Basic Information | |
---|---|
Family ID | F090107 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 108 |
Average Sequence Length | 42 residues |
Representative Sequence | MTSLKLLVVEDDLASLELMVEVFTSLKAEVHPVSDSEKA |
Number of Associated Samples | 90 |
Number of Associated Scaffolds | 108 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 94.44 % |
% of genes near scaffold ends (potentially truncated) | 96.30 % |
% of genes from short scaffolds (< 2000 bps) | 87.04 % |
Associated GOLD sequencing projects | 85 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.54 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (55.556 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (26.852 % of family members) |
Environment Ontology (ENVO) | Unclassified (31.481 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.667 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 19.40% β-sheet: 0.00% Coil/Unstructured: 80.60% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 108 Family Scaffolds |
---|---|---|
PF00072 | Response_reg | 2.78 |
PF14520 | HHH_5 | 2.78 |
PF01979 | Amidohydro_1 | 2.78 |
PF10531 | SLBB | 2.78 |
PF00990 | GGDEF | 2.78 |
PF13242 | Hydrolase_like | 1.85 |
PF02518 | HATPase_c | 1.85 |
PF05231 | MASE1 | 1.85 |
PF00293 | NUDIX | 0.93 |
PF08013 | GatZ_KbaZ-like | 0.93 |
PF03062 | MBOAT | 0.93 |
PF13545 | HTH_Crp_2 | 0.93 |
PF07992 | Pyr_redox_2 | 0.93 |
PF15780 | ASH | 0.93 |
PF07238 | PilZ | 0.93 |
PF00230 | MIP | 0.93 |
PF06537 | DHOR | 0.93 |
PF16656 | Pur_ac_phosph_N | 0.93 |
PF01554 | MatE | 0.93 |
PF13414 | TPR_11 | 0.93 |
PF03190 | Thioredox_DsbH | 0.93 |
PF08448 | PAS_4 | 0.93 |
PF04371 | PAD_porph | 0.93 |
PF09286 | Pro-kuma_activ | 0.93 |
PF00512 | HisKA | 0.93 |
PF00753 | Lactamase_B | 0.93 |
PF01266 | DAO | 0.93 |
PF07311 | Dodecin | 0.93 |
PF13188 | PAS_8 | 0.93 |
PF03466 | LysR_substrate | 0.93 |
PF00085 | Thioredoxin | 0.93 |
PF00300 | His_Phos_1 | 0.93 |
COG ID | Name | Functional Category | % Frequency in 108 Family Scaffolds |
---|---|---|---|
COG0642 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 1.85 |
COG3447 | Integral membrane sensor domain MASE1 | Signal transduction mechanisms [T] | 1.85 |
COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 1.85 |
COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.93 |
COG1331 | Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains | General function prediction only [R] | 0.93 |
COG2957 | Agmatine/peptidylarginine deiminase | Amino acid transport and metabolism [E] | 0.93 |
COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 0.93 |
COG3488 | Uncharacterized conserved protein with two CxxC motifs, DUF1111 family | General function prediction only [R] | 0.93 |
COG4573 | Tagatose-1,6-bisphosphate aldolase non-catalytic subunit AgaZ/GatZ | Carbohydrate transport and metabolism [G] | 0.93 |
COG4934 | Serine protease, subtilase family | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 55.56 % |
Unclassified | root | N/A | 44.44 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001546|JGI12659J15293_10136453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Acaryochloridaceae → Acaryochloris → unclassified Acaryochloris → Acaryochloris sp. CCMEE 5410 | 535 | Open in IMG/M |
3300001593|JGI12635J15846_10568903 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 662 | Open in IMG/M |
3300001661|JGI12053J15887_10247107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 888 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100227970 | All Organisms → cellular organisms → Bacteria | 1754 | Open in IMG/M |
3300002568|C688J35102_119608149 | Not Available | 730 | Open in IMG/M |
3300003321|soilH1_10400887 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1367 | Open in IMG/M |
3300004104|Ga0058891_1410090 | Not Available | 577 | Open in IMG/M |
3300005293|Ga0065715_10335530 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 976 | Open in IMG/M |
3300005435|Ga0070714_100093606 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2635 | Open in IMG/M |
