizosphere | DLKDIKMHLGRGLVDGDNFRDDITVDGKVNHGDTTLEKSKL* |
Ga0157376_114902301 | 3300014969 | Miscanthus Rhizosphere | HKDLKEIRMEVGRGLVTEDNFRDDITVDGKVNHGDTSLEKSKL* |
Ga0132258_135019632 | 3300015371 | Arabidopsis Rhizosphere | TADLKEIKMEVGRGLGNEDNFRDDITVDGKVNHGDTTLEKSKL* |
Ga0132256_1028278002 | 3300015372 | Arabidopsis Rhizosphere | NVGRGLVNDDNFRDDITVDGKVTHGDTTLEKSKL* |
Ga0132256_1036200601 | 3300015372 | Arabidopsis Rhizosphere | EVRMNVGRGLVAEDNFRDDITVDGKVNHGDTILEKSKL* |
Ga0132257_1004574002 | 3300015373 | Arabidopsis Rhizosphere | VNADGVVGTADLKEIRMNVGRGLVNDDNFRDDITVDGKVNHGDTTLEKSKL* |
Ga0132257_1034239291 | 3300015373 | Arabidopsis Rhizosphere | NGASGSVDASATMTLRTGDVNADGRVGTADLKEIRMNVGRGLVNEDNFRDDITVDGKVNHGDTTLEKSKL* |
Ga0132257_1042952312 | 3300015373 | Arabidopsis Rhizosphere | MNVGRGLVNEDNFRDDITVDGKVNHGDTTLEKSKL* |
Ga0132255_1005457593 | 3300015374 | Arabidopsis Rhizosphere | GTADLKEIKMEVGRGLVNEDNFRDDITVDGKVNHGDTTLEKSKL* |
Ga0132255_1012589362 | 3300015374 | Arabidopsis Rhizosphere | MTLRTGDVNADGVIGTADLKEIRMNVGRGLVNDDNFRDDITVDGKVNHGDTTLEKSKL* |
Ga0132255_1020855672 | 3300015374 | Arabidopsis Rhizosphere | MTLRTGDVNADGIVNNTDLKEIRMNVGRGLVNDDSFRDDITVDGKVNHGDTTLEKSKL* |
Ga0132255_1025909221 | 3300015374 | Arabidopsis Rhizosphere | TADINEIRMHIGRGLVDDSDFRDDITVDGHVNHGDKTLAKSKL* |
Ga0132255_1031855911 | 3300015374 | Arabidopsis Rhizosphere | DGVVGTADLKEIRMNVGRGLVNEDNFRDDITVDGKVNHGDTTLEKSKL* |
Ga0132255_1043931421 | 3300015374 | Arabidopsis Rhizosphere | VNADGRVGTADLKEIRMNVGRGLVNDDNFRDDITVDGKVNHGDTTLEKSKL* |
Ga0222622_101053573 | 3300022756 | Groundwater Sediment | VNNTDLKEIRMNVGRGLVTEDNFRDDITVDGKVNHGDTTLEKSKL |
Ga0222622_113075771 | 3300022756 | Groundwater Sediment | LKEIKLNIGRGLVNDDNFRDDITVDGKVNHGDTTLEKSKL |
Ga0207697_105111931 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLRTGDVNADGVVNDTDLKEIKINAGRGLVNDDNFRDDITVDGKVNHGDTTLEKSKL |
Ga0207682_105668072 | 3300025893 | Miscanthus Rhizosphere | TGDVNADGVVNNMDLKEIKMNVGRDLVNDNFRDDITVDGKVNHGDTTVEKLKL |
Ga0207680_100365423 | 3300025903 | Switchgrass Rhizosphere | MTLRTGDVNADGVVNDTDLKEIKINAGRGLVNDDNFRDDITVDGKVKHSDTTLERSKL |
Ga0207680_106914231 | 3300025903 | Switchgrass Rhizosphere | MDLKEIKMNVGRDLVNDNFRDDITVDGKVNHGDTTVEKLKL |
Ga0207645_100758081 | 3300025907 | Miscanthus Rhizosphere | MNVGQGLVNEDNFRDDITVDGKVNHGDTTLEKSKL |
Ga0207645_106336762 | 3300025907 | Miscanthus Rhizosphere | LGNYRGLVIEDNFRDDITVDGKVNHGDTTLEKSKL |
Ga0207645_110063211 | 3300025907 | Miscanthus Rhizosphere | VNNTDLKEIRMNVGRGLVNDDNFRDDITVDGKVNHGDTTLEKSKL |
Ga0207681_101371641 | 3300025923 | Switchgrass Rhizosphere | MHLGRGLVDGDNFRDDITVDGKVNHGDTTLEKSKL |
