Basic Information | |
---|---|
Family ID | F087941 |
Family Type | Metagenome |
Number of Sequences | 110 |
Average Sequence Length | 47 residues |
Representative Sequence | MPEHHEHDDESFPEQVKRLVVDNAFAFVLGWLLGAGHIAALLGDLAGAFS |
Number of Associated Samples | 43 |
Number of Associated Scaffolds | 110 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 30.00 % |
% of genes near scaffold ends (potentially truncated) | 31.82 % |
% of genes from short scaffolds (< 2000 bps) | 67.27 % |
Associated GOLD sequencing projects | 39 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.48 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (83.636 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume (24.546 % of family members) |
Environment Ontology (ENVO) | Unclassified (98.182 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) (49.091 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.87% β-sheet: 0.00% Coil/Unstructured: 55.13% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 110 Family Scaffolds |
---|---|---|
PF16778 | Phage_tail_APC | 27.27 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 87.27 % |
Unclassified | root | N/A | 12.73 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001392|Lau_10012573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 4758 | Open in IMG/M |
3300001392|Lau_10012645 | All Organisms → cellular organisms → Bacteria | 3668 | Open in IMG/M |
3300001392|Lau_10012767 | All Organisms → cellular organisms → Bacteria | 2578 | Open in IMG/M |
3300001392|Lau_10014606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 4736 | Open in IMG/M |
3300001392|Lau_10016566 | All Organisms → cellular organisms → Bacteria | 4798 | Open in IMG/M |
3300001392|Lau_10047112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 2558 | Open in IMG/M |
3300001392|Lau_10050743 | All Organisms → cellular organisms → Bacteria | 2656 | Open in IMG/M |
3300001392|Lau_10055408 | All Organisms → cellular organisms → Bacteria | 4721 | Open in IMG/M |
3300001392|Lau_10055761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 2882 | Open in IMG/M |
3300001392|Lau_10058114 | All Organisms → cellular organisms → Bacteria | 4551 | Open in IMG/M |
3300001392|Lau_10083726 | Not Available | 2554 | Open in IMG/M |
3300001392|Lau_10084810 | All Organisms → cellular organisms → Bacteria | 4749 | Open in IMG/M |
3300001392|Lau_10088767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 3033 | Open in IMG/M |
3300001392|Lau_10089606 | All Organisms → cellular organisms → Bacteria | 6043 | Open in IMG/M |
3300001392|Lau_10090795 | All Organisms → cellular organisms → Bacteria | 2605 | Open in IMG/M |
3300001392|Lau_10093285 | All Organisms → cellular organisms → Bacteria | 2804 | Open in IMG/M |
3300001392|Lau_10095624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 4767 | Open in IMG/M |
3300001392|Lau_10095885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 4658 | Open in IMG/M |
3300001392|Lau_10096024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 3940 | Open in IMG/M |
3300001392|Lau_10116807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 2706 | Open in IMG/M |
3300001392|Lau_10120986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 4679 | Open in IMG/M |
3300001515|KiloMoana_1070848 | Not Available | 1053 | Open in IMG/M |
3300001516|TahiMoana_1084256 | Not Available | 511 | Open in IMG/M |
3300001522|Mariner_1043140 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300001522|Mariner_1112742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 1064 | Open in IMG/M |
3300001524|Abe_1128050 | Not Available | 1283 | Open in IMG/M |
3300001676|TuiMalila_1007020 | Not Available | 3313 | Open in IMG/M |
