NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F089944

Metagenome Family F089944

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F089944
Family Type Metagenome
Number of Sequences 108
Average Sequence Length 42 residues
Representative Sequence MNLTPEQIQEHIANLSDATVEDLDDLLHDLCCLAWPTTDGQNN
Number of Associated Samples 73
Number of Associated Scaffolds 108

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 72.22 %
% of genes near scaffold ends (potentially truncated) 43.52 %
% of genes from short scaffolds (< 2000 bps) 93.52 %
Associated GOLD sequencing projects 67
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (66.667 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Loam → Grasslands → Soil
(19.444 % of family members)
Environment Ontology (ENVO) Unclassified
(25.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(43.519 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 42.25%    β-sheet: 0.00%    Coil/Unstructured: 57.75%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 108 Family Scaffolds
PF13466STAS_2 54.63
PF12850Metallophos_2 13.89
PF01584CheW 2.78
PF00563EAL 2.78
PF02518HATPase_c 2.78
PF01909NTP_transf_2 1.85
PF01061ABC2_membrane 0.93
PF00149Metallophos 0.93
PF02073Peptidase_M29 0.93
PF13649Methyltransf_25 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 108 Family Scaffolds
COG2200EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant)Signal transduction mechanisms [T] 2.78
COG3434c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domainsSignal transduction mechanisms [T] 2.78
COG4943Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domainsSignal transduction mechanisms [T] 2.78
COG5001Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domainSignal transduction mechanisms [T] 2.78
COG2309Leucyl aminopeptidase (aminopeptidase T)Amino acid transport and metabolism [E] 0.93

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms66.67 %
UnclassifiedrootN/A33.33 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001205|C688J13580_1017103All Organisms → cellular organisms → Bacteria852Open in IMG/M
3300001686|C688J18823_10187528All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei1402Open in IMG/M
3300001686|C688J18823_10271556All Organisms → cellular organisms → Bacteria1121Open in IMG/M
3300001686|C688J18823_10586187All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei712Open in IMG/M
3300001686|C688J18823_11110098Not Available501Open in IMG/M
3300002568|C688J35102_119221832All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria657Open in IMG/M
3300002568|C688J35102_119330218All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300002568|C688J35102_119397664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium687Open in IMG/M
3300002568|C688J35102_119819474Not Available784Open in IMG/M
3300002568|C688J35102_119928566All Organisms → cellular organisms → Bacteria817Open in IMG/M
3300002568|C688J35102_120007836All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria844Open in IMG/M
3300002568|C688J35102_120158797All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria904Open in IMG/M
3300002568|C688J35102_120244548All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria946Open in IMG/M
3300002568|C688J35102_120470827All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1095Open in IMG/M
