NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F089280

Metagenome / Metatranscriptome Family F089280

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F089280
Family Type Metagenome / Metatranscriptome
Number of Sequences 109
Average Sequence Length 79 residues
Representative Sequence MLGRLTVATAAIMSVIVIEQILHKSPQLYNLVMGGALSLDRLLLIWLHILPVIFYHATPEIVSIAVACRYYQWI
Number of Associated Samples 95
Number of Associated Scaffolds 109

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 3.70 %
% of genes near scaffold ends (potentially truncated) 98.17 %
% of genes from short scaffolds (< 2000 bps) 83.49 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.248 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(51.376 % of family members)
Environment Ontology (ENVO) Unclassified
(46.789 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(55.963 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 79.73%    β-sheet: 0.00%    Coil/Unstructured: 20.27%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 109 Family Scaffolds
PF01061ABC2_membrane 20.18
PF00005ABC_tran 11.01
PF00106adh_short 2.75
PF03739LptF_LptG 1.83
PF00487FA_desaturase 0.92
PF04116FA_hydroxylase 0.92
PF13469Sulfotransfer_3 0.92
PF13358DDE_3 0.92

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 109 Family Scaffolds
COG0795Lipopolysaccharide export LptBFGC system, permease protein LptFCell wall/membrane/envelope biogenesis [M] 1.83
COG1398Fatty-acid desaturaseLipid transport and metabolism [I] 0.92
COG3000Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamilyLipid transport and metabolism [I] 0.92
COG3239Fatty acid desaturaseLipid transport and metabolism [I] 0.92


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.25 %
UnclassifiedrootN/A2.75 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001867|JGI12627J18819_10087129All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1294Open in IMG/M
3300002245|JGIcombinedJ26739_100402945All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1247Open in IMG/M
3300003218|JGI26339J46600_10065830All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium938Open in IMG/M
3300003505|JGIcombinedJ51221_10130914All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1009Open in IMG/M
3300004092|Ga0062389_102287549All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium713Open in IMG/M
3300004092|Ga0062389_103298887Not Available605Open in IMG/M
3300004631|Ga0058899_12190736All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium607Open in IMG/M
3300004635|Ga0062388_100976155All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium821Open in IMG/M
3300005178|Ga0066688_10212270All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1232Open in IMG/M
3300005332|Ga0066388_100083857All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3575Open in IMG/M
3300005332|Ga0066388_101898531All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1063Open in IMG/M
3300005435|Ga0070714_102415735All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium511Open in IMG/M
3300005764|Ga0066903_108902976All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium509Open in IMG/M
3300006032|Ga0066696_10177313All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1347Open in IMG/M
3300006175|Ga0070712_100277545All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1348Open in IMG/M
3300006800|Ga0066660_10923677All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium709Open in IMG/M
