NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F088054

Metagenome / Metatranscriptome Family F088054

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F088054
Family Type Metagenome / Metatranscriptome
Number of Sequences 109
Average Sequence Length 82 residues
Representative Sequence MHTDQATEIHLTRPFQQLHRYKIRQSILLATATLASSFQLATVTTTFSFPWSIAIVVDGDDGVVVVGAGEAADMGRTVATGQTPT
Number of Associated Samples 96
Number of Associated Scaffolds 109

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 39.45 %
% of genes from short scaffolds (< 2000 bps) 96.33 %
Associated GOLD sequencing projects 95
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere
(62.385 % of family members)
Environment Ontology (ENVO) Unclassified
(87.156 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant surface
(67.890 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 25.88%    β-sheet: 27.06%    Coil/Unstructured: 47.06%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005347|Ga0070668_100315641All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1314Open in IMG/M
3300005355|Ga0070671_100379733All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1208Open in IMG/M
3300005367|Ga0070667_100285671All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1483Open in IMG/M
3300005548|Ga0070665_101994156All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum586Open in IMG/M
3300009972|Ga0105137_103227All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum720Open in IMG/M
3300009977|Ga0105141_114168All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum692Open in IMG/M
3300009980|Ga0105135_100816All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1409Open in IMG/M
3300009980|Ga0105135_112715All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum670Open in IMG/M
3300009981|Ga0105133_100821All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1354Open in IMG/M
3300009981|Ga0105133_101412All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1175Open in IMG/M
3300009989|Ga0105131_105874All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum948Open in IMG/M
3300009989|Ga0105131_113919All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum730Open in IMG/M
3300009990|Ga0105132_133711All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum558Open in IMG/M
3300009992|Ga0105120_1015966All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum788Open in IMG/M
3300009995|Ga0105139_1048851All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum739Open in IMG/M
3300010396|Ga0134126_12624784All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum547Open in IMG/M
3300010399|Ga0134127_11147016All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum842Open in IMG/M
3300010401|Ga0134121_11086294All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum792Open in IMG/M
3300010403|Ga0134123_10539019All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1108Open in IMG/M
3300014325|Ga0163163_11767314All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum679Open in IMG/M
3300014326|Ga0157380_10244398All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1620Open in IMG/M
3300014968|Ga0157379_10340418All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1372Open in IMG/M
3300015270|Ga0182183_1043139All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum648Open in IMG/M
3300015273|Ga0182102_1035602All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum544Open in IMG/M
3300015280|Ga0182100_1004515All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1280Open in IMG/M
3300015280|Ga0182100_1089897All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum522Open in IMG/M
3300015284|Ga0182101_1031041All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum740Open in IMG/M
3300015284|Ga0182101_1061745All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum596Open in IMG/M
3300015290|Ga0182105_1014232All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum965Open in IMG/M
3300015293|Ga0182103_1008114All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1069Open in IMG/M
3300015301|Ga0182184_1036059All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum712Open in IMG/M
