NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F088954

Metagenome / Metatranscriptome Family F088954

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F088954
Family Type Metagenome / Metatranscriptome
Number of Sequences 109
Average Sequence Length 103 residues
Representative Sequence AVKKAQAFALKHIAPMTDPNTGTSTSEHATRGTPTHYAIKEDLKRSFQLGLVLIGGGHTDEGIKIMTTALDHFPIGNAGQDGAHAAEPSALILSGF
Number of Associated Samples 98
Number of Associated Scaffolds 109

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.04 %
% of genes near scaffold ends (potentially truncated) 82.57 %
% of genes from short scaffolds (< 2000 bps) 78.90 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction Yes
3D model pTM-score0.51

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (84.404 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake
(17.431 % of family members)
Environment Ontology (ENVO) Unclassified
(34.862 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(36.697 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 40.32%    β-sheet: 0.00%    Coil/Unstructured: 59.68%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.51
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 109 Family Scaffolds
PF00884Sulfatase 29.36
PF07589PEP-CTERM 2.75
PF13088BNR_2 1.83
PF13366PDDEXK_3 1.83
PF14885GHL15 1.83
PF12831FAD_oxidored 0.92
PF03712Cu2_monoox_C 0.92
PF13676TIR_2 0.92
PF01609DDE_Tnp_1 0.92
PF16385DUF4994 0.92
PF06283ThuA 0.92
PF13358DDE_3 0.92
PF07859Abhydrolase_3 0.92
PF07394DUF1501 0.92

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 109 Family Scaffolds
COG0657Acetyl esterase/lipaseLipid transport and metabolism [I] 0.92
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.92
COG3293TransposaseMobilome: prophages, transposons [X] 0.92
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.92
COG4813Trehalose utilization proteinCarbohydrate transport and metabolism [G] 0.92
COG5421TransposaseMobilome: prophages, transposons [X] 0.92
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.92
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.92


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms85.32 %
UnclassifiedrootN/A14.68 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003388|JGI25910J50241_10019582All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2382Open in IMG/M
3300003404|JGI25920J50251_10012180All Organisms → cellular organisms → Bacteria2893Open in IMG/M
3300004157|Ga0062590_102383070All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6558Open in IMG/M
3300004479|Ga0062595_102705927All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6500Open in IMG/M
3300004769|Ga0007748_11163641All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium607Open in IMG/M
3300004789|Ga0007752_10986646All Organisms → cellular organisms → Bacteria1068Open in IMG/M
3300005263|Ga0071346_1082380All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Anatilimnocola → Anatilimnocola aggregata1200Open in IMG/M
3300005294|Ga0065705_10831024All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6560Open in IMG/M
3300005329|Ga0070683_101511537All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6645Open in IMG/M
3300005543|Ga0070672_102118583All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6507Open in IMG/M
3300005615|Ga0070702_101536898All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6549Open in IMG/M
3300005616|Ga0068852_102686669All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6517Open in IMG/M
3300005842|Ga0068858_102315483All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6531Open in IMG/M
3300006047|Ga0075024_100444580All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6668Open in IMG/M
3300006051|Ga0075364_11088247All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6543Open in IMG/M
3300006109|Ga0007870_1009021All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon2112Open in IMG/M
3300006113|Ga0007858_1008351All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-62568Open in IMG/M
3300006358|Ga0068871_102300832All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6514Open in IMG/M
3300007559|Ga0102828_1095648All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6720Open in IMG/M
3300007621|Ga0102872_1083975All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6859Open in IMG/M
3300007639|Ga0102865_1178899All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6633Open in IMG/M