3300010048|Ga0126373_11792470All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium677Open in IMG/M
3300010358|Ga0126370_11855734All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium585Open in IMG/M
3300011120|Ga0150983_12064539All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium850Open in IMG/M
3300011120|Ga0150983_15374068All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium631Open in IMG/M
3300012363|Ga0137390_11499772All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium615Open in IMG/M
3300012951|Ga0164300_11182950All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium505Open in IMG/M
3300016270|Ga0182036_10040522All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2855Open in IMG/M
3300016270|Ga0182036_10322655All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1182Open in IMG/M
3300016294|Ga0182041_10036109All Organisms → cellular organisms → Bacteria → Proteobacteria3222Open in IMG/M
3300016341|Ga0182035_11791889All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium556Open in IMG/M
3300016357|Ga0182032_10145070All Organisms → cellular organisms → Bacteria → Proteobacteria1748Open in IMG/M
3300016371|Ga0182034_10055883All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2633Open in IMG/M
3300016371|Ga0182034_10222683All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae1472Open in IMG/M
3300016422|Ga0182039_11458864All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium622Open in IMG/M
3300016445|Ga0182038_10006112All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales6564Open in IMG/M
3300016445|Ga0182038_11171617All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium684Open in IMG/M
3300018431|Ga0066655_10126754All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1476Open in IMG/M
3300018468|Ga0066662_11254513All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium755Open in IMG/M
3300018482|Ga0066669_11610740All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium593Open in IMG/M
3300020579|Ga0210407_10636852All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium829Open in IMG/M
3300020580|Ga0210403_10038562All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3819Open in IMG/M
3300020580|Ga0210403_10039325All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae3781Open in IMG/M
3300020580|Ga0210403_10441633All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1060Open in IMG/M
3300020583|Ga0210401_10339517All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1363Open in IMG/M
3300021170|Ga0210400_10636621All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium878Open in IMG/M
3300021171|Ga0210405_10714121All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium773Open in IMG/M
3300021178|Ga0210408_10736906All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium774Open in IMG/M
3300021362|Ga0213882_10121440All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1064Open in IMG/M
3300021372|Ga0213877_10109353All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium847Open in IMG/M
3300021377|Ga0213874_10381382All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium545Open in IMG/M
3300021401|Ga0210393_11463651All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium544Open in IMG/M
3300021420|Ga0210394_11779087All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium514Open in IMG/M
3300021432|Ga0210384_10118677All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2372Open in IMG/M