3300001678|Mariner_1020757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 2008 | Open in IMG/M |
3300001678|Mariner_1022622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 1896 | Open in IMG/M |
3300001678|Mariner_1023544 | All Organisms → cellular organisms → Bacteria | 1845 | Open in IMG/M |
3300001678|Mariner_1028843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 1603 | Open in IMG/M |
3300001678|Mariner_1029237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 1588 | Open in IMG/M |
3300001678|Mariner_1033407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 1449 | Open in IMG/M |
3300001678|Mariner_1034701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 1412 | Open in IMG/M |
3300001679|TahiMoana_1013769 | Not Available | 4513 | Open in IMG/M |
3300001679|TahiMoana_1015992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 2887 | Open in IMG/M |
3300001679|TahiMoana_1023382 | All Organisms → cellular organisms → Bacteria | 2183 | Open in IMG/M |
3300001679|TahiMoana_1026528 | All Organisms → cellular organisms → Bacteria | 1992 | Open in IMG/M |
3300001679|TahiMoana_1034418 | All Organisms → cellular organisms → Bacteria | 1647 | Open in IMG/M |
3300001679|TahiMoana_1036636 | Not Available | 1573 | Open in IMG/M |
3300001679|TahiMoana_1041533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 1435 | Open in IMG/M |
3300001679|TahiMoana_1053536 | Not Available | 1183 | Open in IMG/M |
3300001680|KiloMoana_10021446 | All Organisms → cellular organisms → Bacteria | 3040 | Open in IMG/M |
3300001680|KiloMoana_10027059 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 2619 | Open in IMG/M |
3300001680|KiloMoana_10048553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 1804 | Open in IMG/M |
3300001680|KiloMoana_10052987 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 2804 | Open in IMG/M |
3300001680|KiloMoana_10054184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 1682 | Open in IMG/M |
3300001681|Abe_10015408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 7802 | Open in IMG/M |
3300001681|Abe_10073800 | All Organisms → cellular organisms → Bacteria | 1863 | Open in IMG/M |
3300001681|Abe_10077612 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 1805 | Open in IMG/M |
3300001681|Abe_10099747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 1530 | Open in IMG/M |
3300001681|Abe_10136640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 1214 | Open in IMG/M |
3300005807|Ga0079971_101389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 2439 | Open in IMG/M |
3300005807|Ga0079971_103130 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 1259 | Open in IMG/M |
3300006900|Ga0066376_10473184 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
3300006900|Ga0066376_10779745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 518 | Open in IMG/M |
3300008216|Ga0114898_1057059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 1232 | Open in IMG/M |
3300008216|Ga0114898_1122539 | Not Available | 763 | Open in IMG/M |
3300008217|Ga0114899_1139992 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
3300008219|Ga0114905_1090507 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
3300009173|Ga0114996_10533510 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
3300009412|Ga0114903_1055442 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
3300009412|Ga0114903_1072547 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
3300009414|Ga0114909_1079131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 926 | Open in IMG/M |
3300009418|Ga0114908_1141971 | Not Available | 775 | Open in IMG/M |