3300008996|Ga0102831_1273465All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6558Open in IMG/M
3300009093|Ga0105240_11816197All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6635Open in IMG/M
3300009152|Ga0114980_10057347All Organisms → cellular organisms → Bacteria2353Open in IMG/M
3300009152|Ga0114980_10809095All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6521Open in IMG/M
3300009155|Ga0114968_10483933All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6666Open in IMG/M
3300009160|Ga0114981_10051080All Organisms → cellular organisms → Bacteria2319Open in IMG/M
3300009160|Ga0114981_10268953All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6927Open in IMG/M
3300009160|Ga0114981_10783441All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6503Open in IMG/M
3300009163|Ga0114970_10012101All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia6009Open in IMG/M
3300009176|Ga0105242_12967621All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6525Open in IMG/M
3300009184|Ga0114976_10046670All Organisms → cellular organisms → Bacteria2568Open in IMG/M
3300009184|Ga0114976_10150625All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-61303Open in IMG/M
3300009185|Ga0114971_10140938All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-61455Open in IMG/M
3300009187|Ga0114972_10164900All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-61395Open in IMG/M
3300010357|Ga0116249_11146275Not Available699Open in IMG/M
3300010885|Ga0133913_12019992All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes1431Open in IMG/M
3300011432|Ga0137428_1046595All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-61139Open in IMG/M
3300011432|Ga0137428_1152752All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6680Open in IMG/M
3300011445|Ga0137427_10082383All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-61288Open in IMG/M
3300012039|Ga0137421_1035818All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-61299Open in IMG/M
3300012893|Ga0157284_10228045All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6576Open in IMG/M
3300012905|Ga0157296_10319482All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6551Open in IMG/M
3300012908|Ga0157286_10083283All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6903Open in IMG/M
3300012912|Ga0157306_10435473All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6522Open in IMG/M
3300012931|Ga0153915_13509239All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6507Open in IMG/M
3300012958|Ga0164299_10688309All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6713Open in IMG/M
3300012985|Ga0164308_11311008All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6658Open in IMG/M
3300013088|Ga0163200_1228341All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6581Open in IMG/M
3300013296|Ga0157374_10817631All Organisms → cellular organisms → Bacteria948Open in IMG/M
3300013306|Ga0163162_12410793All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6605Open in IMG/M
3300013308|Ga0157375_12984529All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6565Open in IMG/M
3300014325|Ga0163163_10885881Not Available956Open in IMG/M
3300014502|Ga0182021_10490884All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-61464Open in IMG/M
3300014502|Ga0182021_12069219All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6685Open in IMG/M
3300015200|Ga0173480_10977034All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6556Open in IMG/M
3300015371|Ga0132258_12143352All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-61404Open in IMG/M
3300015373|Ga0132257_102361116All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6690Open in IMG/M
3300015374|Ga0132255_106249532All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6504Open in IMG/M
3300019356|Ga0173481_10353267All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6703Open in IMG/M
3300020221|Ga0194127_10939439All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6523Open in IMG/M
3300025366|Ga0208505_1005455All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-61964Open in IMG/M
3300025390|Ga0208743_1013616Not Available1275Open in IMG/M
3300025900|Ga0207710_10601129All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6575Open in IMG/M
3300026023|Ga0207677_11589159All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6605Open in IMG/M
3300027084|Ga0208443_1088722All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6599Open in IMG/M