3300021432|Ga0210384_11747280All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium527Open in IMG/M
3300021478|Ga0210402_10644606All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium980Open in IMG/M
3300021479|Ga0210410_10857595All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium794Open in IMG/M
3300021559|Ga0210409_11054417All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium687Open in IMG/M
3300022533|Ga0242662_10090827All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium857Open in IMG/M
3300022533|Ga0242662_10244790All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium580Open in IMG/M
3300022718|Ga0242675_1082188All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium593Open in IMG/M
3300022722|Ga0242657_1141158All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium628Open in IMG/M
3300027076|Ga0208860_1034268All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium539Open in IMG/M
3300027729|Ga0209248_10095427All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium898Open in IMG/M
3300027903|Ga0209488_10060497All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae2798Open in IMG/M
3300029636|Ga0222749_10027555All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae2392Open in IMG/M
3300029636|Ga0222749_10819851All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium509Open in IMG/M
3300031128|Ga0170823_11549067All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae1688Open in IMG/M
3300031474|Ga0170818_113617849All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium589Open in IMG/M
3300031561|Ga0318528_10071418All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae1787Open in IMG/M
3300031564|Ga0318573_10083067All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae1621Open in IMG/M
3300031572|Ga0318515_10483492All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium661Open in IMG/M
3300031573|Ga0310915_10733776All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium696Open in IMG/M
3300031668|Ga0318542_10215707All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium970Open in IMG/M
3300031713|Ga0318496_10047991All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2206Open in IMG/M
3300031724|Ga0318500_10244063All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium870Open in IMG/M
3300031736|Ga0318501_10181585All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1095Open in IMG/M
3300031748|Ga0318492_10271034All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium880Open in IMG/M
3300031754|Ga0307475_10381198All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1133Open in IMG/M
3300031763|Ga0318537_10393510All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium511Open in IMG/M
3300031768|Ga0318509_10025559All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2824Open in IMG/M
3300031770|Ga0318521_10558977All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium690Open in IMG/M
3300031777|Ga0318543_10511046All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium538Open in IMG/M
3300031778|Ga0318498_10507401All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium531Open in IMG/M
3300031781|Ga0318547_10047846All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methyloferula → Methyloferula stellata2290Open in IMG/M
3300031792|Ga0318529_10085488All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1409Open in IMG/M
3300031794|Ga0318503_10006282All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2942Open in IMG/M