Ga0207681_110890702 | 3300025923 | Switchgrass Rhizosphere | NNTDLKEIKLNVGRGLVNEDNFRDDIRVDGKVNHGDTTLEKSKL |
Ga0207681_117902921 | 3300025923 | Switchgrass Rhizosphere | ATMTLRTGDVNADGIVNNTDLKEIRMNVGRGLVNGDNFRDDITVDGKVNHGDTTLEKSKL |
Ga0207650_104449862 | 3300025925 | Switchgrass Rhizosphere | SATMTLRTGDVNADGVVGTADLKEIRMNVGRGLVTEDNFRDDITVDGKVNHGDTTLEKSK |
Ga0207650_105877291 | 3300025925 | Switchgrass Rhizosphere | MNVGRGLVTDDNFRDDITVDGKVNHGDTTLEKSKL |
Ga0207659_110743971 | 3300025926 | Miscanthus Rhizosphere | LKEIRMEMGRGLVTEDNFRDDITVDGKVNHGDTTLEKSKL |
Ga0207701_103883482 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | LKEIRMNVGRGLVTEDNFRDDITVDGKVNHGDTTLEKSKL |
Ga0207701_104138081 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | LKEIKMNVGRGLVNDDNFRDDITVDGKVNHGDTTLEKSKL |
Ga0207644_103790331 | 3300025931 | Switchgrass Rhizosphere | SGSVDASATITLRTGDVNADGVVNDTDLKEIKMNVGRGLVNDDNFRDDITVDGKVNHGDTTLEKSKRN |
Ga0207644_107295612 | 3300025931 | Switchgrass Rhizosphere | VVDTADLNEIKMNVGRGLVTEDNYRDDITVDGKVNHGDTTLEKSKL |
Ga0207670_111818811 | 3300025936 | Switchgrass Rhizosphere | DGVVNNTDLQEIRMNVGRGLVNGDNFRDDITVDGKVNHGDTTLERSKL |
Ga0207669_117478571 | 3300025937 | Miscanthus Rhizosphere | SSVDASPTMTLRTGDVNADGVVNDTDLKEIKINAGRGLVNDDNFRDDITVDGKVKHSDTTLERSKL |
Ga0207691_100372641 | 3300025940 | Miscanthus Rhizosphere | ASATMTLRTGDVNADGVVNRTDPKEIKMSVGRGLVNDDNFRDDITVDGKINHGDTTLEKSKL |
Ga0207668_104204642 | 3300025972 | Switchgrass Rhizosphere | ATMTLRTGDVNADGVVGTADLKEIRMEVGRGLVTEDNFRDDITVDGKVNHGDTTLEKSKL |
Ga0207703_110342362 | 3300026035 | Switchgrass Rhizosphere | MKEIKMNVGQGLVNEDNFRDDITVDGKVNHGDTTLEKSKL |
Ga0207703_123128301 | 3300026035 | Switchgrass Rhizosphere | LKDIKMHLGRGLVDGDNFRDDITVDGKVNHGDTTLEKSKL |
Ga0207641_106276842 | 3300026088 | Switchgrass Rhizosphere | RMNVGRGLVTEDNFRDDITVDGKVNHGDTTLEKSKL |
Ga0207648_103675721 | 3300026089 | Miscanthus Rhizosphere | EIRMNIGRGLVNDGNFRTDITVDGKCNHGDKTLAKTKL |
Ga0207683_101169701 | 3300026121 | Miscanthus Rhizosphere | VSSSVDASPTMTLRTGDVNADGVVNDTDLKEIKINAGRGLVNDDNFRDDITVDGKVKHSDTTLERSKL |
Ga0207683_104376031 | 3300026121 | Miscanthus Rhizosphere | GSVDASATMTLRTGDVNADGVVNRTDPKEIKMSVGRGLVNDDNFRDDITVDGKINHGDTTLEKSKL |
Ga0209998_101923352 | 3300027717 | Arabidopsis Thaliana Rhizosphere | IMTLRTGDVNADGVVGTADLKEIRMEVGRGLVNGDNFRDDITVDGKVNHGDTTLEKSKL |
Ga0268264_104524551 | 3300028381 | Switchgrass Rhizosphere | ADGVVNLTDLKEIRMNVGRGLVNEDNFRDDITVDGKVNHGDTTLEKSKL |
Ga0247828_102132962 | 3300028587 | Soil | IKMNVGRGLVNEDNFRDDITVDGKVNHGDTTLEKSKL |
⦗Top⦘ |