3300027193|Ga0208800_1059059All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6522Open in IMG/M
3300027224|Ga0208164_1091689All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6512Open in IMG/M
3300027733|Ga0209297_1261599All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6659Open in IMG/M
3300027734|Ga0209087_1118669All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium1098Open in IMG/M
3300027760|Ga0209598_10104038All Organisms → cellular organisms → Bacteria1329Open in IMG/M
3300027892|Ga0209550_10758933All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6549Open in IMG/M
3300027974|Ga0209299_1010671All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Roseimicrobium4406Open in IMG/M
3300027974|Ga0209299_1143512All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6905Open in IMG/M
(restricted) 3300028044|Ga0247838_1255573All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300028381|Ga0268264_12460180All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6526Open in IMG/M
(restricted) 3300028569|Ga0247843_1011952All Organisms → cellular organisms → Bacteria8750Open in IMG/M
(restricted) 3300028569|Ga0247843_1247326All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6646Open in IMG/M
3300031786|Ga0315908_11261816All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6584Open in IMG/M
3300031857|Ga0315909_10431630All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia933Open in IMG/M
3300031873|Ga0315297_10677858All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6864Open in IMG/M
3300031902|Ga0302322_102911170All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6590Open in IMG/M
3300031997|Ga0315278_11814855All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6576Open in IMG/M
3300032002|Ga0307416_103882218All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6501Open in IMG/M
3300032143|Ga0315292_10956718All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6713Open in IMG/M
3300032164|Ga0315283_11640985All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6653Open in IMG/M
3300032397|Ga0315287_11105333All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6918Open in IMG/M
3300032421|Ga0310812_10546077All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6520Open in IMG/M
3300032579|Ga0316228_1255397All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6553Open in IMG/M
3300033414|Ga0316619_11914942All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6539Open in IMG/M
3300033521|Ga0316616_101893217All Organisms → cellular organisms → Bacteria787Open in IMG/M
3300034051|Ga0335024_0532230All Organisms → cellular organisms → Bacteria → PVC group569Open in IMG/M
3300034114|Ga0364938_087246All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6590Open in IMG/M
3300034148|Ga0364927_0080848All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6885Open in IMG/M
3300034149|Ga0364929_0360278All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6505Open in IMG/M
3300034151|Ga0364935_0159334All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → unclassified Chthoniobacter → Chthoniobacter sp. 12-60-6716Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake17.43%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil9.17%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine8.26%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake6.42%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment5.50%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater4.59%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater3.67%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil3.67%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment3.67%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.75%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater1.83%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater1.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.83%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.83%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen1.83%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.83%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.92%