3300031845|Ga0318511_10293499All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium734Open in IMG/M
3300031860|Ga0318495_10024367All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2614Open in IMG/M
3300031879|Ga0306919_10004242All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria7427Open in IMG/M
3300031893|Ga0318536_10054018All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methyloferula → Methyloferula stellata1947Open in IMG/M
3300031894|Ga0318522_10122003All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium974Open in IMG/M
3300031910|Ga0306923_11361425All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium749Open in IMG/M
3300031910|Ga0306923_12546027All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium503Open in IMG/M
3300031912|Ga0306921_10371992All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae1670Open in IMG/M
3300031941|Ga0310912_10235837All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1405Open in IMG/M
3300031942|Ga0310916_11742875All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium503Open in IMG/M
3300031945|Ga0310913_11137423All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium545Open in IMG/M
3300031954|Ga0306926_11032362All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium976Open in IMG/M
3300031959|Ga0318530_10020237All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2279Open in IMG/M
3300031962|Ga0307479_10578482All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1105Open in IMG/M
3300031962|Ga0307479_11228715All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium712Open in IMG/M
3300032001|Ga0306922_10451640All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1373Open in IMG/M
3300032025|Ga0318507_10047813All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methyloferula → Methyloferula stellata1670Open in IMG/M
3300032035|Ga0310911_10186449All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1176Open in IMG/M
3300032035|Ga0310911_10336943All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium870Open in IMG/M
3300032039|Ga0318559_10272287All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium785Open in IMG/M
3300032041|Ga0318549_10175816All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium958Open in IMG/M
3300032044|Ga0318558_10564430All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium569Open in IMG/M
3300032059|Ga0318533_11406305All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium509Open in IMG/M
3300032091|Ga0318577_10094250Not Available1396Open in IMG/M
3300032174|Ga0307470_11188024All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium619Open in IMG/M
3300033290|Ga0318519_11036173All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium510Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil51.38%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil14.68%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil6.42%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil4.59%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.75%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.75%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.75%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.83%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.83%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.92%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.92%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.92%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.92%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.92%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.92%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300003218Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1EnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004631Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021362Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09EnvironmentalOpen in IMG/M