3300005534|Ga0070735_10382127 | Not Available | 844 | Open in IMG/M |
3300005536|Ga0070697_100411540 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1174 | Open in IMG/M |
3300005538|Ga0070731_10597109 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
3300005560|Ga0066670_10154878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1342 | Open in IMG/M |
3300005586|Ga0066691_10375294 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 843 | Open in IMG/M |
3300005719|Ga0068861_100438672 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
3300006059|Ga0075017_100639914 | Not Available | 815 | Open in IMG/M |
3300006800|Ga0066660_11153571 | Not Available | 610 | Open in IMG/M |
3300007258|Ga0099793_10574377 | Not Available | 564 | Open in IMG/M |
3300009088|Ga0099830_11255038 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300009089|Ga0099828_10091152 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2620 | Open in IMG/M |
3300009098|Ga0105245_12939022 | Not Available | 528 | Open in IMG/M |
3300009143|Ga0099792_10198676 | Not Available | 1139 | Open in IMG/M |
3300009143|Ga0099792_10550149 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 729 | Open in IMG/M |
3300010371|Ga0134125_10669972 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
3300010375|Ga0105239_11971444 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
3300010398|Ga0126383_12782928 | Not Available | 571 | Open in IMG/M |
3300011120|Ga0150983_15422077 | Not Available | 1130 | Open in IMG/M |
3300011269|Ga0137392_10128092 | Not Available | 2032 | Open in IMG/M |
3300011269|Ga0137392_10229553 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1524 | Open in IMG/M |
3300011269|Ga0137392_10496238 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
3300011270|Ga0137391_11003901 | Not Available | 679 | Open in IMG/M |
3300012096|Ga0137389_10025752 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4202 | Open in IMG/M |
3300012096|Ga0137389_11527127 | Not Available | 564 | Open in IMG/M |
3300012199|Ga0137383_10746801 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 715 | Open in IMG/M |
3300012208|Ga0137376_10425265 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1153 | Open in IMG/M |
3300012917|Ga0137395_10978594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 607 | Open in IMG/M |
3300012917|Ga0137395_11004358 | Not Available | 597 | Open in IMG/M |
3300012917|Ga0137395_11228772 | Not Available | 522 | Open in IMG/M |
3300012923|Ga0137359_11145573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 664 | Open in IMG/M |
3300012924|Ga0137413_11175353 | Not Available | 610 | Open in IMG/M |
3300012927|Ga0137416_11211238 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 680 | Open in IMG/M |
3300012927|Ga0137416_11341225 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 647 | Open in IMG/M |
3300012927|Ga0137416_11448716 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 623 | Open in IMG/M |
3300012929|Ga0137404_10930305 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
3300012929|Ga0137404_10954313 | Not Available | 783 | Open in IMG/M |
3300012930|Ga0137407_10110732 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2369 | Open in IMG/M |
3300014495|Ga0182015_10030295 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4193 | Open in IMG/M |
3300014501|Ga0182024_12277927 | Not Available | 590 | Open in IMG/M |
3300015242|Ga0137412_10052849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3312 | Open in IMG/M |
3300015264|Ga0137403_10362796 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1334 | Open in IMG/M |
3300017823|Ga0187818_10090215 | Not Available | 1324 | Open in IMG/M |
3300017936|Ga0187821_10176503 | Not Available | 815 | Open in IMG/M |
3300018030|Ga0187869_10020078 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3828 | Open in IMG/M |
3300018062|Ga0187784_10569385 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 911 | Open in IMG/M |
3300020006|Ga0193735_1092480 | Not Available | 852 | Open in IMG/M |