Anaerobic Enrichment CultureEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Anaerobic Enrichment Culture0.92%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic0.92%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.92%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.92%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.92%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.92%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.92%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.92%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.92%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.92%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.92%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.92%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.92%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.92%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.92%
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge0.92%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003388Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SNEnvironmentalOpen in IMG/M
3300003404Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMDEnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004769Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004789Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005263Freshwater pond sediment microbial communities from Middleton WI, enriched with Humic Acid Only under anaerobic conditions - HA Sample 3EnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005517Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4)EnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006051Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4Host-AssociatedOpen in IMG/M
3300006109Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH04Jul08EnvironmentalOpen in IMG/M
3300006113Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH08Aug08EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300007559Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541EnvironmentalOpen in IMG/M
3300007590Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02EnvironmentalOpen in IMG/M
3300007621Estuarine microbial communities from the Columbia River estuary - metaG 1547A-3EnvironmentalOpen in IMG/M
3300007639Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02EnvironmentalOpen in IMG/M
3300008996Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009131Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1EnvironmentalOpen in IMG/M
3300009152Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaGEnvironmentalOpen in IMG/M
3300009155Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaGEnvironmentalOpen in IMG/M
3300009160Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaGEnvironmentalOpen in IMG/M
3300009163Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaGEnvironmentalOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009184Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaGEnvironmentalOpen in IMG/M
3300009185Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaGEnvironmentalOpen in IMG/M
3300009187Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaGEnvironmentalOpen in IMG/M
3300010357AD_USSTcaEngineeredOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300011432Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2EnvironmentalOpen in IMG/M
3300011445Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2EnvironmentalOpen in IMG/M
3300012039Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT534_2EnvironmentalOpen in IMG/M
3300012892Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1EnvironmentalOpen in IMG/M
3300012893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1EnvironmentalOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012912Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300013088Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_200mEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300020221Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100mEnvironmentalOpen in IMG/M
3300025366Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH15Jul08 (SPAdes)EnvironmentalOpen in IMG/M
3300025390Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH04Jul08 (SPAdes)EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027084Estuarine microbial communities from the Columbia River estuary - metaG 1554A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027193Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes)EnvironmentalOpen in IMG/M