3300009603|Ga0114911_1160219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 628 | Open in IMG/M |
3300009604|Ga0114901_1062810 | All Organisms → Viruses → Predicted Viral | 1246 | Open in IMG/M |
3300009605|Ga0114906_1298957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 511 | Open in IMG/M |
3300009622|Ga0105173_1009701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 1331 | Open in IMG/M |
3300009622|Ga0105173_1052977 | All Organisms → Viruses → unclassified bacterial viruses → Bacteriophage sp. | 687 | Open in IMG/M |
3300009622|Ga0105173_1057397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 665 | Open in IMG/M |
3300009622|Ga0105173_1061603 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
3300009622|Ga0105173_1089426 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300009622|Ga0105173_1096598 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300017775|Ga0181432_1120480 | Not Available | 792 | Open in IMG/M |
3300017775|Ga0181432_1195277 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300025046|Ga0207902_1045352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 549 | Open in IMG/M |
3300025069|Ga0207887_1016702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 1149 | Open in IMG/M |
3300025069|Ga0207887_1049619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 684 | Open in IMG/M |
3300025125|Ga0209644_1152870 | Not Available | 550 | Open in IMG/M |
3300025241|Ga0207893_1019911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 931 | Open in IMG/M |
3300025241|Ga0207893_1061152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 542 | Open in IMG/M |
3300025257|Ga0207899_1042900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 739 | Open in IMG/M |
3300025259|Ga0207876_1029595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 777 | Open in IMG/M |
3300025267|Ga0208179_1013372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 2492 | Open in IMG/M |
3300025270|Ga0208813_1051341 | Not Available | 909 | Open in IMG/M |
3300025270|Ga0208813_1057005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 849 | Open in IMG/M |
3300025277|Ga0208180_1051339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 1057 | Open in IMG/M |
3300025296|Ga0208316_1010694 | All Organisms → cellular organisms → Bacteria | 2778 | Open in IMG/M |
3300025305|Ga0208684_1150513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 545 | Open in IMG/M |
3300025873|Ga0209757_10219946 | Not Available | 602 | Open in IMG/M |
3300031606|Ga0302119_10133527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 994 | Open in IMG/M |
3300031623|Ga0302123_10015060 | All Organisms → cellular organisms → Bacteria | 4655 | Open in IMG/M |
3300031800|Ga0310122_10058244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 2037 | Open in IMG/M |
3300031800|Ga0310122_10071967 | All Organisms → Viruses → Predicted Viral | 1783 | Open in IMG/M |
3300031800|Ga0310122_10100772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 1441 | Open in IMG/M |
3300031801|Ga0310121_10240816 | All Organisms → Viruses → Predicted Viral | 1083 | Open in IMG/M |
3300031801|Ga0310121_10562887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 622 | Open in IMG/M |
3300034628|Ga0326755_000791 | All Organisms → cellular organisms → Bacteria | 4062 | Open in IMG/M |
3300034628|Ga0326755_005045 | All Organisms → cellular organisms → Bacteria | 1253 | Open in IMG/M |
3300034628|Ga0326755_005389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 1213 | Open in IMG/M |
3300034628|Ga0326755_005833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 1165 | Open in IMG/M |
3300034628|Ga0326755_017918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 687 | Open in IMG/M |