3300021372Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01EnvironmentalOpen in IMG/M
3300021377Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7Host-AssociatedOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022533Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022718Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022722Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300027076Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF012 (SPAdes)EnvironmentalOpen in IMG/M
3300027729Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12627J18819_1008712923300001867Forest SoilMLGRLTVATAAIMSVIVIEQILHKSPQLYDLVMSGELSLDRLLLIWVHILPVIFYHATPEIVSIAVACRYYQWI
JGIcombinedJ26739_10040294513300002245Forest SoilMLGRLTVATAAIMSVIVIEQVLHKSPQLYYLVMGGALSLDRLLLIWLHILPVIFYHATPEIVSIAVACRYYQWIENNEVLSLRSAGRSSCQIACPGIIVAVLA
JGI26339J46600_1006583023300003218Bog Forest SoilMLGRLTVTTAAIMSVIVVEQILEKSQHLYDLVIARALPLDRLLLIWFHILPVIFYHASPEVVSIAVAWQYHQWHENNEVLTLRSAGRSCRQIAC
JGIcombinedJ51221_1013091423300003505Forest SoilMLGRLTVATAAIMSVIVIEQILHKSPQLYNLVMGGALSLDRLLLIWLHILPVIFYHATPEIVSIAVACRYYQWIENNEVLSL
Ga0062389_10228754913300004092Bog Forest SoilMVGRLTFATAAIMSVIVIEQILHKSPQLYDLVMSGALSPVRLLLIWLHILPVIFYHATPEIVSIAVACRYYQWI
Ga0062389_10329888723300004092Bog Forest SoilMLGRLTVTTAAIMSVIAVEQIFEKSHRLYDLVIAGALPLDRLLLIWFHILPVIFYHASPE
Ga0058899_1219073623300004631Forest SoilMFGRLTVATAAIMSVIVIEQILHKSPQLYDLVMSGELSLDRLLLIWVHILPVIFYHATPEIVSIAVACRYYQWIE
Ga0062388_10097615523300004635Bog Forest SoilMVGRLTFATAAIMSVIVIEQILHKSPQLYDLVMSGALSPVRLLLIWLHILPVIFYHATPEIVSIAVACRYYQWIE
Ga0066688_1021227023300005178SoilMLGRLTVATAAIMSVIVIEQILHKSPQLYDLVMSGALSLDRLGLIWLHILPVIFYHATPEIVSIGVACRYYQWIENNEVLSLRNAGRSSSQIACPGIIVAVLAASFCALNSLCLLP
Ga0066388_10008385713300005332Tropical Forest SoilVITIYRHMLGRLTVTTAAIMSVIVVEQILEKSRKLYDLVMAGALPLHRLVLIWLHVLPVIFYHASPEIVSIAVAWRY
Ga0066388_10189853123300005332Tropical Forest SoilMLGRLTVTTAAIMSVIVVEQILEKSRKLYDLVMAGALPLHRLLLIWFHILPVIFYHASPEIVSIAVA
Ga0070714_10241573513300005435Agricultural SoilMLGRLTVATAAIMSVIVIEQILHKSPQLYNLVMGGALSLDRLLLIWLHILPVIFYHATPEIVSIAVACRYY
Ga0066903_10890297613300005764Tropical Forest SoilMLGRLTIATALIMSVIVVEQILHKSPELYDLVIAGALSLDRLLLIWLYILPVIFYHATPEIISIAVAFRYYAWIENNEVLTLRSVGQSSRQIACPGMIVA
Ga0066696_1017731313300006032SoilMLGRLTVATAAIMSVIVIEQILHKSPQLYDLVMSGALSLDRLGLIWLHILPVIFYHATPEIVSIGVACRYYQWIEDNEVLSLR
Ga0070712_10027754523300006175Corn, Switchgrass And Miscanthus RhizosphereMLGRLTVATAAIMSVIVIEQILHKSPQLYNLVMGGALSLDRLLLIWLHILPVIFYHATPEIVSIAVACRYYQWI
Ga0066660_1092367723300006800SoilMLGRLTVATAAIMSVIVIEQILHKSPQLYDLVMSGALSPDRLLLIWLHILPVIFYHATPEIVSIAVACR
Ga0126373_1179247013300010048Tropical Forest SoilMLGRLTVATAAIMVVIVVEQILEKSRNLYDLVMAGALPLDRLLLIWLHILPVIFYHASPEIVSIAVAWQYHH
Ga0126370_1185573413300010358Tropical Forest SoilMLGQLTFATAVIMSAVVVEQILHKSPKLYDLVMAGALSLDRLLSIWLYILPVIFYHATPEIVSMAVAFRYYRWIENNEVLI
Ga0150983_1206453913300011120Forest SoilMLGRLTVATAAIMSVIVIEQVLHKSPQLYYLVMGGALSLDRLLLIWLHILPVIFYHATPEIVSIAVACRYYQWIENNEVLSSRSAGRSSCQIACPGIIV