3300027224Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027621Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027733Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027734Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027736Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027756Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027760Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027892Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027974Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300028044 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_15mEnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028569 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8mEnvironmentalOpen in IMG/M
3300031786Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032143Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0EnvironmentalOpen in IMG/M
3300032164Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0EnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300032421Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3EnvironmentalOpen in IMG/M
3300032579Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18021EnvironmentalOpen in IMG/M
3300032668Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025EnvironmentalOpen in IMG/M
3300033414Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_BEnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300034051Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13May2013-rr0097EnvironmentalOpen in IMG/M
3300034114Sediment microbial communities from East River floodplain, Colorado, United States - 9_s17EnvironmentalOpen in IMG/M
3300034148Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17EnvironmentalOpen in IMG/M
3300034149Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17EnvironmentalOpen in IMG/M
3300034151Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI25910J50241_1001958233300003388Freshwater LakeAVKKAQAFALKHIAPMTDPNTGTSTSEHATRGTPTHYAIKEDLKRSFQLGLVLIGGGHTDEGIKIMTTALDHFPIGNAGQDGAHAAEPSALILSGF*
JGI25920J50251_1001218013300003404Freshwater LakeAVKKAQAFALKHIAPMTDPNTGTSTSEHATRGTPTHYAIKEDLKRSFXLGLVLIGGGHTDEGIKIMTTALDHFPIGNAGQDGAHAAEPSALILSGF*
Ga0062590_10238307023300004157SoilKELMDLQKFNPTYREEKLNNALQRAQAFAFTCISPMTDPNSGPPCKEYATRGTPSHYELKKDFKRGFQLGRILIGGQHTDEGIKIMNATLDHFPVGNAGQDGAHAAGPSALILSGLSSGVAGR*
Ga0062595_10270592713300004479SoilREEKLNAAVQKAQAFAFKCIAPMTDPNSGPPCADHATRGTPSHYALKQDSKRGFQLGLILIGGRHTDEGIKIMNASLEHFPIGNAGQDGVHAAEPSALILSGF*
Ga0007748_1116364123300004769Freshwater LakeTSEHATRGTPTHYAIKEDLKRSFQLGLVLIGGGHTDEGIKIMTTALDHFPIGNAGQDGAHAAEPSALILSGF*
Ga0007752_1098664623300004789Freshwater LakeDPNTGTSTSEHATRGTPTHYAIKEDLKRSFQLGLVLIGGGHTDEGIKIMTTALDHFPIGNAGQDGAHAAEPSALILSGF*
Ga0071346_108238043300005263Anaerobic Enrichment CultureMDLQKFNPAYREEKLNAAVRKARAFALKCIAPMTDPNTGPPCTQHATRGTPSRYSLKDNLKRSYQLGLILFGGGHMDEGIKIMNAALDHFPIGNAGMDGVHAAEPSALILSGF*
Ga0065705_1083102413300005294Switchgrass RhizosphereDKDVLGYFMLTTKELMDLQKFNPAYREEKLNAAVQRAQAFAFKCIAPMTDPNSGPPCMEHATRGTPSHYALKENSKRGFQLGLILMGGGHTDEGIKIMNAALDHFPIGNAGQDGAHAAEPSALVLSGF*
Ga0070683_10151153723300005329Corn RhizosphereSAVQRAQAFAFKCIAPMTDPSSGPPCMEHATRGTPFHYALKEDSKRGFQLGLILIGSRHRDEGIKIMNASLDHFPIGNAGQDGAHAAEPSALILSGF*
Ga0070374_1002245053300005517Freshwater LakeFALQQIAPMTEPNTGPAPRPHATPGTPRRYSVQDEAKRSYQLGLILLEGGQQNEGLKIMSAALAQFPVGNAGQDGSHAAEPSALILSSPLLR*
Ga0070672_10211858313300005543Miscanthus RhizosphereVLGYFMLTTKELMDLQKFNPAYREEKLNAAVQKAQAFAFKCIAPMTDPNSGPPCKEYATRGTPSHYSLIEDSKRGFQLGLILIGGRHTDEGIKIMNASLDHFPIGNAGQDGAHAAEPSALILSGF*
Ga0070695_10150609913300005545Corn, Switchgrass And Miscanthus RhizosphereSHYALKEDSKRGFQLGLILMGSGYTEEGIKIMNAALDHFPIGNAGQDGAHAAEPSALILSGF*
Ga0070702_10153689813300005615Corn, Switchgrass And Miscanthus RhizosphereDPNSGPPCKEYATRGTPSHYSLKEDSKRGFQLGLILIGGRHTDEGIKIMNASLDHFPIGNAGQDGAHAAEPSALILSGF*
Ga0068852_10268666923300005616Corn RhizosphereRGTPSHYSLQEDSKRGFQLGLILIGGRHTDEGIKIMNASLDHFPIGNAGQDGAHAAEPSALILSGF*
Ga0068858_10231548323300005842Switchgrass RhizosphereQRAQAFAFKCIAPMTDPNSGPPCKEYATRGTPSHYSLKEDSKRGFQLGLILIGGRHTDEGIKIMNAALDHFPIGNAGQDGAHAAEPSALILSGF*
Ga0075024_10044458013300006047WatershedsQKFNPAYREEKLNAAVQKAQAFALKCIAPMTEPNTGPACREHATRETPSHYSLKEDLKRSFQLGLVLMGGGHTDEGIKIMNAALDHFPIGNVGMDGAHAAEPSALILSGL*
Ga0075364_1108824713300006051Populus EndosphereEHATRGTPSHYSLKEDSKRGFQLGLILIGGGHTDEGIKIMNAALDHFPIGNAGQDGAHAAEPSALVLSGF*
Ga0007870_100902113300006109FreshwaterAQAFAFQCIAPMTEPNSGSACPEHTTRETPSHYSLRENAKRSFQLGHILIAGGYLAEGIKIMEAALAYFPIGNTGQDGAHAAEPTVLILSGN*
Ga0007858_100835113300006113FreshwaterNPAYRDVKLSATIKKAQAFAFQCIAPMTEPNSGSACPEHTTRETPSHYSLRENAKRSFQLGHILIAGGYLAEGIKIMEAALAYFPIGNTGQDGAHAAEPTVLILSGN*