3300002568|C688J35102_120982809All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei5292Open in IMG/M
3300003267|soilL1_10031101All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2153Open in IMG/M
3300003267|soilL1_10092764All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1256Open in IMG/M
3300003322|rootL2_10323746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1294Open in IMG/M
3300004081|Ga0063454_100047106All Organisms → cellular organisms → Bacteria1683Open in IMG/M
3300004081|Ga0063454_100097272All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1389Open in IMG/M
3300004081|Ga0063454_101531082All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria572Open in IMG/M
3300004153|Ga0063455_100417663All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria799Open in IMG/M
3300004153|Ga0063455_100454461All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria779Open in IMG/M
3300004153|Ga0063455_100945902All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium617Open in IMG/M
3300004463|Ga0063356_101296826All Organisms → cellular organisms → Bacteria1065Open in IMG/M
3300004463|Ga0063356_104189456Not Available620Open in IMG/M
3300005093|Ga0062594_101617861Not Available672Open in IMG/M
3300005327|Ga0070658_11662918All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300005328|Ga0070676_10540597Not Available833Open in IMG/M
3300005329|Ga0070683_100799556All Organisms → cellular organisms → Bacteria904Open in IMG/M
3300005334|Ga0068869_100428545All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1093Open in IMG/M
3300005338|Ga0068868_100322335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1317Open in IMG/M
3300005338|Ga0068868_100866821Not Available819Open in IMG/M
3300005341|Ga0070691_10721810All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria600Open in IMG/M
3300005344|Ga0070661_100332804All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1188Open in IMG/M
3300005347|Ga0070668_101368234All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales645Open in IMG/M
3300005406|Ga0070703_10166986Not Available840Open in IMG/M
3300005437|Ga0070710_10511177Not Available824Open in IMG/M
3300005458|Ga0070681_10932916All Organisms → cellular organisms → Bacteria787Open in IMG/M
3300005535|Ga0070684_100313502All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1440Open in IMG/M
3300005543|Ga0070672_100789630All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales835Open in IMG/M
3300006954|Ga0079219_10431315All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales889Open in IMG/M
3300007790|Ga0105679_10702503Not Available1090Open in IMG/M
3300007790|Ga0105679_10876463All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2118Open in IMG/M
3300009100|Ga0075418_13141976All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium503Open in IMG/M
3300009148|Ga0105243_10914437All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium874Open in IMG/M
3300009156|Ga0111538_11370980All Organisms → cellular organisms → Bacteria892Open in IMG/M
3300009156|Ga0111538_13356536Not Available557Open in IMG/M
3300009162|Ga0075423_12169202Not Available603Open in IMG/M
3300009162|Ga0075423_12544237Not Available559Open in IMG/M
3300009177|Ga0105248_11774839Not Available700Open in IMG/M
3300009177|Ga0105248_12165325Not Available633Open in IMG/M
3300009840|Ga0126313_11079212Not Available659Open in IMG/M