Ga0150983_1537406823300011120Forest SoilMLGRLTVATAAIMSVIVIEQILHKSPQLYNLVMGGALSLDRLLLIWLHILPVIFYHATPEIVSIAVACRYYQWIENNEVLSLRSAGRSS
Ga0137390_1149977213300012363Vadose Zone SoilMAKLRVGEQILHKSPKLYDLVMAGALSLDRLLSIWLYILPVIFYHATPEIVSIAVAFQYYQWIENNEVLTLRSA
Ga0164300_1118295013300012951SoilMLGRLTVTTALIMSAIVFEQILHKSPKLYDLLMAGALSLDRLLLIWLHILSVIFYQATPEIVSIAVACRYYQWIENN
Ga0182036_1004052213300016270SoilMLGQLTIATALIMSAIVVEQILHKSPELYPLVIAGALSLDRLLSIWLYILPVIFYHATPEIVSIAV
Ga0182036_1032265523300016270SoilMLGRLTVTTAAIMSVIVVEQILEKSRKLYDLVMAGALPLHRLLLIWLHILPVIFYHASPEIVSIAVAW
Ga0182041_1003610913300016294SoilMLGQLTIATALIMSAIVVEQILHKSPELYPLVIAGALSLDRLLSIWLYILPVIFYHATPEIVSIAVAFLYYLWIEKNEVLTLRSAGQSSRQIACPGMIVAVLAALF
Ga0182035_1179188913300016341SoilMLGRLTVTTAAIMSVIVVEQIFEKSRKLYDLVIAGALPLDRLLLIWFHILPVIFYHASPEIVSI
Ga0182032_1014507043300016357SoilMLGRLIVTIAAIMSVIVVEQILEKSRKLYDLVMAGVLPLHRLLLIWLHILPVIFYHASPEIVSIAVAWRYRQWIEN
Ga0182034_1005588333300016371SoilMLGRLTVTTAAIMSVIVVEQIFEKSHRLYDLVIAGALPLDRLLLIWFHILPVIFYHASPEIVSIAVAWRYHQWIENN
Ga0182034_1022268333300016371SoilMLGQLTIATALIMSAIVVEQILHKSPELYHLVIAGALSPDRLLSIWLYILPVIFYHATPEIVSIAVAFRYYLWI
Ga0182039_1145886423300016422SoilMLGRLTVTTAAIMSVIVVEQILEKSRKLYDLVMAGALPLHRLLLIWLHILPVIFYHASPEIVSIAV
Ga0182038_1000611213300016445SoilMLGQLTIATALIMSAIVVEQILHKSPELYPLVIAGALSLDRLLSIWLYILPVIFYHATPEIVSIAVAFRYYLWIEKNEVLTLRSAGQSSRQIACP
Ga0182038_1117161723300016445SoilMLGRLTVTTAAIMSVIVVEQILEKSRKLYDLVMAGALPLHRLLLIWLHILPVIFYHASPEIVSIAVAWRYYQ
Ga0066655_1012675413300018431Grasslands SoilMLGRLTVATAAIMSVIVIEQILHKSPQLYDLVMSGALSLDRLGLIWLHILPVIFYHATPEIVSIGVACRYYQWIENNEVLSLRNAGRSSSQIACPGIIVAVLAASFCALNSLCLLPFSWRSL
Ga0066662_1125451313300018468Grasslands SoilMLGRLTVATAAIMSVIVIEQILHKSPQLYDLVMSGALPLDRLGLIWLHILPVIFYHATPEIVSIGIACRYYQWFENHDVFSLRKSGRSSSQISCPCITL
Ga0066669_1161074023300018482Grasslands SoilMLGRLTVATAAIMSVIVIEQILHKSPQLYDLVMSGALSLDRLGLIWLHILPVIFYHATPEIVSIGVACRYYQW
Ga0210407_1063685213300020579SoilMLGRLTVATAAIMSVIVIEQVLHKSPQLYYLVMGGALSLDRLLLIWLHILPVIFYHATPEIVSIAVACRYYQWIENNEVLSLRSAGRSSCQIACPGIIVAVLAASFCAL
Ga0210403_1003856213300020580SoilMLGRLTVTTAAIMSVIVAEQILEKSQKLYELVMAGALPFDRLLFIWLHILPVIFYHASPEIVSIAVAWQYHHWIE
Ga0210403_1003932513300020580SoilMLGRLTVATAAIMSVIVIEQILHKSPQLYNLVMGGALSLDRLLLIWLHILPVIFYHATPEIVSIAVACRYYQWIENNEVLSLRSAG
Ga0210403_1044163313300020580SoilMLGRLTVTTAAITSVIVVEQILEKSQRLYDLVITGALPLDRLLLIWFHILPVIFYHA
Ga0210401_1033951723300020583SoilMLGRLTVATAAIMSVIVIEQILHKSPQLYNLVMGGALSLDRLLLIWLHILPVIFYHATPEIVSIAVACRYYQWIENNEVLSLRSAGRSRC
Ga0210400_1063662123300021170SoilMLGRLTVATAAIMSVIVIEQILHKSPQLYNLVMGGALSLDRLLLIWLHILPVIFYHATPEIVSIAVACRYYQWIENNEVLSLRSAGRSSCQIACPGIIVAVLA
Ga0210405_1071412123300021171SoilMLGRLTVATAAIMSVIVIEQILHKSPQLYNLVMGGALSLDRLLLIWLHILPVIFYHATPEIVSIAVACRYYQWIENNEVLSLRSAGRSSC
Ga0210408_1073690613300021178SoilMLGRLTVATAAIMSVIVIEQILHKSPQLYNLVMGGALSLDRLLLIWLHILPVIFYHATPEIVSIAVACRYYQWIENNEVLS
Ga0213882_1012144013300021362Exposed RockMLGRLTVATAAIMSVIVIEQILHKSPQLYNLVTSGALSLDRLLLIWLHILPVIFYHATPEIVSIA
Ga0213877_1010935313300021372Bulk SoilMLGQLTIATALIMSVIVVEQILHKSPELYDLVIAGALSLDRLLSIWLYILPVIFYHATPEIVSIAVAWRYHQWIGNNEILTLRSAGRSC
Ga0213874_1038138213300021377Plant RootsMLGQLAIATALIMSVIAVEQILHKSPELYHLVIAGALSLDWLLSIWLYILPVIFYHATPEIVSIAVAFRYYLWIENNEILILRSAGQSSRQIAYPGMIAAVL
Ga0210393_1146365113300021401SoilMLGQLTIATALIMSAIVVEQILHKSPELYHLVIAGALSLDRLLSIWLYILPVIFYHATPEIVSIAVAFRYYLWIENNEVLTLRSAGQSSRQIAC
Ga0210394_1177908723300021420SoilMLGRLTVTTAAIMSVIVVEQILEKSRKLYDLVMAGALPLHRLLLIWLHILPVIFYHASPEIVSIAVAWRYYQWIENNE