3300015301|Ga0182184_1046640All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum655Open in IMG/M
3300015306|Ga0182180_1086175All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum521Open in IMG/M
3300015309|Ga0182098_1029129All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum826Open in IMG/M
3300015311|Ga0182182_1001137All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum2238Open in IMG/M
3300015311|Ga0182182_1050947All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum687Open in IMG/M
3300015312|Ga0182168_1037659All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum807Open in IMG/M
3300015313|Ga0182164_1006397All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1375Open in IMG/M
3300015315|Ga0182120_1082372All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum617Open in IMG/M
3300015318|Ga0182181_1053109All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum658Open in IMG/M
3300015319|Ga0182130_1004141All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1476Open in IMG/M
3300015319|Ga0182130_1007865All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1247Open in IMG/M
3300015324|Ga0182134_1128723All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum532Open in IMG/M
3300015325|Ga0182148_1002708All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1714Open in IMG/M
3300015325|Ga0182148_1107672All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum567Open in IMG/M
3300015326|Ga0182166_1096095All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum590Open in IMG/M
3300015327|Ga0182114_1087244All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum648Open in IMG/M
3300015327|Ga0182114_1109988All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum592Open in IMG/M
3300015329|Ga0182135_1043408All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum808Open in IMG/M
3300015329|Ga0182135_1067684All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum693Open in IMG/M
3300015330|Ga0182152_1028591All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum931Open in IMG/M
3300015331|Ga0182131_1151575All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum509Open in IMG/M
3300015332|Ga0182117_1016506All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1188Open in IMG/M
3300015334|Ga0182132_1072615All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum710Open in IMG/M
3300015335|Ga0182116_1145967All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum552Open in IMG/M
3300015337|Ga0182151_1005945All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1498Open in IMG/M
3300015338|Ga0182137_1026185All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1051Open in IMG/M
3300015353|Ga0182179_1003729All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum2627Open in IMG/M
3300015354|Ga0182167_1276222All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum601Open in IMG/M
3300017412|Ga0182199_1134224All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum595Open in IMG/M
3300017414|Ga0182195_1194303All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum531Open in IMG/M
3300017435|Ga0182194_1042448All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum809Open in IMG/M
3300017435|Ga0182194_1042463All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum809Open in IMG/M
3300017440|Ga0182214_1080896All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum677Open in IMG/M
3300017447|Ga0182215_1001925All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae4430Open in IMG/M
3300017691|Ga0182212_1018121All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1476Open in IMG/M
3300017692|Ga0182210_1039316All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum959Open in IMG/M
3300020223|Ga0182118_102897All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum810Open in IMG/M
3300022465|Ga0213505_112193All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum712Open in IMG/M
3300025922|Ga0207646_10877902All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum796Open in IMG/M
3300025925|Ga0207650_10152183All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1826Open in IMG/M