Ga0068871_10230083223300006358Miscanthus RhizosphereFNPAYREEKLNAALQKAQALALKCIAPMTEPNTGPACAEHRTPSTPTHYAVADDLKRSFQLGLVLMGGGHTDEAVKILNAAVDHFPVGNAGMDGVHAAQPLALILSDSGSRTH*
Ga0079218_1121677213300007004Agricultural SoilAQAFAVKFIAPTTEPNTGSVARPHATQGTPAHYAVKDDPKRSYQLGLVLFGGGYQEEGIKIVNAALPHFPFGNAGQDGAHAAEPVALILSH*
Ga0102828_109564813300007559EstuarineVLGYFMLTTKELMDLQKFNPTFREEKLTAAVKKAQAFALKHIAPMTDPNTGTSTSEHATRGTPTHYAIKEDLKRSFQLGLVLIGGGHTDEGIKIMTTALDHFPIGNAGQDGAHAAEPSALILSGF*
Ga0102917_130985213300007590EstuarinePAYHEDRLNAALKKAQTFALQQIAPTTEPNTGSGPRPHATAGTPKRYSVQDEAKRSYQLGLILLEGGQQKEGLRIMSAALAQFPVGNAGQDGSHAAEPSALILSSPLLR*
Ga0102872_108397523300007621EstuarineKDKDVLGYFMLTTKELMDLQKFNPAYREEKLNTAVKKAQAFALKHIAPMTDPNTGTSTSEHATRGTPTHYAIKEDLKRSFQLGLVLIGGGHTDEGIKIMTTALDHFPIGNAGQDGAHAAEPSALILSGF*
Ga0102865_117889913300007639EstuarineGYFMLTTKELMDLQTFNPTFREEKLTAAVKKAQAFALKHIAPMTDPNTGTSTSEHATRGTPTHYAIKEDLKRSFQLGLVLIGGGHTDEGIKIMTTALDHFPIGNAGQDGAHAAEPSALILSGF*
Ga0102831_127346513300008996EstuarineKDVLGYFMLTTKELMDLQKFNPAYREEKLNTAVKKAQAFALKHIAPMTDPNTGTSTSEHATRGTPTHYAIKEDLKRSFQLGLVLIGGGHTDEGIKIMTTALDHFPIGNAGQDGAHAAEPSALILSGF*
Ga0105240_1181619723300009093Corn RhizosphereLGYFMLTTTELMDLQKFNPAYREEKLNAAVRKAQAFALKHIAPMTDPDSGPPCSNHATRGTPSHYSLKDDSKRGFQLGLILIGGGHTGEGIKIMTAALDQFPIGNAGQDGAHAAEPSVLILSEF*
Ga0115027_1156491423300009131WetlandMILQKFNPAYREEKLTAALQKAQAFALKHIAPMTDPNPGTSTSEHATRGTPKHYVIKEDLKRSFQLGLVLIGGGHTDEGVKIMTTALDHFPIGNAGQDGA
Ga0114980_1005734733300009152Freshwater LakeKDKDVLGYFMLTTKELMDLQKFNPAYREEKLTAAVKKAQAFALKHIAPMTDPNTGTSTSEHATRCTPMHYAIKEDLKRSFQLGLVLIGGGHTDEGIKIMNTALDHFPIGNAGQDGAHAAEPSALILSGF*
Ga0114980_1080909513300009152Freshwater LakeTKELMDLQKLNPAYREEKLTAALKKAQAFALKHIAPMTDPNTGTSTSEHATRGTPTHYAIKEDLKRSFQLGLVLIGGGHTDEGVKIMTAALDQFPIGNAGQDGAHAAEPSALILSGF*
Ga0114968_1048393323300009155Freshwater LakeLDKDPKDKDVLGYFMLTTKELMDLQKLNPTYREEKLTAAVRKAQAFALKHIAPMTEPNTGTSTSEHATRGTPTHYAIKEDLKRSFQLGLVLIGGGHTDEGIKIMNSALDHFPIGNAGQDGAHAAEPSALILSGF*
Ga0114981_1005108013300009160Freshwater LakeYFMLTTKELMDLQKLNPTYREEKLTAAVRKAQAFALKHIAPMTEPNTGTSTSEHATRGTPTHYAIKEDLKRSFQLGLVLIGGGHTDEGIKIMTTALDHFPIGNAGQDGAHAAEPSALILSGF*
Ga0114981_1026895313300009160Freshwater LakeDPKDKDVLGYFMLTTKELMDLQKFNPAYREEKLTAAVKKAQAFALKHIAPMTDPNTGTSTFEHATRGTPTHYAIKEDLKRSFQLGLVLIGGGHTEEGIKIMTTALDHFPIGNVGQDGAHAAEPSTLILSGF*
Ga0114981_1078344113300009160Freshwater LakeLQKLNPAYREEKLTAALKKAQAFALKHIAPMTDPNTGTSTSEHATRGTPTHYAIKEDLKRSFQLGLVLIGGGHTDEGVKIMTAALDQFPIGNAGQDGAHAAEPSALILSGF*
Ga0114970_1001210153300009163Freshwater LakeVLGYFMLTTKELMDLQKFNPVYREEKLTAAVKKAQAFALKHIAPMTDPNTGTSTSEHATRGTPSHYAIKEDLKRSFQLGLVLIGGGHTEEGIKIMNTALDHFPIGNAGQDGAHAAEPSALILSGF*
Ga0105242_1296762113300009176Miscanthus RhizosphereKLNAALQKAQAFALKCIAPMTDPNTGGPCTEHATSGTPSHYSLQEDSKRSFQLGPILIGGGHRAEGIKIMNAALDHFPVGNAGQDGAHAAEPSALILSWL*
Ga0114976_1004667013300009184Freshwater LakeEHATRGTPTHYAIKEDLKRSFQLGRVLIGGGHTDEGIKIMTAALDHFPIGNAGQDGAHAAEPSVLILSGF*
Ga0114976_1015062523300009184Freshwater LakePKDKDVLGYFMLTTKELMDLQKFNPAYREEKLTAAVKKAQAFALKHIAPMTDPNTGTSTFEHATRGTPTHYAIKEDLKRSFQLGLVLIGGGHTEEGIKIMTTALDHFPIGNVGQDGAHAAEPSTLILSGF*
Ga0114971_1012417623300009185Freshwater LakePTHYAIKEDLKRSFQLGLVLIGGGHTDEGIKIMTTALDHFPIGNAGQDGAHAAEPSALILSGF*
Ga0114971_1014093813300009185Freshwater LakeFALKHIAPMTDPNTGTSTSEHATRGTPTHYAIKEDLKRSFQLGLVLIGGGHTEEGIKIMTTALDHFPIGNAGQDGAHAAEPSALILSGF*
Ga0114972_1016490013300009187Freshwater LakeEKLTAAVKKAQAFALKHIAPMTDPNTGTSSSEHTTRGTPTHYGIKEGLKRSFQLGLVLIGGGHTDEGIKIMTAALDHFPIGNAGQDGTHAAEPSVLILSGF*
Ga0116249_1114627523300010357Anaerobic Digestor SludgeAQTFALKSIAPMTPPNEGTASTEHRTLGTPPRYTLKDDLKRSFQLGHVLMGSGHRDEAIKILNAALAEFPIGDAGMDGIHAAAPSALILSGF*
Ga0133913_1201999213300010885Freshwater LakeKHIAPMTDPNTGTSTSEHATRGTPTHYAIKEDLKRSFQLGLVLIGGGHTEEGIKIMTTALDHFPIGNAGQDGAHAAEPSALILSGF*
Ga0137428_104659523300011432SoilLQKFNPAYREEKLNAAVQRAQAFALKCIAPMTDPNSGPPCAEHATRRTPSHYALKEDSKRGFQLGLILIGGGNMDEGIKIMNATLDHFPIGNADQDGAHAAEPSALILSSY*
Ga0137428_115275223300011432SoilMDKDVLGYFMLTTKELMDLQRFNPMYREEKLNAAVQKAQAFALKRIAPMTDPNSGPPCAEHSTRGTPSHYILKEDSKRGFQLGLILIGGGHLDEGIKIMNATLNHFPIGNAGQDGAHAAEPSALVLSGF*
Ga0137427_1008238323300011445SoilPNSGPPCAEHSTRGTPSHYILKEDSKRGFQLGLILIGGGHLDEGIKIMNATLNHFPIGNAGQDGAHAAEPSALVLSGF*
Ga0137421_103581823300012039SoilLGYFMLTTKELMDLQRFNPMYREEKLNAAVQKAQAFALKRIAPMTDPNTGPPCAEHATRGTPSHYSLKEDSKRGFQLGLILIGGGHRDEGIKIMNATLYQFPIGNTGQDGAHAAEPSALILSGL*
Ga0157294_1024208513300012892SoilPSHYALKDDSKRGFQLSLILIGGRHTDEGIKIMNATLDHFPIGNAGQDGAHAAEPSALILSGF*