Ga0210384_1011867713300021432SoilMLGRLTVTTAAITSVIVVEQILEKSQRLYDLVITGALPLDRLLLIWFHILPVIFYHASPEIVSIAVAWRYHQWNE
Ga0210384_1174728013300021432SoilMLGRLTVATAAIMSVIVIEQVLHKSPQLYYLVMGGALSLDRLLLIWLHILPVIFYHATPEIVSIAVACRYYQWIENNEVLSLRSA
Ga0210402_1064460623300021478SoilMLGRLTVATAAIMSVIVIEQILHKSPQLYNLVMGGALSLDRLLLIWLHILPVIFYHA
Ga0210410_1085759513300021479SoilMLGRLTVATAAIMSVIVIEQILHKSPQLYNLVMGGALSLDRLLLIWLHILPVIFYHATPEIVSIAVACRYYQWIENNEVLSLRSAGRSSCQIACPGIIVA
Ga0210409_1105441713300021559SoilMLGRLTVATAAIMSVIVIEQILHKSPQLYNLVMGGALSLDRLLLIWLHILPVIFYHATPEIVSI
Ga0242662_1009082713300022533SoilMLGRLTVATAAIMSVIVIEQILHKSPQLYNLVMGGALSLDRLLLIWLHILPVIFYHATPEIVSIAVACRYYQWIENNEVLSLRSAGRSSCQI
Ga0242662_1024479023300022533SoilMLGRLTVATAAIMSVIVIEQVLHKSPQLYYLVMGGALSLDRLLLIWLHILPVIFYHATPEIVSIAVACRYYQWIENNEVLSL
Ga0242675_108218823300022718SoilMLGRLTVATAAIMSVIVIEQILHKSPQLYDLVMSGELSLDRLLLIWVHILPVIFYHATPEIV
Ga0242657_114115823300022722SoilMLGRLTVATAAIMSVIVIEQVLHKSPQLYNLVMGGALSVDGLLLIWLHILPVIFYHATPEIVSIAVAC
Ga0208860_103426813300027076Forest SoilMLGRLTVATAAIMSVIVIEQILHKSPQLYDLVMSGELSLDRLLLIWVHILPVIFYHATPEIVSIAVACRYYQWIENNEVLTL
Ga0209248_1009542723300027729Bog Forest SoilMLGRLTVATAAIMSVIVIEQILHKSPQLYDLVMSGALSPERLLLVWLHILPVIFYHATPEIVSIAVACRYYQWIEDNEVLTLRSAGRSSCQIACPGIIVAML
Ga0209488_1006049713300027903Vadose Zone SoilMLGRLTVATAAIMSVIVIEQILHKSPQLYDLVMSGALSLDRLLLIWLHILPVIFYHATPEIVSIG
Ga0222749_1002755533300029636SoilMLGRLTVATAAIMSVIVIEQILHKSPQLYNLVMGGALSLDGLLLIWLHILPVIFYHATPEIVSIAVACRYYQWIENNEVLSLR
Ga0222749_1081985113300029636SoilMLGRLTVATAAIMSVIVIEQVLHKSPQLYYLVMGGALSLDRLLLIWLHILPVIFYHATPEIVSIAVACRYYQWIENNEVLSLRS
Ga0170823_1154906713300031128Forest SoilMLGRLTVATAAIMSVIVIEQVLHKSPQLYYLVMGGALSPARVLLIWLHILPVIFYHATPEIVSIAVAC
Ga0170818_11361784923300031474Forest SoilMLGRLTVATAAIMSVIVIEQVLHKSPQLYYLVMGGALSPARVLLIWLHILPVIFYHATPEIVSIAVA
Ga0318528_1007141813300031561SoilMLGRLTVTTAAIMSVIVVEQILEKSRKLYDLVMAGALPLHRLLLIWLHILPVIFYHASPEIVSIAVAWR
Ga0318573_1008306713300031564SoilMLGQLTIATALIMSAIVVEQILHKSPELYHLVIAGALSPDRLLSIWLYILPVIFYHATPEIVSIAVAFRYYLWIENN
Ga0318515_1048349223300031572SoilMLGQLTIATALIMSAIVVEQILHKSPELYHLVIAGALSPDRLLSIWLYILPVIFYHATPEIVSIAVAFRYYLWIEKNEVLTLRSAGQSSRQIACPGMIVAV
Ga0310915_1073377613300031573SoilMLGQLTIATALIMSAIVVEQILHKSPELYHLVIAGALSPDRLLSIWLYILPVIFYHATPEIVSIAVAFRYYLWIENNEVLTLR
Ga0318542_1021570713300031668SoilVVTIHRRMLGQLTVATAVIMAAVVVEQILHKSPKLYDLVMAGALSLGRLLSIWLYILPVIFYHATPEIVSIAVAFRYYRWIEN
Ga0318496_1004799113300031713SoilMLGRLTVTTAAIMSVIVVEQILEKSRKLYDLVMAGALPLHRLLLIWLQILPVIFYHASPEIVSIAVAWRYYQWIEN
Ga0318500_1024406323300031724SoilMLGQLTIATALIMSAIVVEQILHKSPELYHLVIAGALSPDRLLSIWLYILPVIFYHATPEIVSIAVAFRYYLWIEKNEVL
Ga0318501_1018158523300031736SoilMLGQLTIATALIMSAIVVEQILHKSPELYPLVIAGALSLDRLLSIWLYILPVIFYHATPEIVSIAVAFRYYLW
Ga0318492_1027103413300031748SoilMLGQLTIATALIMSAIVVEQILHKSPELYHLVIAGALSPDRLLSIWLYILPVIFYHATPEIVSIAVAFRYYLWIENNE
Ga0307475_1038119813300031754Hardwood Forest SoilMLGRLTVATAAIMSVIVIEQVLHKSPQLYYLVMGGALSLDRLLLIWLHILPVIFYHATPEIVSIAVACRYYQWIENNEVLTLRSAGRSSCQIAC
Ga0318537_1039351013300031763SoilMLGQLTIATALIMSAIVVEQILHKSPELYPLVIAGALSLDRLLSIWLYILPVIFYHATPEIVSIAVAFRYYLWIENNEVL
Ga0318554_1076825313300031765SoilMLGRLTVTTAAIMSVIVVEQILEKSRKLYDLVMAGALPLHRLLLIWLHILPVIFYH
Ga0318509_1002555913300031768SoilMLGQLTIATALIMSAIVVEQILHKSAELYPLVIAGALSLDRLLSIWLYILPVIFYHATPEIVSIAVAFRY
Ga0318521_1055897723300031770SoilMLGQLTIATALIMSAIVVEQILHKSPELYHLVIAGALSPDRLLSIWLYILPVIFYHATPEIVSIAVAFRYYL
Ga0318543_1051104613300031777SoilMLGRLTVTTAAIMSVIVVEQIFEKSHRLYDLVIAGALPLDRLLLIWFHILPVIFYHASPEIVSIAVAWRYHQWIENNEVL