3300028051|Ga0268344_1015850All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum589Open in IMG/M
3300028053|Ga0268346_1005275All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum948Open in IMG/M
3300028056|Ga0268330_1044175All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum572Open in IMG/M
3300028058|Ga0268332_1036418All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum667Open in IMG/M
3300028058|Ga0268332_1045658All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum618Open in IMG/M
3300028142|Ga0268347_1023619All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum569Open in IMG/M
3300028143|Ga0268348_1000217All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum2062Open in IMG/M
3300028144|Ga0268345_1012067All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum658Open in IMG/M
3300028152|Ga0268336_1010286All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum702Open in IMG/M
3300028153|Ga0268320_1010490All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum688Open in IMG/M
3300028256|Ga0268304_1004916All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum719Open in IMG/M
3300028379|Ga0268266_10969896All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum823Open in IMG/M
3300028464|Ga0268302_104202All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum642Open in IMG/M
3300028470|Ga0268307_1016325All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum574Open in IMG/M
3300028471|Ga0268323_1000502All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1441Open in IMG/M
3300028477|Ga0268309_1002515All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum915Open in IMG/M
3300028523|Ga0268313_1008594All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum646Open in IMG/M
3300032464|Ga0214492_1082582All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum610Open in IMG/M
3300032466|Ga0214503_1105442All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum878Open in IMG/M
3300032468|Ga0214482_1105286All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum530Open in IMG/M
3300032490|Ga0214495_1104837All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum649Open in IMG/M
3300032514|Ga0214502_1170484All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum835Open in IMG/M
3300032551|Ga0321339_1058725All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum882Open in IMG/M
3300032590|Ga0214489_1052120All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum611Open in IMG/M
3300032591|Ga0214484_1074585All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum714Open in IMG/M
3300032697|Ga0214499_1230228All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum572Open in IMG/M
3300032759|Ga0314720_1032787All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum635Open in IMG/M
3300032761|Ga0314733_1060889All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum723Open in IMG/M
3300032781|Ga0314742_1061494All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum654Open in IMG/M
3300032792|Ga0314744_1101729All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum541Open in IMG/M
3300032822|Ga0314740_1056002All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum589Open in IMG/M
3300032823|Ga0314723_1094421All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum559Open in IMG/M
3300032843|Ga0314736_1025206All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum774Open in IMG/M
3300032914|Ga0314750_1097075All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum686Open in IMG/M
3300032959|Ga0314738_1027853All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1010Open in IMG/M
3300033523|Ga0314768_1321025All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum539Open in IMG/M
3300033535|Ga0314759_1252213All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum559Open in IMG/M
3300033542|Ga0314769_1261088All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum581Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere62.39%
PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere14.68%