Ga0157284_1022804513300012893SoilQKAQAFALKHIAPMTDPNSGPPCLEHATRGTPSHYALKEDSKRGFQLGLILMGGGHGDEGIKIMNAALDHFPIGNAGQDGAHAAEPSALILSGF*
Ga0157296_1031948213300012905SoilKDPKDKDVLGYFMLTTKELMNLQKFNPAYREEKLNAALQKAQGFALKCIAPMTDPNTGAPCAEHATRGTPSHYSLKEDSKRSFQLGLILIGGGHRDEGIKIMNAALDHFPVGNAGQDGAHAAEPSALILSGL*
Ga0157286_1008328313300012908SoilNDKDVLGYFMLTTKELMDLQKFNPAYREEKLNAAVHKAQAFAFKCIAPMTGPNSGPPCMEHATRGTPSHYSLKEDSKRGFQLGLILIGGGHTDEGIKIMNAALDHFPIGNAGQDGAHAAEPSALVLSGF*
Ga0157306_1043547323300012912SoilAPMTDPNSGPPCKEYATRGTPSHYSLKEDSKRGFQLGLILIGGGHTDEGIKIMNATLEHFPIGNAGQDGAHAAEPSALILSGF*
Ga0153915_1350923913300012931Freshwater WetlandsAYRDEKLNSAVQKARAFALKCIAPMTEPNKGPACRTHATQATPSHYSLKEDCKRGFQLGLILIGGGHTDEGIKIMNAAIERFPLGNTGQDGAKAAEVSALILSSL*
Ga0164299_1068830913300012958SoilLQKFNPAYREEKLNAAVQKAQAFALKCIAPMTDPNFGPPCKEYATRGTPSHYSLKEDSKRGFQLGLILIGGRHTDEGIKIMNASLDHFPIGNAGQDGAHAAEPSALILSGF*
Ga0164308_1131100813300012985SoilELMDLQQFNPAYREEKLNAAVQKAQAFAFKCIAPMTDPNSGPPCKEYATRGTPSHYSLKEDSKRGFQLGLILIGGRHTDEGIKIMNASLDHFPIGNAGQDGAHAAEPTALILSGF*
Ga0163200_122834123300013088FreshwaterGYFMLTTKELMDLQKFNPVYRDERLTASLQKAQSFALKHIAPMTDPNTGTATSEHVTRGTPTHYAIKEDLKRSFQLGLVLIGGGHTDEGIKIMTTALDHFPIGNVGQDGAHAAEPSALVLSGF*
Ga0157374_1081763123300013296Miscanthus RhizosphereTDPNSGPPCAEHATRGTPSHYALKEESKRGFQLGLILMGGRHTDEGIKIMNASLDHFPIGNAGQDGAHAAEPSALILSGF*
Ga0163162_1241079313300013306Switchgrass RhizosphereAVQKAQAFAFRCIAPMTDPNSGPPCKEYATRGTPSHYSLKEDSKRGFQLGLILIGGRHTDEGIKIMNASLDHFPIGNAGQDGAHAAEPSALILSGF*
Ga0157375_1298452913300013308Miscanthus RhizosphereFNPAYREEKLNAAVQRAQAFAFKCIAPMTDPNSGPSCAEHATRRTPSHYALKEDSKRGFQLGLILIGGRHSDEGIKIMNASLDHFPIGNAGQDGVHAAEPSALILSGF*
Ga0163163_1088588113300014325Switchgrass RhizosphereMGQPDSPHTTRGTPAHYSAKADAKRTFQLGLVLLGGGHTEEGTKIVNAALAHFPIGNAGQDGAHAAAPSAIMLSGMRQ*
Ga0182021_1049088433300014502FenTTEELMKLQQFNPTYREEKLNAAVHKAQTFALKFIAPMTEPNSGPACKAHTTRETPKHYSLKENMKRSYELGRILFGGGYTDEGLKIMNAALEQFPFGTGGQDGAHAAEPSALLLSGF*
Ga0182021_1206921923300014502FenMHKAQAFALKCIAPMTEPNSGPACKEHTTRATPTHYSLKENMKRSYELGRILFGGGYTDEGLKIMNVALEQFPVGNGGQDGAHAAEPSALMLSGF*
Ga0173480_1097703413300015200SoilPNSGPPCKEYATRGTPSHYSLKEDSKRGFQLGLILIGGRHTDEGIKIMNASLDHFPIGNAGQDGAHAAEPSALILSGF*
Ga0132258_1214335223300015371Arabidopsis RhizosphereAQAFAFKCIAPMTDPNSGPPCMEHVTRGIPSHYALKEDSKRGFQLGLILMGGGHTDEGIKIMNAALDHFPIGNAGQDGAHAAEPSALILSGF*
Ga0132257_10236111613300015373Arabidopsis RhizosphereNDKDILGYFMLTTKELMDLQKFNPAYREEKLNAAVQRAQAFAFKCIAPMTDPNSGPPCIDHATRGTPSHYSLKEDSKRGFQLGLILIGGRHADEGIKIMNASLDHFPIGNAGQDGAHAAEPSALILSGF*
Ga0132255_10624953213300015374Arabidopsis RhizosphereNAAVQRAQAFAFKCIAPMTDPNSGPPCAEHATRGTPSHYALKENSKRGFQLGLILIGGRHADEGIKIMNASLDHFPIGNAGQDGAHAAEPSALILSGF*
Ga0173481_1035326713300019356SoilKELMDLQKFNPAYREEKLNAAVHKAQAFAFKCIAPMTGPNSGPPCMEHATRGTPSHYSLKEDSKRGFQLGLILIGGGHTDEGIKIMNAALDHFPIGNAGQDGAHAAEPSALVLSGF
Ga0194127_1093943923300020221Freshwater LakeRQAQAFALKHIAPMTDPNTGTSTAGHATRGTPKHYAINEDAKRSYQLGVVLIGGGHRDEGIKIMTTALDHFPLGNAGQDGAHAAEPAALILSGF
Ga0208505_100545513300025366FreshwaterSGNDPKNKDILGYFMLTLGELMKLQKFNPAYRDVKLSATIKKAQAFAFQCIAPMTEPNSGSACPEHTTRETPSHYSLRENAKRSFQLGHILIAGGYLAEGIKIMEAALAYFPIGNTGQDGAHAAEPTVLILSGN
Ga0208743_101361633300025390FreshwaterAQAFAFQCIAPMTEPNSGSACPEHTTRETPSHYSLRENAKRSFQLGHILIAGGYLAEGIKIMEAALAYFPIGNTGQDGAHAAEPTVLILSGN
Ga0207710_1060112913300025900Switchgrass RhizosphereAQTFAFKCIAPITDPNSGPPCKEYATRGTPTHYSLKEDSKRGLQLGLILIGGRHTGEGIKIMNAALDHFPIGNAGQDGAHAAEPSALLLSGF
Ga0207677_1158915913300026023Miscanthus RhizosphereSDNDPNDKDVLGYFMLTTKELMDLQQFNPAYREERLNAAVQRAQAFAFKCIAPMTGPNSGPPCMEHATRGTPSHYSLKEDSKRGFQLGLILIGSRHRDEGIKIMNASLDHFPIGNAGQDGAHAAEPSALILSGF
Ga0208443_108872223300027084EstuarineNPTFREEKLTAAVKKAQAFALKHIAPMTDPNTGTSTSEHATRGTPTHYAIKEDLKRSFQLGLVLIGGGHTDEGIKIMTTALDHFPIGNAGQDGAHAAEPSALILSGF
Ga0208800_101774523300027193EstuarineLQKAQTFALQQIAPMTEPNTGPAPRPHATAGTPKGYSVQDEAKRSYQLGLILFEGGQVNEGLRIMSAALAQFPVGNAGQDGSHAAEPSALILSSPLFR
Ga0208800_105905923300027193EstuarineQKFNPTFREEKLTAAVKKAQAFALKHIAPMTDPNTGTSTSEHATRGTPTHYAIKEDLKRSFQLGLVLIGGGHTDEGIKIMTTALDHFPIGNAGQDGAHAAEPSALILSGF
Ga0208164_109168913300027224EstuarineAFALKHIAPMTDPNTGTSTSEHATRGTPTHYAIKEDLKRSFQLGLVLIGGGHTDEGIKIMTTALDHFPIGNAGQDGAHAAEPSALILSGF
Ga0208951_117722913300027621Freshwater LenticFALQQIAPMTEPNTGPAPRPHATAGTPKGYSVQDEAKRSYQLGLILFEGGQVNEGLRIMSAALAQFPVGNAGQDGSHAAEPSALILSSPLLR
Ga0209297_126159923300027733Freshwater LakeSLLDKDPKDKDVLGYFMLTTKELMDLQKFNPAYREEKLTAAVKKAQAFALKHIAPMTDPNTGTSTFEHATRGTPTHYAIKEDLKRSFQLGLVLIGGGHTEEGIKIMTTALDHFPIGNVGQDGAHAAEPSTLILSGF