3300010039|Ga0126309_10734201All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria638Open in IMG/M
3300010041|Ga0126312_10694778All Organisms → cellular organisms → Bacteria734Open in IMG/M
3300010371|Ga0134125_10974381All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria930Open in IMG/M
3300010371|Ga0134125_11793562All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300010373|Ga0134128_10250819All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1986Open in IMG/M
3300010373|Ga0134128_11737186Not Available687Open in IMG/M
3300010400|Ga0134122_10755131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria922Open in IMG/M
3300012212|Ga0150985_111327463All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria548Open in IMG/M
3300012212|Ga0150985_113043257All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria514Open in IMG/M
3300012469|Ga0150984_108787488All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria616Open in IMG/M
3300012469|Ga0150984_115305800All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria511Open in IMG/M
3300012955|Ga0164298_10776196All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300012957|Ga0164303_10051273All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD00591831Open in IMG/M
3300013102|Ga0157371_11156287Not Available595Open in IMG/M
3300014487|Ga0182000_10285988Not Available680Open in IMG/M
3300014488|Ga0182001_10079914Not Available964Open in IMG/M
3300014497|Ga0182008_10651335Not Available597Open in IMG/M
3300014497|Ga0182008_10689502Not Available582Open in IMG/M
3300014745|Ga0157377_10242339All Organisms → cellular organisms → Bacteria1164Open in IMG/M
3300014969|Ga0157376_12900468Not Available519Open in IMG/M
3300019377|Ga0190264_10504017All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria829Open in IMG/M
3300019377|Ga0190264_11533276Not Available581Open in IMG/M
3300024055|Ga0247794_10339628Not Available512Open in IMG/M
3300024430|Ga0196962_10040042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1411Open in IMG/M
3300024430|Ga0196962_10202701Not Available638Open in IMG/M
3300025321|Ga0207656_10145600All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1119Open in IMG/M
3300025898|Ga0207692_10839156Not Available602Open in IMG/M
3300025901|Ga0207688_10023900All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3350Open in IMG/M
3300025907|Ga0207645_10151930All Organisms → cellular organisms → Bacteria1512Open in IMG/M
3300025915|Ga0207693_10099341All Organisms → cellular organisms → Bacteria2282Open in IMG/M
3300025923|Ga0207681_11226040Not Available630Open in IMG/M
3300025927|Ga0207687_10281535All Organisms → cellular organisms → Bacteria1333Open in IMG/M
3300025933|Ga0207706_11227600All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria622Open in IMG/M
3300025937|Ga0207669_10340376All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1155Open in IMG/M
3300026075|Ga0207708_10018765All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD00595210Open in IMG/M
3300026075|Ga0207708_10389765All Organisms → cellular organisms → Bacteria1150Open in IMG/M
3300028381|Ga0268264_11278009Not Available744Open in IMG/M
3300028592|Ga0247822_11116125All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria655Open in IMG/M
3300028596|Ga0247821_10491385Not Available779Open in IMG/M