Switchgrass AssociatedHost-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated10.09%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere5.50%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.83%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.92%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.92%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300009972Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_224 metaGHost-AssociatedOpen in IMG/M
3300009977Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_91 metaGHost-AssociatedOpen in IMG/M
3300009980Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaGHost-AssociatedOpen in IMG/M
3300009981Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaGHost-AssociatedOpen in IMG/M
3300009989Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaGHost-AssociatedOpen in IMG/M
3300009990Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaGHost-AssociatedOpen in IMG/M
3300009992Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaGHost-AssociatedOpen in IMG/M
3300009995Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaGHost-AssociatedOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015270Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015273Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015280Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015284Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015290Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015293Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015301Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015306Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015309Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015311Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015312Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015313Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015315Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015318Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015319Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015324Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015325Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015326Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015327Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015329Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015330Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015331Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015332Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015334Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015335Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015337Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015338Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015353Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015354Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017412Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017414Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017435Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017440Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017447Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017691Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017692Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300020223Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_31MAY2016_LD2 MGHost-AssociatedOpen in IMG/M
3300022465Metatranscriptome of phyllosphere microbial comminities from switchgrass, Michigan, USA - G5R1_MAIN_12JUL2016_LR1 MT pilot (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028051Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028053Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028056Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028058Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028142Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028143Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_18SEP2017_LD1Host-AssociatedOpen in IMG/M
3300028144Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028152Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028153Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028256Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_15MAY2017_LD1Host-AssociatedOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028464Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_15MAY2017_LD1Host-AssociatedOpen in IMG/M
3300028470Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_15MAY2017_LD1Host-AssociatedOpen in IMG/M
3300028471Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028477Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028523Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300032464Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032466Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032468Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032490Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032514Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032551Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032590Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_31MAY2016_LR3 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032591Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032697Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032759Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_15MAY2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032761Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032781Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032792Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032822Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032823Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032843Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032914Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032959Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033523Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033535Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033542Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0070668_10031564113300005347Switchgrass RhizosphereMYMHTDQATEIHLTRPFQQLHRYKIRQSILLATATLASSFQLATVTTTFSFPWSIAIVVDGDDGVVVVGAGEAADMGRTVATGQTPT*
Ga0070671_10037973313300005355Switchgrass RhizosphereMYMHTDQATEIHLARPFQQLHRYKIRQSILLATATLASSFQLATVTTTFSFPWSIAIVVYGDDGVDAGEAADMGRTVATGQTPT*
Ga0070667_10028567123300005367Switchgrass RhizosphereMHTDQATEIHLTRPFQQLHRYKIRQSILLATATLASSFQLATVTTTFSFPWSIAIVVDGDDGVVVVGAGEAADMGRTVATGQTPT*
Ga0070665_10199415613300005548Switchgrass RhizosphereMYMHTDKATEIHLIRPFQQLHRYKIRQSILLATATLASSFQLATVTTTFSFPWSIAIVVDGDDGVIVVGAGEA
Ga0105137_10322713300009972Switchgrass AssociatedMHTDQATEIHLTRPFQQLHRYKIRQSILLATATLASSFQLATVTTTFSFPWSIAIVVDGDDGVVVVGAVEAADMGRTVATGQTST*
Ga0105141_11416823300009977Switchgrass AssociatedMHTDQSTEIHLTRPFQQLHRYKIRQSILLATATLASSFQLATVTTTFSFPWSIAIIVDGDDGVVVVGAREAADMGGTVATGQTPT*
Ga0105135_10081623300009980Switchgrass AssociatedMHTDQATQIHLTRPFQQLHRYKIRQSILLATATLASSFQLATVTTTFSFPWSIAIVVDGDDGVVVVGAGEAADMGRTVATGQTPT*
Ga0105135_11271513300009980Switchgrass AssociatedMHTDKATEIHLTRPFQQLHRYKIWQSILLATTTLASSFQLGTVTTTFSFPWSIGIVVDGDDGVVVVVGAGEATDMGCTVATGQTPT*
Ga0105133_10082123300009981Switchgrass AssociatedYMHKDQATEIHLTRSLQQLHRYKIRQSILLATATLASSFQLATVTTTFSFPWSIAIVVDGDDGVVVVGTGEAAGMGRTVATWQTPT*
Ga0105133_10141223300009981Switchgrass AssociatedMHTDKATEIHLTRPFQQLHRYKIRQSILLATATLASSFQLGTVTTTFSFSWSIGIVVDGDDGVVVVVGAGEATDMGCTVVTGQTPT*
Ga0105131_10587423300009989Switchgrass AssociatedMHTDQATEIHLTRPFQQLHRYKIRKILLLATATLASSFQLATVTTTFSFPWSIAIVVDGDDGVVVVGAGEAADMGRTVATGQTPT*
Ga0105131_11391913300009989Switchgrass AssociatedMHTDQATEIHLTRPFQQLHRYKIRQSILLATATLASSFQLATVTTTFSFPWSIAIVVDGDDGVVVVGAGEAADMGRTVA
Ga0105132_13371123300009990Switchgrass AssociatedMHTEKATEIHLTRPFQQLHQYKIRQSILLATATLASSFQLGTVTTTFSFPWSIGIVVDGDDGVVVVVGAGEATDMGCTVATGQTPT*
Ga0105120_101596613300009992Switchgrass AssociatedMHTDQATEIHLTRPFQQLHRYKIRQNILLATATLASSFQLGTLTTTFSFPWSIATVVDGDDGVVVVVGAGEATDMGCTVATGQTPN*
Ga0105139_104885123300009995Switchgrass AssociatedMHTEKATEIHLTRPFQQLHRYKIRQSILLATATLASSFQLGTVTTTFSFPWSIGIVVDGDDGVVVVVGAGEATDMGCTVATGQTPT*
Ga0134126_1262478413300010396Terrestrial SoilKATEIHLTRPFQQLHRYKIRQSILLATANLASSFQLGTVTTTFSFPWSIGIVVDGDDGVVVVVGAGEATDMGCTVATGQTPT*
Ga0134127_1114701613300010399Terrestrial SoilMHTDQATEIHLTRPLQQLHRYKIRQSILLATATLASSFQLATVTTTFSFPWSIAIVVYGDDGVVVVGAGEAADM