Ga0209087_111866923300027734Freshwater LakeGTPTHYAIKEDLKRSFQLGLVLIGGGHTEEGIKIMTTALDHFPIGNVGQDGAHAAEPSTLILSGF
Ga0209190_102037343300027736Freshwater LakeALQQIAPMTEPNTGPAPRPHATVGTPRRYSVQDEAKRSYQLGFILLESGQQNEGLKIMSAALAQFPVGNAGQDGSHASEPSALILSNPLLR
Ga0209444_1004807133300027756Freshwater LakeQIAPMTEPNTGPAPRPHATAGTPKGYSVQDEAKRSYQLGLILFEGGQVNEGLRIMSAALAQFPVGNAGQDGSHAAEPSALILSSPLFR
Ga0209598_1010403813300027760Freshwater LakeDPNTGTSSSEHTTRGTPTHYGIKEGLKRSFQLGLVLIGGGHTDEGIKIMTAALDHFPIGNAGQDGTHAAEPSVLILSGF
Ga0209550_1075893323300027892Freshwater LakeAVKKAQAFALKHIAPMTDPNTGTSTSEHATRGTPTHYAIKEDLKRSFQLGLVLIGGGHTDEGIKIMTTALDHFPIGNAGQDGAHAAEPSALILSGF
Ga0209299_101067143300027974Freshwater LakeMTDPNTGTSTSEHVTRGTPKHYAIKDDLKRSFQLGLVLIGGDHTEEGIKIMTTALDHFPIGNAGQDGAHAAEPSALILSGF
Ga0209299_114351213300027974Freshwater LakeLGYFMLTTKELMDLQKFNPAYREEKLTAAVKKAQAFALKHIAPMTDPNTGTSTFEHATRGTPTHYAIKEDLKRSFQLGLVLIGGGHTEEGIKIMTTALDHFPIGNVGQDGAHAAEPSTLILSGF
(restricted) Ga0247838_125557323300028044FreshwaterPVYRDERLTASLQKAQAFALKHITPMTDPNTGTSTSKHVTRGTPKHYAIKDDLKRSFQLGLVLIGGGHTDEGVKIMTTALDHFPIGNAGQDGAHAAEPSALILSGF
Ga0268264_1246018013300028381Switchgrass RhizosphereKDVLGYFLLTTKELMDLQKFNPAYREEKLNAAVQRAQTFAFKCISPMTDPNSGPPCKEYATRGTPSHYELKKDFKRGFQLGRILIGGQHTDEGIKIMNASLDHFPIGNAGQDGAHAAEPSALILSGF
(restricted) Ga0247843_101195243300028569FreshwaterLDKDPKDKDVLGYFMLTTKELMDLQAFNPLYREPKLNAALEKAQAFALKHIAPMTDPNTGTSSSEYATRGTPTHYSIKDESKRSFQLVLILIGVGHTGEGIKIMNTALDHFPTATSARMALMPLNPPR
(restricted) Ga0247843_124732623300028569FreshwaterRFNPAYREEKLTAALRKAQAFSLKNIAPMTDPNTGTSTTEHATRGTPEHYAIKDEAKRSFQLGLVLIGGGHLEEGIKIMTTALEHFPIGNGGQDGAHAAEPSALILSRF
Ga0315908_1126181613300031786FreshwaterKFNPAYREEKLNTAVKKAQAFALKHIAPMTDPNTGTSTSEHATRGTPTHYAIKEDLKRSFQLGLVLIGGGHTDEGIKIMTTALDHFPIGNAGQDGAHAAEPSALILSGF
Ga0315909_1043163013300031857FreshwaterTRGTPTHYAIKEDLKRSFQLGLILIGGGHSEEGIKIMTTALDQFPIGNAGQDGAHAAEPSALILSGF
Ga0315297_1067785823300031873SedimentNKDVLGYFMLTTEELMHLQKFNPAYREEKLNAAVKKAQAFALKCIAPMTDPNRGSACSEHRTPSTPTHYSVTDDLKRSFQLGCVLMGGGHTDEGMKIVNTALDHFPVGNAGMDGVHAAGPSAFILSGF
Ga0302322_10291117023300031902FenAFALKCIAPMTDPNHGAVCSEHRTSSTPTHYSVSDDLKRSFQLGCVLMGGGHTDEGMKIVNTALDHFPVGNAGMDGVHAAGPSAFILSGF
Ga0315278_1181485513300031997SedimentLQKFNPAYREEKLNAAVKKAQAFALKCIAPMTDPNRGSACSEHRTPSTPTHYSVADDLKRSFQLGCVLMGGGHTDEGMKIVNTALDHFPVGNAGMDGVHAAGPSAFILSGF
Ga0315278_1196817323300031997SedimentRTYIAPMTEPNAGSATHPHATAGTPSRYSLKEDAKRSFQLSLILLGGGQQQEGLKIMNAALAQFPVGNAGQDGAHAAEPSALILSSRLLR
Ga0307416_10388221813300032002RhizosphereTRGTPSHYSLKEDSKRGFQLGLILIGGRHTDEGIKIMNASLDHFPIGNAGQDGAHAAEPSALILSGF
Ga0315292_1095671813300032143SedimentLNAAVKKAQAFALKCIAPMTDPNRGSACSEHRTPSTPTHYSVADDLKRSFQLGCVLMGGGHTDEGMMIVNTALDHFPVGNAGMDGVHAAGPSAFILSGF
Ga0315283_1164098523300032164SedimentKCIAPMTEPNTGPACATHATRGTPSHYSLKEESKRSYQLGLVLIGGGYLDEGIKIMNAALDHFPIGNAGQDGAHAAEPSALILSGL
Ga0315287_1110533323300032397SedimentMDLHKFNPAYRDEKLNSAIQRAQAFALKCIAPMTEPNNRPACREHATPATPSHYSLKGDSKRGFQLALILIGGGHMDEGIKIMNAALDHFPIGNAGQDGAHAAEPSALVLLEF
Ga0310812_1054607713300032421SoilDLQKFNPAYREEKLNAAVRRAQAFAFKCIAPMTDPNSGPPCAEHATRGTPSHYALKEDSKRGFQLGLILIGGRHTDEGIKIMNASLDHFPIGNAGQDGVHAAEPSALILSGF
Ga0316228_125539723300032579FreshwaterGYFMLTTEELMKLQQFNPGYREERLNAAVRKAQAFALKRIAPMTEPNIGPACTEHATRETPAHYSLKDDAKRSFQLGRILLGGGYRDEGIRIMNVALAQFPVGNVGQDGAHAAEPSALILSSF
Ga0316230_122816513300032668FreshwaterLNAAMRKAQAFALQRIAPMTEPNTGPACTEHATRETPAHYSLKEDAKRSFQLGRILLGGGYRDEGLKIMNAALAQFPVGSIGQDGAHAAEPSALILSSF
Ga0316619_1191494223300033414SoilPNNGPACREHATSSTPSHYSLEGDSKRGFELGLILIGGGNMDEGIKIMSASIQHFPFGNAGQDGAHAAEPSALVLSGLK
Ga0316616_10189321723300033521SoilMTDPNPGTSTSEHATRGTPKHYVIKEDLKRSFQLGLVLIGGGHTDEGVKIMTTALDHFPIGNAGQDGAHAAEPSALILSGF
Ga0335024_0532230_352_5673300034051FreshwaterSGHATRDTPNHYSTKEDLKRSFQLGLVLLGGGHTDEGIKIMSTAIDHFPIGNAGQDGAHAAEPSALILSGF
Ga0364938_087246_248_5893300034114SedimentMDLQKFNPAYREEKLNAAVQRAQAFAFRCIAPMTDPNSGPPCAEHATRGTPSHYSLKEDSKRGFQLALILIGGRHTGEGIKIMNASLNHFPIGNAGQDGAHAAEPSALILSGF
Ga0364927_0080848_494_8563300034148SedimentMLTTKELMDLQKFNPTYREEKLNAAVQRAQAFALKCIAPMTDPNSGPPCAEHATRRTPSHYALKEDSKRGFQLGLILIGGGNMDEGIKIMNATLDHFPIGNADQDGAHAAEPSALILSSY
Ga0364929_0360278_107_5053300034149SedimentNDPSDKDVLGYFMLTTKELMDLRKFNPAYREEKLNAAVKKAQAFALKRIAPMTDPNSGPPCAEHATRGTPSHYSLKVDSKRGFQLGLILIGGGHTDEGTKIMNAALDHFPIGNAGQEGAHAAEPSAVILSGF
Ga0364935_0159334_363_7043300034151SedimentMDLQKFNPAYREEKLNAAVQRAQAFALKCIAPMTDPNSGPPCAEHATRRTPSHYALKEDSKRGFQLGLILIGGGNMDEGIKIMNATLDHFPIGNADQDGAHAAEPSALILSSY


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.