3300034654|Ga0326741_021328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 1149 | Open in IMG/M |
3300034654|Ga0326741_073992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 563 | Open in IMG/M |
3300034656|Ga0326748_009200 | All Organisms → cellular organisms → Bacteria | 1270 | Open in IMG/M |
3300034656|Ga0326748_013396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 1073 | Open in IMG/M |
3300034656|Ga0326748_027205 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 780 | Open in IMG/M |
3300034656|Ga0326748_034067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 704 | Open in IMG/M |
3300034656|Ga0326748_047196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Acidiferrobacterales → Acidiferrobacteraceae → unclassified Acidiferrobacteraceae → Acidiferrobacteraceae bacterium | 605 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Black Smokers Hydrothermal Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume | 24.55% |
Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 19.09% |
Black Smokers Hydrothermal Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume | 19.09% |
Filtered Seawater | Environmental → Aquatic → Marine → Unclassified → Unclassified → Filtered Seawater | 10.91% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 9.09% |
Marine Oceanic | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic | 5.45% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 4.55% |
Hydrothermal Vent Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Hydrothermal Vent Plume | 3.64% |
Basalt Sediment | Environmental → Aquatic → Marine → Oceanic → Benthic → Basalt Sediment | 1.82% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 1.82% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001392 | ELSC Metagenome | Environmental | Open in IMG/M |
3300001515 | Hydrothermal vent plume microbial communities from Kilo Moana, Pacific Ocean, of black smokers | Environmental | Open in IMG/M |
3300001516 | Hydrothermal vent plume microbial communities from Tahi Moana, Pacific Ocean, of black smokers | Environmental | Open in IMG/M |
3300001522 | Hydrothermal vent plume microbial communities from Mariner/Tui Malila, Pacific Ocean, of black smokers | Environmental | Open in IMG/M |
3300001524 | Abe Hydrothermal Plume | Environmental | Open in IMG/M |
3300001676 | Black smokers hydrothermal plume microbial communities from Tui Malila, Lau Basin, Pacific Ocean | Environmental | Open in IMG/M |
3300001678 | Black smokers hydrothermal plume microbial communities from Mariner, Lau Basin, Pacific Ocean -IDBA | Environmental | Open in IMG/M |
3300001679 | Black smokers hydrothermal plume microbial communities from Tahi Moana, Lau Basin, Pacific Ocean | Environmental | Open in IMG/M |
3300001680 | Black smokers hydrothermal plume microbial communities from Kilo Moana, Pacific Ocean | Environmental | Open in IMG/M |
3300001681 | Black smokers hydrothermal plume microbial communities from Abe, Lau Basin, Pacific Ocean - IDBA | Environmental | Open in IMG/M |
3300005807 | Basalt sediment microbial communities from Loihi, Hawaii, USA - Two Loihi Rocks | Environmental | Open in IMG/M |
3300006900 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_Bottom_ad_5009_LV_A | Environmental | Open in IMG/M |
3300008216 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar | Environmental | Open in IMG/M |
3300008217 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215 | Environmental | Open in IMG/M |
3300008219 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 | Environmental | Open in IMG/M |
3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
3300009412 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s2 | Environmental | Open in IMG/M |