Ga0134121_1108629413300010401Terrestrial SoilMHTDQATEIHLTRPFQQLHRYKIRQSILLATATLASSFQLATVTTTLSFPWSIAIVVYGDDGVVVVGAGEAADMG
Ga0134123_1053901923300010403Terrestrial SoilMHTDQATEIHLTRPFQQLHRYKIRQSILLATATLASSFQLATVTTTFSFPWSIAIVVYGDDGVVVVGAGEAADMGRTVATGQTPT*
Ga0163163_1176731413300014325Switchgrass RhizosphereEIHLTRPFQQLHRYKIRQSILLATATLASSFQLATVTTTFSFPWSIAIVVDGDDGVVVVGAGEAADMGRTVATGQTPT*
Ga0157380_1024439823300014326Switchgrass RhizosphereMHTDQATEIHLTRPFQQLHRYKIRQSILLATVTLASSFQLATVTTTFSFPWSWSIAIVVDGDDGVVVVVGAGEAADMGRTVATGQTPT*
Ga0157379_1034041813300014968Switchgrass RhizosphereMHTDQATEIHLTRPLQQLHRYKIRQSILLATATLASSFQLATVTTTFSFPWSIAIVVDGDDGVVVVGAGEAADMGRTVATGQTPT*
Ga0182183_104313923300015270Switchgrass PhyllosphereMHTDKATEIHLTRPFQQLHRYKIRQSILLATATLASSFQLGTVTTTFSFPWSIGIVVDGDDGVVVVVGAGEATDMGCTVATGQTPT*
Ga0182102_103560213300015273Switchgrass PhyllosphereMHTDQATEIHLTRPFQQLHRYKIRQSILLATATLASSFQLATVTTTISFPWSIAIVVDGDDGVVVVGAGEAANMGRTVATGQTPT*
Ga0182100_100451513300015280Switchgrass PhyllosphereMHTDQATEIHLTRPLQQLHRYKIRQSILLATATLASSFQLATVTTTFSFPWSIAIVVYGDDGVDAGEAADMGRTVATGQTPT*
Ga0182100_108989713300015280Switchgrass PhyllosphereMHTDQATEIHLTRPFQQLHRYKIRQSILLATATLASSFQLATVTTTFSFPWSIAIVVDGDDGVVVVGAGEAADMCRTVATGQTPT*
Ga0182101_103104123300015284Switchgrass PhyllosphereMHTDQATESHLIRPFQQLHRYKIWQSILLATATLASSFQLAIVTTSFSFPWSIAIVVVDGDDGVVVVVVGAGEAADMGRIVATGQTPT*
Ga0182101_106174523300015284Switchgrass PhyllosphereMHTDQATQIHLTRPFQQLHRYKIRQSILLATATLASSFQLATVTTTFSFPWSIAIVVDGDDGVVVVVGAREATDMGCTVATGQTPT*
Ga0182105_101423223300015290Switchgrass PhyllosphereMHTEKATEIHLTRPFQQLHRYKIRQSILLATATLASSFQLGTVTTTFSFPWSIGIVVDGDDGVVVVVGAGEATDMGCTVATG*
Ga0182103_100811413300015293Switchgrass PhyllosphereMYMHTDQATQIHLTRPFQQLHRYKIQQSILLATATLASSFQLATVTTTSSIPWSIAIVVDGDDGVVVVGAGEAADMGRTVATGQTPT*
Ga0182184_103605913300015301Switchgrass PhyllosphereEIHLTRPFQQLHRYKIRQSILLATATLASSFQLATVTTTSFFPWSIAIVVDGDDGVVVVGAGEAADMGRTVATGQTPT*
Ga0182184_104664013300015301Switchgrass PhyllosphereLQQLHRYKIRQSILLATATLASSFQLATVTTTASFPWSIAIVVDGDDGVVVVGAGEAADMGRIVATGQTPT*
Ga0182180_108617523300015306Switchgrass PhyllosphereMHTEKATEIHLTKPFQQLHRYKIRQSILLATATLASSFQLGTVTTTFSFPWSIGIVVDGDDGVVVVVGAGEATDMGCTAV*
Ga0182098_102912913300015309Switchgrass PhyllosphereFQQLHRYKIRQSILLATATLASSFQLATVTTTFSFPWSIAIVVDGDDGVVVVGAGEAADMGRTVATGQTPT*
Ga0182182_100113733300015311Switchgrass PhyllosphereMHTDQATEIHLTRPFQQLHRYKIRQSILLATATLASSFQLATVTTTFSFPWSIAIVVYGDDGVDAGEAADMGRTVATGQTPT*
Ga0182182_105094713300015311Switchgrass PhyllosphereMHTDQATEIHLTRPFQQLHRYKIRQSILLATATLASSFHLATVTTTFSFPWSIAIVVYGDDGVVVVGAGEAADMGRTVATGQTPT*
Ga0182168_103765913300015312Switchgrass PhyllosphereATEIHLTRPFQQLHRYKIRQSILLATATLASSFQLGQLGTLTTTFSFPWSIGIVVDGDDGVVVVVGAGEATDMGCTVATGQTPT*
Ga0182164_100639723300015313Switchgrass PhyllosphereMHTKKATEIHLTRPFQQLHRYKIRQSILLATATLASSFQLGTVTTTFSFPWSIGIVVDGDDGVVVVVGAGEATDMGCTVATGQTPT*
Ga0182120_108237213300015315Switchgrass PhyllosphereQIKQQKSISQRPFQQLHRYKIRQSIFLATATLASSFQLATVTTTFSFPWSIAIVVDGDDGVVVVGAGEAADMGRTVATGQTPT*
Ga0182181_105310913300015318Switchgrass PhyllosphereMHTDKVTEIHLTRPFQQLHRYKIRQSILLATATLASSFQLGTVTTTFSFPWSIGIVVDGDDGVVVVVDAGEATDMGSTVATGQTPT*
Ga0182130_100414113300015319Switchgrass PhyllosphereNKATEIHLTRPFQQLHQYKIRQSILLATATLASSFQLGTVTTTFSFPWSIAIVVYGDDGVVVVGAGEAADIGHTVAIGQTPT*
Ga0182130_100786513300015319Switchgrass PhyllosphereMHTDQATEIHLTRSFQQLHRYKIRQSILLATATLASSFQLATVTTTFSFPWSIAIVVDGDDGVVVVGAGEAADMGRTVATGQTPT*
Ga0182134_112872313300015324Switchgrass PhyllosphereMHTDQATESHLIRPFQQLHRYKIWQSILLATATLASSFQLAIVTTSFSFPWGIAIVVVDGDDGVVVVVVGAGEAADMGRIVATGQTPT*
Ga0182148_100270813300015325Switchgrass PhyllosphereMHTDQATEIHLTRPLQQLHRYKIRQSILLATATLASSFQLATVTTTFSFPWSIAIVVDGDDGVVVVGAGEVADMG
Ga0182148_110767213300015325Switchgrass PhyllosphereMHTDKATEIHLTRPFQQLHRYKIRQSILLATATLASSFQLGTVTTTFSFPWSIGIVVDGDDGVVVVVGAGEATDMGCTVATGQTPS*
Ga0182166_109609513300015326Switchgrass PhyllosphereDQATEIHLTRPFQQLHRYKIRQSILLATATLASSFQLATVTTTFSFPWSIAIVVDGDDGVVVVGAGEAADMGRTVATGQTPT*
Ga0182114_108724413300015327Switchgrass PhyllosphereQQLHRYKIRQSILLATATLASSFQLATVTTTFSFPWSIAIVVDGDDGVVVVGAGEAADMGRTVATGQTPT*