3300028596|Ga0247821_10954240Not Available573Open in IMG/M
3300028705|Ga0307276_10067401All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria822Open in IMG/M
3300028778|Ga0307288_10310821All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria629Open in IMG/M
3300028812|Ga0247825_11220129Not Available549Open in IMG/M
3300028889|Ga0247827_10933368All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300030336|Ga0247826_11473954All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300030336|Ga0247826_11498822All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria547Open in IMG/M
3300030336|Ga0247826_11505439Not Available546Open in IMG/M
3300030510|Ga0268243_1143536Not Available575Open in IMG/M
3300031901|Ga0307406_11873895Not Available534Open in IMG/M
3300031938|Ga0308175_100509123All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1281Open in IMG/M
3300031995|Ga0307409_101525499Not Available696Open in IMG/M
3300031995|Ga0307409_101640686All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria671Open in IMG/M
3300032002|Ga0307416_103767346Not Available508Open in IMG/M
3300033551|Ga0247830_11352900All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria569Open in IMG/M
3300034268|Ga0372943_0010003All Organisms → cellular organisms → Bacteria4924Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil19.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil9.26%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.56%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil4.63%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.63%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil3.70%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere3.70%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere3.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.78%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.78%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.78%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.78%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil1.85%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere1.85%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.85%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.85%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere1.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.93%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.93%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.93%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.93%
Sugarcane Root And Bulk SoilHost-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001205Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300003267Sugarcane bulk soil Sample L1EnvironmentalOpen in IMG/M
3300003322Sugarcane root Sample L2Host-AssociatedOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007790Microbial communities of desert soil contaminated with blood from dead anthrax infected zebra in Etosha National Park, Namibia. Combined Assembly of 14 sequencing projectsEnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300014487Bulk soil microbial communities from Mexico - Magueyal (Ma) metaGEnvironmentalOpen in IMG/M
3300014488Bulk soil microbial communities from Mexico - San Felipe (SF) metaGEnvironmentalOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300024430Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_20EnvironmentalOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028596Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14EnvironmentalOpen in IMG/M