3300009414 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 | Environmental | Open in IMG/M |
3300009418 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 | Environmental | Open in IMG/M |
3300009603 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904 | Environmental | Open in IMG/M |
3300009604 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 | Environmental | Open in IMG/M |
3300009605 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 | Environmental | Open in IMG/M |
3300009622 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3321_4155 | Environmental | Open in IMG/M |
3300017775 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17 | Environmental | Open in IMG/M |
3300025046 | Marine viral communities from the Pacific Ocean - LP-45 (SPAdes) | Environmental | Open in IMG/M |
3300025069 | Marine viral communities from the Pacific Ocean - LP-38 (SPAdes) | Environmental | Open in IMG/M |
3300025125 | Marine viral communities from the Pacific Ocean - ETNP_2_1000 (SPAdes) | Environmental | Open in IMG/M |
3300025241 | Marine viral communities from the Deep Pacific Ocean - MSP-121 (SPAdes) | Environmental | Open in IMG/M |
3300025257 | Marine viral communities from the Deep Pacific Ocean - MSP-134 (SPAdes) | Environmental | Open in IMG/M |
3300025259 | Marine viral communities from the Deep Pacific Ocean - MSP-146 (SPAdes) | Environmental | Open in IMG/M |
3300025267 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar (SPAdes) | Environmental | Open in IMG/M |
3300025270 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904 (SPAdes) | Environmental | Open in IMG/M |
3300025277 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 (SPAdes) | Environmental | Open in IMG/M |
3300025296 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_231 (SPAdes) | Environmental | Open in IMG/M |
3300025305 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 (SPAdes) | Environmental | Open in IMG/M |
3300025873 | Marine viral communities from the Pacific Ocean - ETNP_6_1000 (SPAdes) | Environmental | Open in IMG/M |
3300031606 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_Tmax | Environmental | Open in IMG/M |
3300031623 | Marine microbial communities from Western Arctic Ocean, Canada - CB21_32.1 | Environmental | Open in IMG/M |
3300031800 | Marine microbial communities from Western Arctic Ocean, Canada - CB6_Bottom_1051 | Environmental | Open in IMG/M |
3300031801 | Marine microbial communities from Western Arctic Ocean, Canada - CB27_Tmax_986 | Environmental | Open in IMG/M |
3300034628 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 543_2961 | Environmental | Open in IMG/M |
3300034654 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 487_2244 | Environmental | Open in IMG/M |
3300034656 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 502_2477 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Lau_100125732 | 3300001392 | Black Smokers Hydrothermal Plume | MPDHHEHEEESFPEQVQRIVVDNAFAFVLGWLLGAGHVAALLGDLAGAF* |
Lau_100126456 | 3300001392 | Black Smokers Hydrothermal Plume | MPEHHEHEDESFPEQLKRLVLDNAFAFVLGWLLGAGHIAALLGDLAGAFT* |
Lau_100127672 | 3300001392 | Black Smokers Hydrothermal Plume | MSDESFPEQVQRIVVDNAFAFVLGWLLGAGHVLSLFSDLAGAFS* |
Lau_100146064 | 3300001392 | Black Smokers Hydrothermal Plume | MPEHHEHDDESFPEQLKRLVIDNAFAFVLGWLLGAGHIAALLGDLAGAFT* |
Lau_100165668 | 3300001392 | Black Smokers Hydrothermal Plume | MPEHHEHDDETFLEQVQRLVVDNAFAFVLGWLLGAGHVLSLFSDLAGAFS* |
Lau_100471124 | 3300001392 | Black Smokers Hydrothermal Plume | VEETFLEQVKRLVVDNAFAFVLGWLLGAGHVASLLSDLAGAFS* |