Ga0318498_1050740123300031778SoilMLGRLTVTTAAIMSVIVVEQILEKSRKLYDLVMAGALPLHRLLLIWLHILPVIFYHASPEIVSIAVAWRYYQW
Ga0318547_1004784613300031781SoilMLGQLTVATAVIMAAVVVEQILHKSPKLYDLVMAGALSLGRLLSIWLYILPVIFYHATPEIVSIAVAFRYYRWIENNEVLILRS
Ga0318529_1008548823300031792SoilVVTIHRRMLGQLTVATAVIMAAVVVEQILHKSPKLYDLVMAGALSLGRLLSIWLYILPVIFYHATPEIVSIAVAFRYYRWIENN
Ga0318503_1000628263300031794SoilMLGRLTVTTAAIMSVIVVEQIFEKSHRLYDLVIAGALPLDRLLLIWFHILPVIFYHASPEIVSIAVAWRYHQWIENNEVLTLRSTGRS
Ga0318511_1029349923300031845SoilMLGQLTIATALIMSAIVVEQILHKSPELYPLVIAGALSLDRLLSIWLYILPVIFYHATPE
Ga0318495_1002436713300031860SoilMLGRLTVTTAAIMSVIVVEQILEKSRKLYDLVMAGALPLHRLLLIWLHILPVIFYHASPEIVSIAVAWRYYQWIENNEVLTLRSA
Ga0306919_1000424213300031879SoilMLGQLTIATALIMSAIVVEQILHKSPELYPLVIAGALSLDRLLSIWLYILPVIFYHATPEIVSIAVAFRYYLWI
Ga0318536_1005401833300031893SoilMLARLTVTTAAIMSVIVVEQILEKSRKLYDLVMAGALPLHRLLLIWFHILPVIFYHASPE
Ga0318522_1012200313300031894SoilMLGRLTVTTAAIMSVIVVEQILEKSRKLYDLVMAGALPLHRLLLIWLHILPVIFYHASPEIVSIAVAWRYYQWIENNEVLTLRGAGRSC
Ga0306923_1136142523300031910SoilMLGRLTVTTAAIMSVIVVEQILEKSRKLYDLVMAGALPLHRLLLIWLHILPVIFYHASPEIVS
Ga0306923_1254602713300031910SoilMLGRLIVTIAAIMSVIVVEQILEKSRKLYDLVMAGVLPLHRLLLIWLHILPVIFYHASPEIVSIAVAWRYRQWIENNEVLTLRSAGTGCLQIA
Ga0306921_1037199213300031912SoilMLGRLTVATAAIMSVIVIEQILHKSPQLYDLVMGGGLSVDRLLLIWLHILPVIFYHATPEIVSIAVACRYYHWIENNEVLSL
Ga0310912_1023583723300031941SoilMLGRLTVTTAAIMSVIVVEQILEKSRKLYDLVMAGALPLHRLLLIWLHILPVIFYHASPEIVSIAVAWRYYQWI
Ga0310916_1174287513300031942SoilMLGRLTVATAAIMSVIVIEQILHKSPQLYDLVMSGELSLDRLLLIWVHILPVIFYHATPE
Ga0310913_1113742313300031945SoilMLGRLTVTTAAIMSVIVIEQILEKSRKLYDLVMTGALPVHRVLLIWLHILPVIFYHASPEIVSIAVTWRYYQWIQ
Ga0306926_1103236223300031954SoilMLGQLTIATALIMSAIVVEQILHKSPELYPLVIAGALSLDRLLSIWLYILPVIFYHATPEIVSIAVAFRYYLWIEK
Ga0318530_1002023733300031959SoilMLGRLTVTTAAIMSVIVVEQILEKSRKLYDLVMAGALPLHRLLLIWLHILPVIFYHASPEIVSIAVAWRYYQWIEDNEVLTLRS
Ga0307479_1057848223300031962Hardwood Forest SoilMLGRLTVTTAAIMSVIVVEQILEKSRKLYDLVMAGALPLDRLLSIWLHILPVIFYHASPEIVSIAVAWQY
Ga0307479_1122871513300031962Hardwood Forest SoilMLGRLTVTTAAIMSVIVVEQILEKSRKLYDLVMAGALPLHRLLLIWLHILPVIFYHASPEIVSIA
Ga0306922_1045164023300032001SoilMLGRLTVTTAAIMSVIVVEQILEKSRKLYDLVMAGALPLHRLLLIWLQILPVIFYHASPEIVSIAVAWRYYQWIENNEVLTLRSAGRSCL
Ga0318507_1004781313300032025SoilMLGQLTVATAVIMAAVVVEQILHKSPKLYDLVMAGALSLGRLLSIWLYILPVIFYHATPEIVSIAVAFRYYRWIENN
Ga0310911_1018644923300032035SoilMLGRLTVTTAAIMSVIVVEQILEKSRKLYDLVMAGALPLHRLLLIWLHILPVIFYHASPEIVSIAVAWRYYQWIENNEVLTLRGAGRSCLQIACP
Ga0310911_1033694313300032035SoilMLGQLTIATALIMSAIVVEQILHKSPELYHLVIAGALSPDRLLSIWLYILPVIFYHATPEIVSIAVAFRYYLWIEN
Ga0318559_1027228713300032039SoilVVTIHRRMLGQLTVATAVIMAAVVVEQILHKSPKLYDLVMAGALSLGRLLSIWLYILPVIFYHATPEI
Ga0318549_1017581613300032041SoilMLGRLTVTTAAIMSVIVVEQILEKSRKLYDLVMAGALPLHRLLLIWLHILPVIFYHASPEIVSIAVAWRYYQWIEDNEVLTLRSTGRSCL
Ga0318558_1056443013300032044SoilMLARLTVTTAAIMSVIVVEQILEKSRKLYDLVMAGALPLHRLLLIWFHILPVIFYHASPEIVSIAVAWRYH
Ga0318533_1140630513300032059SoilMLGRLTVTTAAIMSVIVVEQILEKSRKLYDLVMAGALPLHRLLLIWLHILPVIFYHASPEIVSIAVAWRYYQWIEDNEVLTLRSTGRS
Ga0318577_1009425013300032091SoilMLGRLTVTTAAIMSVIVVEQILEKSRKLYDLVMAGALPLHRLLLIWLHILPVIFYLASP
Ga0307470_1118802413300032174Hardwood Forest SoilMLGRLTVATAAIMSVIVIEQILHKSPQLYNLVMGGALSLDRLLLIWLHILPVIFYHATPEIVSIAVACRYYQWIENNEVLSLR
Ga0318519_1103617313300033290SoilMLGQLTIATALIMSAIVVEQILHKSPELYHLVIAGALSPDRLLSIWLYILPVIFYHATPEIVSIAVAFRYYLWIENNEVLTLRSAGQSSRQIACPG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.