3300028705Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115EnvironmentalOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300030510Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG (v2)EnvironmentalOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034268Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
C688J13580_101710323300001205SoilMNFTPEQIQEHITNLSDATVEDLDDLLHDLCCLAWPTTDGQNN*
C688J18823_1018752813300001686SoilMNLTPEQIQEHIASLSDATVEDLDDLLHDLCCLAWPTTDGQNN*
C688J18823_1027155613300001686SoilMNLTPEQIQEHITHLSDATVEDLDDLLHDLCCLAWPTTDGQNN*
C688J18823_1058618733300001686SoilTPEQIQEHITNLSDATVEDLDDLLHDLCCLAWPTTDGQNN*
C688J18823_1111009823300001686SoilMNLSPEQIQEHISNLSDATVEDLDDLLHDLCCLAWP
C688J35102_11922183213300002568SoilMNLTPQQIQEHIANMSDATVEDLDDLLHDLCCLAWPTTDGQNN*
C688J35102_11933021813300002568SoilMNLSPEQVQEHIEKLTGATVEDLDDLLHDLFCLAWPTTEGQNN*
C688J35102_11939766413300002568SoilMNLSPEQIQEHVSNLAEASVEDLDDLLHDLCCLAWPTSDGQNN*
C688J35102_11981947423300002568SoilMNLTPEQINEHIAKLTDATPEDLDDLLHDLCCLAWPTSDGQN
C688J35102_11992856623300002568SoilMNLTPEQIQEHITHLSDATVEDLDDLLHDLCCLAWPTTDGQN
C688J35102_12000783613300002568SoilMNLSPEQVQEHISKLSDATVEDLDDLLHDLFCLAWPTTDGQNN*
C688J35102_12015879723300002568SoilMNLSPEQVQEHIEKLADATVEDLDDLLHDLFCLAWPTTEGQNN*
C688J35102_12024454813300002568SoilMNLTPEQIQQHIANMSDASVEDLDDLLHDLCCLSWPTTDGQNN*
C688J35102_12047082723300002568SoilMNLTPEQIQQHITNLSDATVEDLDDLLHDLCCLAWPTTDGQNN*
C688J35102_12098280963300002568SoilMNLSPEQIQEHISNLSDATVEDLDDLLHDLCCLAWPTTDGQNN*
soilL1_1003110133300003267Sugarcane Root And Bulk SoilMNLSPEQIQEHITSLANASVEETDDLLHDLFCLAWPTTNSQNN*
soilL1_1009276423300003267Sugarcane Root And Bulk SoilMNLSPEQIQEHITSLSDATVEDLDDLLHDLCCLAWPTTDGQNN*
rootL2_1032374623300003322Sugarcane Root And Bulk SoilMNLSPEQIQEHITAMSEATVEDLDDLLHDLCCLAWPTTDGQNN*
Ga0063454_10004710613300004081SoilMNLTPEQINEHIAKLTDATPEDLDDLLHDLCCLAWPTSDGQNN*
Ga0063454_10009727213300004081SoilMNLSPEQVQEHISKLSDATVEDLDDLLHDLFCLAWPTTEGQNN*
Ga0063454_10153108213300004081SoilNLTPEQIQQHIANMSDASVEDLDDLLHDLCCLSWPTTDGQNN*
Ga0063455_10041766313300004153SoilMNLTPEQIQEHIASLSDATVEDLDDLLHDLCCLAWPTTDGQN
Ga0063455_10045446123300004153SoilMNLTPEQIQEHISKLTDATVEDLDDLLHDLFCLAWPTTDGQNN*
Ga0063455_10094590213300004153SoilMNLTPQQIQEHIANMSDATVEDLDDLLHDLCCLAWPTTDGQN
Ga0063356_10129682623300004463Arabidopsis Thaliana RhizosphereMNLTPEQIQEHVTNLADATVEDLDDLLHDLCCLAWPSSDGQNN*
Ga0063356_10418945613300004463Arabidopsis Thaliana RhizosphereMNLSPEQIQEHVSNLAEASVEDLDDLLHDLCCLAWPTTDGQNN*
Ga0062594_10161786123300005093SoilRPAMNLTPEQIQEHVANLADATVEDLDDLLHDLCCLAWPTSDGQNN*
Ga0070658_1166291823300005327Corn RhizosphereMNLTPEQIQEHVANLADATVEDLDDLLHDLCCLAWPTSDGQNN*
Ga0070676_1054059723300005328Miscanthus RhizosphereMNLTPEQIQEHIANLADASVEDLDDLLHDLCCLAWPTSDGQNN*
Ga0070683_10079955623300005329Corn RhizosphereMNLSPEQVQEHIEKLADATIEDLDDLLHDLFCLAWPTTDGQNN*
Ga0068869_10042854513300005334Miscanthus RhizosphereMNLTPEQIQEHVANLADASVEDLDDLLHDLCCLAWPTSDGQNN*
Ga0068868_10032233533300005338Miscanthus RhizospherePAMNLSPEQIQEHITTLSEASVEDLDDLLHDLCCLAWPTSDGQNN*
Ga0068868_10086682113300005338Miscanthus RhizosphereMNLTPEQIQEHVAKLADATVEDIDDLLHDLCCLAWPTSDGQNN*