Lau_100507433 | 3300001392 | Black Smokers Hydrothermal Plume | MPEHHDHDEESFPEQLKRLVIDNAFAFVLGWLLGAGHIAALLGDLAGAFT* |
Lau_100554088 | 3300001392 | Black Smokers Hydrothermal Plume | VPEHHEHEDENFLEQVQRLVVDNAFAFVLGWLLGAGHVLSLFSDLAGAFS* |
Lau_100557614 | 3300001392 | Black Smokers Hydrothermal Plume | MPEHHEHADESFPEQLKRLVIDNAFAFVLGWLLGAGHIAALLGDLAGAFT* |
Lau_100581146 | 3300001392 | Black Smokers Hydrothermal Plume | MPEHHEHDEESFPEQLKRLVLDNAFAFVLGWLLGAGHIAALLGDLAGAFT* |
Lau_100837265 | 3300001392 | Black Smokers Hydrothermal Plume | MPEHHEHVDVSFPEQLKRLVIDNAFAFVLGWLLGAGHIAALLGDLAGAFT* |
Lau_100848109 | 3300001392 | Black Smokers Hydrothermal Plume | MPEHHEHGEESFPEQVKRLVVDNAFAFVLGWLLGAGHIAALLGDLAGAFS* |
Lau_100887674 | 3300001392 | Black Smokers Hydrothermal Plume | MPEHHEHEDENFLEQVQRLVVDNAFAFVLGWLLGAGHVLSLFSDLAGAFS* |
Lau_100896066 | 3300001392 | Black Smokers Hydrothermal Plume | MPEHHEHDEESFPEQVKRLVVDNAFAFVLGWLLGAGHIAALLGDLAGAFT* |
Lau_100907954 | 3300001392 | Black Smokers Hydrothermal Plume | MPEHHEHEEESFLEQVQRLVVDNAFAFVLGWLLGAGHIFSLFSDLAGAFS* |
Lau_100932858 | 3300001392 | Black Smokers Hydrothermal Plume | MPEHHEHLDESFPEQLKRLVIDNAFAFVLGWLLGAGHIAALLGDLAGAFT* |
Lau_100956242 | 3300001392 | Black Smokers Hydrothermal Plume | VPEHHEHEDENFVEQVQRLVVDNAFAFVLGWLLGAGHVLSLFSDLAGAFS* |
Lau_100958859 | 3300001392 | Black Smokers Hydrothermal Plume | MSDESFPEQVQRIVVDNAFAFVLGWLLGAGHVMALFSDLAGAFS* |
Lau_100960246 | 3300001392 | Black Smokers Hydrothermal Plume | MPEHHEHDEESFPEQLKRLVIDNAFAFVLGWLLGAGHIAALLGDLAGAFT* |
Lau_101168072 | 3300001392 | Black Smokers Hydrothermal Plume | MPEHHEHEEESFPEQVQRIVVDNAFAFVLGWLLGAGHVVALISDLAGAF* |
Lau_101209868 | 3300001392 | Black Smokers Hydrothermal Plume | MPEHHEHDDETFVEQVQRLVVDNAFAFVLGWLLGAGHVLSLFSDLAGAFS* |
KiloMoana_10708482 | 3300001515 | Hydrothermal Vent Plume | MPEDTDETFPEQVKRLVIDNAFVFTIGWLVGRGYVFDLLGDLAGAFS* |
TahiMoana_10842562 | 3300001516 | Hydrothermal Vent Plume | MPEHHEHEDESVLEQMKRLVIDNAFAFVLGWLLGAGHIAALLGDLAGAFT* |
Mariner_10431403 | 3300001522 | Hydrothermal Vent Plume | MPEHHEHEDESFPEQLKRLVIDNAFAFVLGWLLGAGHIAA |
Mariner_11127423 | 3300001522 | Hydrothermal Vent Plume | MPEHHEHLDESVLEQMKRLVIDNAFAFVLGWLLGAGHIAALLGDLA |
Abe_11280504 | 3300001524 | Black Smokers Hydrothermal Plume | MPEDIDVDESFPEQLKRLVIDNAFAFVLGWLLGAGHIAALL |
TuiMalila_10070202 | 3300001676 | Black Smokers Hydrothermal Plume | MPEHHEHDEESFPEQLKRLLIDNAFAFTIGWLVGRGYVIDLLSDIAGALT* |
Mariner_10207577 | 3300001678 | Black Smokers Hydrothermal Plume | MPEHHEHDDESFPEQVKRLVVDNAFAFVLGWLLGAGHIAALLGDLAGAFS* |
Mariner_10226221 | 3300001678 | Black Smokers Hydrothermal Plume | MPEHHEHGDETFPEQVKRLVVDNAFAFVLGWLLGAGHIAALLGDLAGAFS* |
Mariner_10235442 | 3300001678 | Black Smokers Hydrothermal Plume | MPEHHEHEEESFPEQVKRLVVDNAFAFVLGWLVGRGYVLDLLGDLAGAFS* |
Mariner_10288432 | 3300001678 | Black Smokers Hydrothermal Plume | MPEHHEHVDVSFPEQLKRLLVDNAFAFTIGWLVGRGYVLDLLGDLAGAFT* |
Mariner_10292374 | 3300001678 | Black Smokers Hydrothermal Plume | MPEHHEHGEESFPEQVKRLVLDNAFAFVLGWLLGAGHIAALLGDLAGAFS* |
Mariner_10334072 | 3300001678 | Black Smokers Hydrothermal Plume | MPEHHEHDDESFPEQLKRLVLDNAFAFVLGWLLGAGHIAALLGDLAGAFT* |
Mariner_10347012 | 3300001678 | Black Smokers Hydrothermal Plume | MPEHHEHLDESVLEQMKRLVIDNAFAFVLGWLLGAGHIAALLGDLAGAFT* |
TahiMoana_10137692 | 3300001679 | Black Smokers Hydrothermal Plume | MPEHHDHPDETFPEQLKRLVIDNAFAFVLGWLLGAGHIAALLGDLAGAFT* |
TahiMoana_10159927 | 3300001679 | Black Smokers Hydrothermal Plume | MPEHHEHEEESFPEQVQRLVVDNAFAFVLGWLLGAGHVLSLFSDLAGAFS* |
TahiMoana_10233823 | 3300001679 | Black Smokers Hydrothermal Plume | MPEHHEHGDETFPEQLKRLLIDNAFAFTIGWLVGRGYVIDLLSDIAGALT* |
TahiMoana_10265283 | 3300001679 | Black Smokers Hydrothermal Plume | MPEHHEHEDENFLEQVQRLVVDNAFAFVLGWLLGAGHVLSLFSDLAGAFA* |