Ga0182114_110998813300015327Switchgrass PhyllosphereMHTDQATEIHLTRPFQQLHRYKIRQSILLATATLASSLRLGTLTTTFSFPWSIGIVVDGDDGVVVVVGAGEATDMGCTVATGQTPT*
Ga0182135_104340813300015329Switchgrass PhyllosphereMHTDQATKIHLTRPFQQLHRYKIRQSILLATATLASSFQLATVTTTFSFPWSIAIVVDGDDGVVVVVAGEAADMGRAVATG*
Ga0182135_106768413300015329Switchgrass PhyllosphereYMHTDQATEIHLTRLFQQLHRYKIRQSILLATATLASSFLLATVTTTFSFPWSIAIVVDGDDGVVVVVAGEAADMGRTVAIGQTPT*
Ga0182152_102859123300015330Switchgrass PhyllosphereFQQLHRYKIWQSILLATATLASSFQLAIVTTSFSFPWSIAIVVVDGDDGVVVVVVGAGEAADMGRIVATGQTPT*
Ga0182131_115157513300015331Switchgrass PhyllosphereMHIDQATEIHLTRPFQQLHRYKIRQSILLATATLASCFQLATVTTTFSFPWSISLVVDGDDGVVVVGAGEAADMGCTVATGQTPT*
Ga0182117_101650613300015332Switchgrass PhyllosphereRPFQQLHRYKIRQSILLATATLASSFQLATVTTTFSFPWSIAIVVYGDDGVVVVGAGEAADMGRTVATGQTPT*
Ga0182132_107261513300015334Switchgrass PhyllosphereIHLTRPFQQLHRYKIRQSILLATATLASSFQLATVTTTFSFPWSIAIVVDGDDGVVVVGAGEAADMGRTVATGQTPT*
Ga0182116_114596713300015335Switchgrass PhyllosphereMHTDQATEIHLTRPLQQLHRYKIRQSILLATATLASSFELATVTTTFSFPWSIAIVVDGDDGVVVV
Ga0182151_100594513300015337Switchgrass PhyllosphereMHTDQATESHLIRPFQQLHRYKIWQSILLATATLASSFQLASVTTSFSFPWSIAIVVDGDDGVVVVGAGEAADMGRIVATGQTPT*
Ga0182137_102618523300015338Switchgrass PhyllosphereMHTEKAIEIHLTRPFQQLHRYKIRQSILLATVTLASSFQLGTLTTTFSFPWSICIVVDGDDGVVVVVGAGEATDMGCTVATGQTPT*
Ga0182179_100372943300015353Switchgrass PhyllosphereMHTDQATESHLIRPFQQLHRYKIWQSILLATATLASSFQLATVTTSFSFPWSIAIVVVDGDDGVVVVVVGAGEAADMGRIVATGQTPT*
Ga0182167_127622223300015354Switchgrass PhyllosphereMHTDQATEIHLTRSFQQLHRYKIRQSILLATATLASSFQLATVTTTFSFPWSIAIVVYGDDGVVVVGAGEAADMGRTVATGQTPT*
Ga0182199_113422423300017412Switchgrass PhyllosphereMYMHTDKATEIHLTRHFQQLHRYMIRQSILLATATLASSFQLGTVTTTFSFSWSIGIVVDGDDGVVVVVGAGEATDMGCT
Ga0182195_119430313300017414Switchgrass PhyllosphereMYMHTDQATEIHLTRPFQQLHRYKIRQSILLATATLASSFQLATVTTTFSFPWSIAIVVDGDDGVVMVGAGEAADMGRTVATGQTPT
Ga0182194_104244813300017435Switchgrass PhyllosphereMHTDQATQIHLTRPFQQLHRYKIRQSILLATATLASSFQLATVTTTSSFPWSIDIVVDGDDGVVVVGAGEAADIGRTVTTGQTPA
Ga0182194_104246313300017435Switchgrass PhyllosphereHTKKATEIHLTRPFQQLHRYKIRQSILLATANLASSFQLGTVTTTFSFPWSIGIVVDGDDGVVVVVGAGEATDMGCTVATGQTPT
Ga0182214_108089613300017440Switchgrass PhyllosphereIHLTRPFQQLHRYKIRQSILLATATLASSFQLATVTTTFSFPWSIAIVVDGDDGVVVVGAGEAADMGRTVATGQTPT
Ga0182215_100192573300017447Switchgrass PhyllosphereMHTDQATEIHLTRPFQQLHRYKIRQSILLATATLASSFQLATVTTTFSFPWSIAIVVYGDDGVVVVGAGEAADIGHTVAIGQTPT
Ga0182212_101812123300017691Switchgrass PhyllosphereMHTDQATEIHLTRPFQQLHRYKIRQSILLATATLASSFQLATMTTTFSFPWSIAIVVYGDDGVVVVGAGEAADMGRTVATGQTPT
Ga0182210_103931623300017692Switchgrass PhyllosphereMYMHTDQATEIHLTRPFQQLHRYKIRQSILLATATLSSSFQLATVTTTFSFPWSIAIVVDGDDGVVVVGAG
Ga0182118_10289713300020223Switchgrass PhyllosphereMYMHTDQATEIHLTRPFQQLHRYKIRQSILLATATLASSFQLATVTTTFSFPWSIAIVVDGDDGVVMVGAGEAADK
Ga0213505_11219313300022465Switchgrass PhyllosphereMHTDQATESHLIRPFQQLHRYKIWQSILLATATLASSFQLATVTTSFSFPWSIAIVVVDGDDGVVVVVVGAGEAADMGRIVATGQTPT
Ga0207646_1087790223300025922Corn, Switchgrass And Miscanthus RhizosphereMYMHTDQATQIHLTRPFQQLHRYKIRQSILLATATLASSFQLATVTTTFSFPWSIAIVVDGDDVVVVGAGEAADMGHTVATGQTPT
Ga0207650_1015218323300025925Switchgrass RhizosphereMHTDQATEIHLTRHFQQLHRYKIRQSILLATATLASSFQLATVTTTISFPWSIAIVVDGDDGVVVVGAGEAADMGRTVATGQTPT
Ga0268344_101585013300028051PhyllosphereMYMHTDQATEIHLTRPFQQLHRYKIRQSILLATATLASSFQLATVTTTFSFPWSIAIVVYGDDG
Ga0268346_100527513300028053PhyllosphereMYMHTDQATEIHLTRPFQQLHRYKIRQSILLATATLASSFQLATVTTTFSFPWSIAIVVDGDDGVVVVGAGEAADMGRTVATGQTPT
Ga0268330_104417513300028056PhyllosphereMHTDQATQIHLTRPFQQLHRYKIRQSILLATATLASSFQLATMTTTFSFPWSIAIVVDGDDGVVVVGAGEAADMGRTVATG
Ga0268332_103641813300028058PhyllosphereATEIHLTRPFQQLHRYKIRQSILLATATLASSFQLATVTTTFSFPWSIAIVVDGDDGVVVVGAGEAADMGRTVATGQTPT
Ga0268332_104565823300028058PhyllosphereMHTDQATESHLIRPFQQLHRYKIWQSILLATATLASSFQLAIVTTSFSFPWSIAIVVVDGDDGVVVVVVGAGEAADMGRIVATGQTPT
Ga0268347_102361913300028142PhyllosphereMYMHTDQATEIHLTRPFQQLHRYKIRQSILLATATLASSFQLATVTTTFSFPWSIAIVVDGDDGVVVVG
Ga0268348_100021733300028143PhyllosphereMHTDQATEIHLTRSFQQLHRYKIRQSILLATATLASSFQLATVTTTFSFPWSIAIVVYGDDGVVVVGAGEAADMGRTVATGQTPT