Ga0070691_1072181023300005341Corn, Switchgrass And Miscanthus RhizosphereAMNLSPEQIQEHISNLSDATVEDLDDLLHDLCCMAWPTTDGQNN*
Ga0070661_10033280413300005344Corn RhizosphereMNLSPEQIQEHVSNLAEASVEDLDDLLHDLCCLAWPTSDGQ
Ga0070668_10136823413300005347Switchgrass RhizosphereMNLTPEQIQEHITNLSDATVEDLDDLLHDLCCMAWPTTDGQNN*
Ga0070703_1016698623300005406Corn, Switchgrass And Miscanthus RhizosphereMNLTPEQIQEHVANLADATVEDLDDLLHDLCCLAWPTSDG
Ga0070710_1051117713300005437Corn, Switchgrass And Miscanthus RhizosphereMNLTPEQIQEHVANLADATVDDLDDLLHDLCCLAWPTSDGQNN*
Ga0070681_1093291623300005458Corn RhizosphereNLTPEQIQEHVANLADATVEDLDDLLHDLCCLAWPTSDGQNN*
Ga0070684_10031350233300005535Corn RhizosphereLSPEQVQEHIEKLADATIEDLDDLLHDLFCLAWPTTDGQNN*
Ga0070672_10078963013300005543Miscanthus RhizospherePEQIQEHVANLADATVEDLDDLLHDLCCLAWPTSDGQNN*
Ga0079219_1043131533300006954Agricultural SoilQIQEHISNLSDATVEDLDDLLYDLCCLAWPTTDGQNN*
Ga0105679_1070250333300007790SoilDPNPQEPVMNLSPEQVQEHIEKLSGATVEDLDDLLHDLFCLAWPTTDGQNN*
Ga0105679_1087646343300007790SoilMNFTPEQVQEHVDKLATATVEELDDLLHDLFCIAWPTTDGQNN*
Ga0075418_1314197623300009100Populus RhizosphereMNLTPEQIQEHIANLSDATVEDLDDLLHDLCCLAWPTTDGQNN*
Ga0105243_1091443733300009148Miscanthus RhizosphereMNLTPEQIQEHIEKLTHASIEDLDDLLHDLFCLAW
Ga0111538_1137098023300009156Populus RhizosphereMNLTPEQIQEHVINLADATVEDLDDLLHDLCCLAWPTSNGQNN*
Ga0111538_1335653613300009156Populus RhizosphereMNLTPEQIQEHVINLADATVEDLDDLLHDLCCLAWPTNDGQNN*
Ga0075423_1216920223300009162Populus RhizosphereEQIQEHVINLADATVEDLDDLLHDLCCLAWPTSNGQNN*
Ga0075423_1254423713300009162Populus RhizosphereMNLTPEQIQEHVINLADATVEDLDDLLHDLCCLAWPTSDGQNN*
Ga0105248_1177483913300009177Switchgrass RhizospherePDPQGRPAMNLTPEQIQEHVANLADATVEDLHALLHDLCCLAWPTSDGQNN*
Ga0105248_1216532513300009177Switchgrass RhizospherePDPQGRPAMNLTPEQIQEHVANLADATVEDLDDLLHDLCCLAWPTSDGQNN*
Ga0126313_1107921213300009840Serpentine SoilMNLSPEQVQEHIEKLTGATVEDLDDLLHDLFCLAWPTTDGQNN*
Ga0126309_1073420123300010039Serpentine SoilMNLTPEQIHEHIANLSDATVEDLDDLLHDLCCLAWPTTDGQNN*
Ga0126312_1069477823300010041Serpentine SoilMNFTPEQIQEHVTKLADASAEDLDDLLHDLCCLAWPTSDGQNN*
Ga0134125_1097438113300010371Terrestrial SoilNSKDRAAMNLTPEQIQEHVNTLTEASVEDLDDLLHDLCCLAWPTTDGQNN*
Ga0134125_1179356213300010371Terrestrial SoilMNLTPEQIQEHVAKLADATVEDIDDLLHDLCCLAWP
Ga0134128_1025081913300010373Terrestrial SoilMNLTPEQIQEHITNLSVATVEDLDDLLHDLCCLAWPTNDGQNN*
Ga0134128_1173718613300010373Terrestrial SoilQIQEHVAKLADATVEDIDDLLHDLCCLAWPTSDGQNN*
Ga0134122_1075513113300010400Terrestrial SoilMNLSPEQIQEHITNLSDATVEDLDDLLHDLCCMAWPTTDGQNN*
Ga0150985_11132746313300012212Avena Fatua RhizospherePAAMNLTPEQIQEHITHLSDATVEDLDDLLHDLCCLAWPTTDGQNN*
Ga0150985_11304325713300012212Avena Fatua RhizosphereLEGRPAMNLTPEQIQEHISNLSDATVEDLDDLLHDLCCMAWPTTDGQNN*
Ga0150984_10878748813300012469Avena Fatua RhizosphereEGRPAMNLTPEQIQEHISNLSDATVEDLDDLLHDLCCMAWPTTDGQNN*
Ga0150984_11530580013300012469Avena Fatua RhizosphereQGRAAMNLTPQQIQEHIANMSDATVEDLDDLLHDLCCLAWPTTDGQNN*
Ga0164298_1077619623300012955SoilMNLTPEQIQEHVANLADASVEDLDDLLHDLCCLAW
Ga0164303_1005127333300012957SoilMNLTPEQIQEHVANLAVASVEDLDDLRHDLCCLAWPTSDGQNN*
Ga0157371_1115628713300013102Corn RhizosphereIQEHIANLADASVEDLDDLLHDLCCLAWPTSDGQNN*
Ga0182000_1028598823300014487SoilMNLTPEQIQEHITNLSAATVEDLDDLLHDLCCLAWPTTDGQNN*
Ga0182001_1007991423300014488SoilMNLTPEQVQEHIEKLSGATVEDLDDLLHDLFCLAWPTTDGQNN*
Ga0182008_1065133513300014497RhizosphereMNLTPEQIQEHISNLSDATVEDLDDLLHDLCCLAWPTTDGQNN*