TahiMoana_10344181 | 3300001679 | Black Smokers Hydrothermal Plume | MPEHHEHEDENFLEQVQRLVVDNAFAFVLGWLLGAGHVLSLFSDLA |
TahiMoana_10366363 | 3300001679 | Black Smokers Hydrothermal Plume | MTEHHEHEEESFPEQLKRLVIDNAFAFVLGWLLGAGHIAALLGDLAGAFT* |
TahiMoana_10415333 | 3300001679 | Black Smokers Hydrothermal Plume | MPEHHDHDEESFPEQVKRLVVDNAFAFVLGWLLGAGHVASLLSDLAGAFS* |
TahiMoana_10535362 | 3300001679 | Black Smokers Hydrothermal Plume | MPEDIDVDESFPEQLKRLVIDNAFAFVLGWLLGAGHIAALLGDLAGAFT* |
KiloMoana_100214467 | 3300001680 | Black Smokers Hydrothermal Plume | MSDESFPEQVQRIVVDNAFAFVLGWLLGAGHVMSLFSDLAGAFS* |
KiloMoana_100270597 | 3300001680 | Black Smokers Hydrothermal Plume | MPEHHEHLDESFPEQLKRLVIDNAFAFVLGWLLGAGHIAA |
KiloMoana_100485535 | 3300001680 | Black Smokers Hydrothermal Plume | MPEHHDHPDETFPEQLKRLVIDNAFAFVQGWLLGAGHIAALLGDLAGAFT* |
KiloMoana_100529875 | 3300001680 | Black Smokers Hydrothermal Plume | MPEHHEHDEESFPEQVKRLVVDNAFSFVLGWLVGRGYVLDLLGDLAGAFT* |
KiloMoana_100541846 | 3300001680 | Black Smokers Hydrothermal Plume | MPDIDHHDLVDESFPEQLKRLVIDNAFAFVLGWLLGAGHIA |
Abe_100154086 | 3300001681 | Black Smokers Hydrothermal Plume | MPEHHEHDEETFPEQVKRLVVDNAFSFVLGWLLGAGHIAALLGDLAGAFT* |
Abe_100738002 | 3300001681 | Black Smokers Hydrothermal Plume | MPEHHEHDEESFPEQLKRLVLDNAFVFVLGWLVGGGHIAALLGDLAGAFT* |
Abe_100776122 | 3300001681 | Black Smokers Hydrothermal Plume | MPEHHEHEDETFLEQVQRLVVDNAFAFVLGWLLGAGHVLSLFSDLAGAFA* |
Abe_100997474 | 3300001681 | Black Smokers Hydrothermal Plume | MPEHHEHEDESVLEQMKRLVLDNAFVFVLGWLVGGGHIAALLGDLAGAFT* |
Abe_101366401 | 3300001681 | Black Smokers Hydrothermal Plume | MPEHHEHEDENFLEQVQRLVVDNAFAFVLGWLLGAGHIFSLFSDLAGAFS* |
Ga0079971_1013894 | 3300005807 | Basalt Sediment | MPEHHEHGEESFPEQVKRLVVDNAFAFTIGWLVGRGYVIDLLSDIAGALT* |
Ga0079971_1031302 | 3300005807 | Basalt Sediment | MPEHHEHDEESFPEQVKRLVVDNAFAFVLGWLLGAGHIAALLGDLAGAFS* |
Ga0066376_104731843 | 3300006900 | Marine | MLQTTGRWRQMSDESFPEQVQRIVVDNAFAFVLGWLLGAGHVLSLFSDLAGAFS* |
Ga0066376_107797451 | 3300006900 | Marine | HEEESFPEQVQRIVVDNAFAFVLGWLLGAGHVVALISDLAGAF* |
Ga0114898_10570592 | 3300008216 | Deep Ocean | MSDDESFPEQAKRLVIDNAFAFVLGWLVGRGYVFDLLNDLAGAFS* |
Ga0114898_11225391 | 3300008216 | Deep Ocean | MPDDIDETFPEQVKRLVVDNAFAFVLGWLLGAGHIASLLSDLAGAFS* |
Ga0114899_11399923 | 3300008217 | Deep Ocean | MSDDESFPEQAKRLVIDNAFAFVLGWLVGRGYVFDLLNDLD |
Ga0114905_10905071 | 3300008219 | Deep Ocean | MSEESFPEQAKRLVIDNAFAFVLGWLLGAGHIASLLSDLAGAFS* |
Ga0114996_105335103 | 3300009173 | Marine | MSDESFPEQVQRIVVDNAFAFVLGWLLGAGHVLSLFSDLAG |
Ga0114903_10554423 | 3300009412 | Deep Ocean | MSDDESFPEQAKRLVIDNAFAFVLGWLVGRGYVFDLLNDLAGEFS* |
Ga0114903_10725471 | 3300009412 | Deep Ocean | MSDDESFPEQAKRLVIDNAFAFVLGWLVGRGYVFDLLND |
Ga0114909_10791313 | 3300009414 | Deep Ocean | MSDDESFPEQAKRLVIDNAFAFVLGWLLGAGHIASLLSDLAG |
Ga0114908_11419713 | 3300009418 | Deep Ocean | MLRELAGGSRMSEESFPEQAKRLVIDNAFAFVLGWLLGAGHIASLLSDLAGAFS* |
Ga0114911_11602193 | 3300009603 | Deep Ocean | MSDDESFPEQAKRLVIDNAFAFVLGWLLGAGHIASLLSDLAGAFS |
Ga0114901_10628102 | 3300009604 | Deep Ocean | MSDDETFPEQAKRLVIDNAFAFVLGWLVGRGYVFDLLNDLAGAFS* |
Ga0114906_12989572 | 3300009605 | Deep Ocean | MSDESFPEQAKRLVIDNAFAFVLGWLVGRGYVFDLLNDLAGALP* |
Ga0105173_10097014 | 3300009622 | Marine Oceanic | MPEHHEHEEESFPEQVQRIVVDNAFAFVLGWLLGAGHVLSLFSDLAGAFS* |
Ga0105173_10529773 | 3300009622 | Marine Oceanic | MPEHHEHEEESFPEQVQRIVVDNAFAFVLGWLLGAGHVAALLGDLAGAF* |
Ga0105173_10573972 | 3300009622 | Marine Oceanic | FPEQVQRIVVDNAFAFVLGWLLGAGHVVALISDLAGAF* |
Ga0105173_10616033 | 3300009622 | Marine Oceanic | MPDHHEHEEESFPEQVQRIVVDNAFAFVLGWLLGAGHVLSLFSDLAGAFS* |