Ga0268345_101206713300028144PhyllosphereMYMHTDQATEIHLTRPFQQLHRYKIRQSILLATATLASSFQLATVTTTFSFPWSIAIVVDGDDGVVVVGAGEAADMGRTVATGQTLT
Ga0268336_101028613300028152PhyllosphereIHLTRHFQQLHRYKIRQSILLATATLASSFQLATVTTTFSFPWSIAIVVDGDDGVVVVGAGEAADMGRTVATGQTPT
Ga0268320_101049013300028153PhyllosphereDQATEIHLTRPFQQLHRYKIRQSILLATATLASSFQLATVTTTFSFPWSIAIVVDGDDGVVVVGAGEAADMGRTVATGQTPT
Ga0268304_100491623300028256PhyllosphereMYMHTDQATEIHLTRPFQQLHRYKIRQSILLATATLASSFQLATVTTTFSFPWSIAIVVYGDDGVVVVGAG
Ga0268266_1096989613300028379Switchgrass RhizosphereMHTEKATEIHLTRPFQQLHRYKIRQSILLATATLASSFQLATVTTTFSFPWSIAIVVDGDDGVIVVGAGEAADMGRTVATGQTPT
Ga0268302_10420213300028464PhyllosphereMYMHTDQATEIHLTRPFQQLHRYKIRQSILLATATLASSFQLATVTTTFSFPWSIAIVVDGDDGVVVVGAGEAA
Ga0268307_101632513300028470PhyllosphereDQATQIHLTRPFQQLHRYKIRQSILLATATLASSFQLATVTTTFSFPWSIAIVVDGDDGVVVVGAGEAADMGRTVATGQTPT
Ga0268323_100050213300028471PhyllosphereMHTDQATEIHLTRPFQQLHRYKIRQSILLATATLASSFQLATVTTTFSFPWSIAIVVYGDDGVVVVGAGEAADMGRTVATGQTPT
Ga0268309_100251523300028477PhyllosphereMHTDQATEIHLTRSFQQLHRYKIRQSILLATATLASSFQLATVTTTFSFPWSIAIVVDGDDGVVVVGAGEAADMGRTVATGQTPT
Ga0268313_100859413300028523PhyllosphereTRPFQQLHRYKIRQSILLATATLASSFQLATVTTTFSFPWSIAIVVYGDDGVVVVGAGEAADMGRTVATGQTPT
Ga0214492_108258213300032464Switchgrass PhyllosphereMHTDQATEIHLTRPFQQLHRYKIRQSILLATAILASSFQLATVTTNFSFPWSIAIVVDGDDGVVVVGAGEAADMGRTVATGQTPT
Ga0214503_110544213300032466Switchgrass PhyllosphereMYMHTDQATESHLIRPFQQLHRYKIWQSILLATATLASSFQLATVTTSFSFPWSIAIVVVDGDDGVVVVVVGAGEAADMGRIVATGQTPT
Ga0214482_110528613300032468Switchgrass PhyllosphereMYMHTDQATEIHLTRPFQQLHRYKIRQSILLATAILTSSFQLATVTTNFSFPWSIAIVVDGDDGVVVVGAGEAADMGRTVATGQTPT
Ga0214495_110483723300032490Switchgrass PhyllosphereMYMHTDQATEIHLTRPFQQLHRYKIRQSIFLATATLASSFQLATVTTNFSFPWSIAIVVDGDDGVVVVGAGKAADMGRTVTTG
Ga0214502_117048413300032514Switchgrass PhyllosphereATEIHLTRPFQQLHRYKIRQSILLATAILDSSFQLATVTTNFSFPWSIAIVVVGDDSVVVVGAGEAADMGRTVATGQTPT
Ga0321339_105872513300032551Switchgrass PhyllosphereMYMHTDQATESHLIRPFQQLHRYKIWQSILLATATLASSFQLAIVTTSFSFPWSIAIVVVDGDDGVVVVVVGAGEAADMGRIVATGQTPT
Ga0214489_105212023300032590Switchgrass PhyllosphereMYMHTDQATEIHLTRPFQQLHRYKIRQSILLATAILASSFQLATVTTNFSFPWSIAIVVDGDDGVVVVGAGEAADMGRTVATGQTPT
Ga0214484_107458513300032591Switchgrass PhyllosphereMDMHTDQATEIHLTRPFQQLHRYKIRQSILLATAILASSFQLATVTTNFSFPWSIAIVVDGDDGVVVVGAGEAADMGRTVATGQTPT
Ga0214499_123022813300032697Switchgrass PhyllosphereMHTDQATQIHLTRPFQQLHRYKIRQSILLATATLASSFQLATVTTTFSFPCSIAIVLVDGDVVVVVGAREAAGMGRTVATGQTPT
Ga0314720_103278723300032759Switchgrass PhyllosphereMHTDQATEIHLTRPFQQLHRYKIRQSILLATVTLASSFQLATVTTSFSFPWSIAIVVVDGDDGVVVVVVGAGEAADMGRIVATGQTPT
Ga0314733_106088923300032761Switchgrass PhyllosphereMHTDQATEIHLTRPFQQLHRYKIRQSILLATATLASSFQLATVTTTFSFPWSIAIVVDGDDGVVVVGAGEVADMGRTVATGQTPT
Ga0314742_106149413300032781Switchgrass PhyllosphereMYMHTDQATEIHLTRPFQQLHRYKIRQSIFLATATLASSFQLATVTTNFSFPWSIAIVVDGDDVVVVGAGEAADMGHTVATGQTPT
Ga0314744_110172913300032792Switchgrass PhyllosphereMYMHTDQATEIHLTRPFQQLHRYKIRQSILLATATLASSFQLATVTTTFSFPSSIAIVVDGDDGVVVVGAGEAADMG
Ga0314740_105600213300032822Switchgrass PhyllosphereMHTDQATEIHLTRHFQQLHRYKIRQSILLATAILASSFQLATVTTNFSFPWSIAIVVDGDDGVVVVGAGEAADMGRTVATGQTPT
Ga0314723_109442113300032823Switchgrass PhyllosphereMYMHTDQATEIHLTRPFQQLHRYKIRQSILLATAILASSFQLATVTTNFSFPWSIAIVVDGDDGVVVVGAGKAADMGRTVATG
Ga0314736_102520613300032843Switchgrass PhyllospherePFQQLHRYKIWQSILLATATLASSFQLAIVTTSFSFPWSIAIVVDGDDVVVVGAGEAADMGHTVATGQTPT
Ga0314750_109707513300032914Switchgrass PhyllosphereESHLIRPFQQLHRYKIWQSILLATATLASSFQLATVTTSFSFPWSIAIVVDGDDVVVVGAGEAADMGHTVATGQTPT
Ga0314738_102785323300032959Switchgrass PhyllosphereMYMHTDQTTEIHLTRPFQQLHRYKIRQSILLATAILASSFQLATVTTNFSFPWSIAIVVDGDDGVVVVGAGEAADMGRTVATGQTPT
Ga0314768_132102513300033523Switchgrass PhyllosphereMYMHTDQATESHLIRPFQQLHRYKIRQSIFLATATLASSFQLATVTTNFSFPWSIAIVVDGDDGVVVVGAGEAADMGRTVATGQTPT
Ga0314759_125221313300033535Switchgrass PhyllosphereMHTDQATEIHLTRPFQQLHRYKIRQSIFLATATLASSFQLATVTTNFSFPWSIAIVVDGDDGVVVVGAGEAADMGRTVVTGQTLT
Ga0314769_126108823300033542Switchgrass PhyllosphereMYMHTDQATEIHLTRPFQQLHRYKIRQNILLATATLASSFQLATVTTNFSFPWSIAIVVDGDDGVVVVGAGEAADMGRTVATGQTPT

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.