Ga0182008_1068950223300014497RhizosphereMNLTPEQIQEHIEKLTHASVEDLDDLLHDLFCLAWPTTDGQNN*
Ga0157377_1024233923300014745Miscanthus RhizosphereMNLTPEQIQEHVANLADATVEDLDDLLHDLCCLAWRTSDGQNN*
Ga0157376_1290046823300014969Miscanthus RhizospherePEQIQEHVANLADATVEDLDDLFHDLCCLAWPTSDGQNN*
Ga0190264_1050401723300019377SoilMNLTPEQVQEHINKLAASTVEDLDDLLHDLFCIAWPTTDGQNN
Ga0190264_1153327623300019377SoilMNISPEQVQEHINKLSTSTVEELDDLLHDLFCIAWPTTDGQNN
Ga0247794_1033962823300024055SoilMNLSPEQIQEHVSNLAEASVEDLDDLLHDLCCLAWPTSDGQNN
Ga0196962_1004004213300024430SoilEQVQEHIEKLETASVEELDDLLHDLFCLAWPTTEGQNN
Ga0196962_1020270113300024430SoilMNLTPEQVQEHINKLSTATVEELDDLLHDLFCIAWPTCDGQNN
Ga0207656_1014560033300025321Corn RhizosphereTPEQIQEHVANLADATVEDLDDLLHDLCCLAWPTSDGQNN
Ga0207692_1083915623300025898Corn, Switchgrass And Miscanthus RhizosphereMNLTPEQIQEHVANLADATVDDLDDLLHDLCCLAWPTSDGQNN
Ga0207688_1002390043300025901Corn, Switchgrass And Miscanthus RhizosphereMNLTPEQIQEHVANLADASVEDLDDLLHDLCCLAWPTSDGQNN
Ga0207645_1015193033300025907Miscanthus RhizosphereMNLTPEQIQEHIANLADASVEDLDDLLHDLCCLAWPTSDGQNN
Ga0207693_1009934133300025915Corn, Switchgrass And Miscanthus RhizosphereMNLTPEQIQEHVAHLADATVEDLDDLLHDLCCLAWPTSDGQNN
Ga0207681_1122604023300025923Switchgrass RhizosphereTPEQIQEHVANLADASVEDLDDLLHDLCCLAWPTSDGQNN
Ga0207687_1028153533300025927Miscanthus RhizosphereMNLSPEQVQEHIEKLADATIEDLDDLLHDLFCLAW
Ga0207706_1122760013300025933Corn RhizosphereMNLTPEQIQEHITNLSDATVEDLDDLLHDLCCMAWPTTDGQNN
Ga0207669_1034037633300025937Miscanthus RhizosphereEQIQEHVANLADASVEDLDDLLHDLCCLAWPTSDGQNN
Ga0207708_1001876593300026075Corn, Switchgrass And Miscanthus RhizosphereQIQEHVANLADATVEDLDDLLHDLCCLAWPTSDGQNN
Ga0207708_1038976523300026075Corn, Switchgrass And Miscanthus RhizosphereMNLTPEQIQEHVANLADATVEDLDDLLHDLCCLAWPTS
Ga0268264_1127800923300028381Switchgrass RhizosphereMNLTPEQIQEHVAKLADATVEDIDDLLHDLCCLAWPTSDGQNN
Ga0247822_1111612523300028592SoilHPDPLEGRPAMNLTPEQIQEHITNLSDATVEDLDDLLHDLCCMAWPTTDGQNN
Ga0247821_1049138523300028596SoilMNLSPEQIQEHISRLAEASVEDLDDLLHDLCCLAWPTSDGQNN
Ga0247821_1095424023300028596SoilMNLTPEQIQEHISNLADANVEDLDDLLHDLCCLAWPTADGQNN
Ga0307276_1006740123300028705SoilMNLTPEQIQEHISNLSDATVEDLDDLLHDLCCLAWPTTDGQNN
Ga0307288_1031082123300028778SoilEQIQEHISNLSDATVEDLDDLLHDLCCLAWPTTDGQNN
Ga0247825_1122012913300028812SoilMNLSPEQIQEHITTLSEASVEDLDDLLHDLCCLAWPTADGQNN
Ga0247827_1093336813300028889SoilMNLSPEQIQEHISRLAEASVEDIDELLHDLCCLAWPTSDGQNN
Ga0247826_1147395423300030336SoilMNLSPEQIQEHITTLSEASVEDLDDLLHDLCCLAWPTTDGQNN
Ga0247826_1149882223300030336SoilIQEHISNLADANVEDLDDLLHDLCCLAWPTADGQNN
Ga0247826_1150543923300030336SoilMNLSPEQIQQHITQIGDATVEDLDDLLHDLCCLAWPSAESQSN
Ga0268243_114353623300030510SoilMNLTPEQIQEHITNLSAATVEDLDDLLHDLCCLAWPTTDGQNN
Ga0307406_1187389513300031901RhizosphereMNLTPEQIQEHITSMSEATVEDLDDLLHDLCCLAWPTTDGQNN
Ga0308175_10050912313300031938SoilMNLTPEQIQEHIEKLTHASVEDLDDLLHDLFCLAWPTTDGQNN
Ga0307409_10152549923300031995RhizosphereMNFTPEQVQEHIDKLSTSTVEELDDLLHDLCCIAWPTTDGQNN
Ga0307409_10164068613300031995RhizosphereMNLTPEQVQEHIEKLSGATVEDLDDLLHDLFCLAWPTTDGQNN
Ga0307416_10376734613300032002RhizosphereMNLTPEQVQEHIEKLSGATVEDLDDLLHDLFCLAW
Ga0247830_1135290023300033551SoilAMNLSPEQIQEHITTLSEASVEDLDDLLHDLCCLAWPTTDGQNN
Ga0372943_0010003_4623_47543300034268SoilMNLTPEQIQEHITNLSDATVEDLDDLLHDLCCLAWPTTDGQNN

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.