Ga0105173_10894261 | 3300009622 | Marine Oceanic | MPEHHEHEDENFLEQVQRLVVDNAFAFVLGWLLGAGHVAALLGDLAGAF |
Ga0105173_10965981 | 3300009622 | Marine Oceanic | MPEHHEHEEESFPEQVQRIVVDNAFAFVLGWLLGAGHVVALISDL |
Ga0181432_11204802 | 3300017775 | Seawater | MPEDIDETFPEQVKRLVVDNAFAFVLGWLLGAGHIAALLGDLAGAFT |
Ga0181432_11952772 | 3300017775 | Seawater | MSEESFPEQAKRLVIDNAFAFVLGWLVGRGYVFDLLNDLAGAFS |
Ga0207902_10453522 | 3300025046 | Marine | FPEQVKRLVLDNAFAFVLGWLLGAGHIAALLGDLAGAFS |
Ga0207887_10167022 | 3300025069 | Marine | MPEHHEHADESFPEQVKRLVVDNAFAFVLGWLLGAGHVASLLSDLAGAFS |
Ga0207887_10496192 | 3300025069 | Marine | MPDVEETFLEQAKRLVVDNAFAFVLGWLLGAGHIAALLGDLAGAFS |
Ga0209644_11528701 | 3300025125 | Marine | MPEDIDETFPEQVKRLVVDNAFAFVLGWLLGAGHIAALLGDLAGAFS |
Ga0207893_10199113 | 3300025241 | Deep Ocean | MPEHHEHDEESFPEQLKRLVLDNAFAFVLGWLLGAGHIAALLGDL |
Ga0207893_10611522 | 3300025241 | Deep Ocean | PEQVQRIVVDNAFAFVLGWLLGAGHVLTLFSDLAGAFS |
Ga0207899_10429003 | 3300025257 | Deep Ocean | FPEQVQRIVVDNAFAFVLGWLLGAGHVMALFSDLAGAFS |
Ga0207876_10295953 | 3300025259 | Deep Ocean | MPEHHEHEEESFPEQVKRLVVDNAFAFVLGWLLGAGHIAALLGDL |
Ga0208179_10133723 | 3300025267 | Deep Ocean | MSEESFPEQAKRLVIDNAFAFVLGWLLGAGHIASLLSDLAGAFS |
Ga0208813_10513413 | 3300025270 | Deep Ocean | GGSRMSEESFPEQAKRLVIDNAFAFVLGWLLGAGHIASLLSDLAGAFS |
Ga0208813_10570053 | 3300025270 | Deep Ocean | MSDDESFPEQAKRLVIDNAFAFVLGWLLGAGHIASLLSDLA |
Ga0208180_10513393 | 3300025277 | Deep Ocean | MSEESFPEQAKRLVIDNAFAFVLGWLLGAGHIASLLS |
Ga0208316_10106941 | 3300025296 | Deep Ocean | MPDDIDETFPEQVKRLVVDNAFAFVLGWLLGAGHIASLLSDLAGAFS |
Ga0208684_11505133 | 3300025305 | Deep Ocean | MSDDESFPEQAKRLVIDNAFAFVLGWLVGRGYVFD |
Ga0209757_102199462 | 3300025873 | Marine | MPEHHEHGEESFPEQVKRLVLDNAFAFVLGWLVGRGYVLDLLGDLAGAFS |
Ga0302119_101335271 | 3300031606 | Marine | FPEQVQRIVVDNAFAFVLGWLLGAGHVLSLFSDLAGAFS |
Ga0302123_100150605 | 3300031623 | Marine | MWMSDESFPEQVQRIVVDNAFAFVLGWLLGAGHVLSLFSDLAGAFS |
Ga0310122_100582441 | 3300031800 | Marine | EDENFLEQVQRLVVDNAFAFVLGWLLGAGHVMALFSDLAGAFS |
Ga0310122_100719673 | 3300031800 | Marine | MSDESFPEQVQRIVVDNAFAFVLGWLLGAGHVAALFSDLAGAFS |
Ga0310122_101007721 | 3300031800 | Marine | MPEHHEHEEESFPEQVQRIVVDNAFAFVLGWLLGAGHVLSLFSDL |
Ga0310121_102408162 | 3300031801 | Marine | MPEHHEEESFPEQVQRIVVDNAFAFVLGWLLGAGHVLSLFSDLAGAFS |
Ga0310121_105628872 | 3300031801 | Marine | MPDEVESFPEQVQRIIVDNAFAFVLGWLLGAGHVLSLFSDLAGAFS |
Ga0326755_000791_2025_2177 | 3300034628 | Filtered Seawater | MPEHHEHAEESFPEQVKRLVVDNAFAFVLGWLLGAGHIAALLGDLAGAFS |
Ga0326755_005045_43_198 | 3300034628 | Filtered Seawater | MMPEHHEHTDENFLEQVQRLVVDNAFAFVLGWLLGAGHVMALFSDLAGAFS |
Ga0326755_005389_1016_1174 | 3300034628 | Filtered Seawater | MTMPEHHEHDDETFLEQVQRLVVDNAFAFVLGWLLGAGHVLSLFSDLAGAFS |
Ga0326755_005833_1020_1163 | 3300034628 | Filtered Seawater | MPEHHEHEEESFPEQVQRIVVDNAFAFVLGWLLGAGHVAALLGDLAGA |
Ga0326755_017918_561_686 | 3300034628 | Filtered Seawater | ESFPEQVKRLVVDNAFAFVLGWLLGAGHIAALLGDLAGAFS |
Ga0326741_021328_51_209 | 3300034654 | Filtered Seawater | MTMPEHHEHEDESFPEQVQRIVVDNAFAFVLGWLLGAGHVLSLFSDLAGAFS |
Ga0326741_073992_429_563 | 3300034654 | Filtered Seawater | EHEEESFPEQVQRIVVDNAFAFVLGWLLGAGHVAALLGDLAGAF |
Ga0326748_009200_2_142 | 3300034656 | Filtered Seawater | MMPEHHEHTDENFLEQVQRLVVDNAFAFVLGWLLGAGHVMALFSDLA |
Ga0326748_013396_945_1073 | 3300034656 | Filtered Seawater | MSDESFPEQVQRIVVDNAFAFVLGWLLGAGHVMALFSDLAGAF |
Ga0326748_027205_581_733 | 3300034656 | Filtered Seawater | MPEHHEHGEETFPEQVKRLVLDNAFAFVLGWLLGAGHIAALLGDLAGAFT |
Ga0326748_034067_3_119 | 3300034656 | Filtered Seawater | PEQLKRLVIDNAFAFVLGWLLGAGHIAALLGDLAGAFT |
Ga0326748_047196_23_175 | 3300034656 | Filtered Seawater | MPEHHEHDEESFPEQVKSLVVDNAFAFVLGWLVGRGYVLDLLGDLAGAFS |
⦗Top⦘ |