3300020579|Ga0210407_10113229 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2070 | Open in IMG/M |
3300020580|Ga0210403_11061683 | Not Available | 631 | Open in IMG/M |
3300020580|Ga0210403_11103144 | Not Available | 616 | Open in IMG/M |
3300020580|Ga0210403_11471853 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 513 | Open in IMG/M |
3300021088|Ga0210404_10611688 | Not Available | 619 | Open in IMG/M |
3300021171|Ga0210405_10211983 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1535 | Open in IMG/M |
3300021178|Ga0210408_10689384 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
3300021181|Ga0210388_10825570 | Not Available | 802 | Open in IMG/M |
3300021401|Ga0210393_11145575 | Not Available | 627 | Open in IMG/M |
3300021401|Ga0210393_11463152 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
3300021432|Ga0210384_10009175 | All Organisms → cellular organisms → Bacteria | 10237 | Open in IMG/M |
3300021433|Ga0210391_10453755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1006 | Open in IMG/M |
3300021478|Ga0210402_11967449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 510 | Open in IMG/M |
3300021479|Ga0210410_10353175 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1318 | Open in IMG/M |
3300021559|Ga0210409_11458606 | Not Available | 560 | Open in IMG/M |
3300022557|Ga0212123_10455273 | Not Available | 842 | Open in IMG/M |
3300024288|Ga0179589_10151245 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 990 | Open in IMG/M |
3300025912|Ga0207707_11369924 | Not Available | 565 | Open in IMG/M |
3300025916|Ga0207663_11130521 | Not Available | 630 | Open in IMG/M |
3300025939|Ga0207665_11482607 | Not Available | 539 | Open in IMG/M |
3300026329|Ga0209375_1301085 | Not Available | 524 | Open in IMG/M |
3300027590|Ga0209116_1033964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1080 | Open in IMG/M |
3300027641|Ga0208827_1080451 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
3300027667|Ga0209009_1104009 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
3300027829|Ga0209773_10289135 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 684 | Open in IMG/M |
3300027855|Ga0209693_10321163 | Not Available | 753 | Open in IMG/M |
3300027903|Ga0209488_10631406 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 774 | Open in IMG/M |
3300028047|Ga0209526_10700901 | Not Available | 638 | Open in IMG/M |
3300028536|Ga0137415_10370323 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1236 | Open in IMG/M |
3300028906|Ga0308309_11579642 | Not Available | 559 | Open in IMG/M |
3300029910|Ga0311369_10086606 | All Organisms → cellular organisms → Bacteria | 3215 | Open in IMG/M |
3300029944|Ga0311352_10413737 | Not Available | 1102 | Open in IMG/M |
3300029944|Ga0311352_11173121 | Not Available | 584 | Open in IMG/M |
3300029951|Ga0311371_11673082 | Not Available | 696 | Open in IMG/M |
3300030057|Ga0302176_10073200 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1326 | Open in IMG/M |
3300030687|Ga0302309_10462588 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
3300030991|Ga0073994_12160334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 948 | Open in IMG/M |
3300031236|Ga0302324_100107619 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4699 | Open in IMG/M |
3300031474|Ga0170818_110806106 | Not Available | 1278 | Open in IMG/M |
3300031715|Ga0307476_10065193 | All Organisms → cellular organisms → Bacteria | 2512 | Open in IMG/M |
3300031715|Ga0307476_10278016 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
3300031715|Ga0307476_10548156 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 857 | Open in IMG/M |
3300031715|Ga0307476_10968298 | Not Available | 627 | Open in IMG/M |
3300031715|Ga0307476_11408580 | Not Available | 507 | Open in IMG/M |
3300031718|Ga0307474_10607615 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
3300031754|Ga0307475_11033942 | Not Available | 645 | Open in IMG/M |
3300031823|Ga0307478_10291884 | Not Available | 1334 | Open in IMG/M |
3300031954|Ga0306926_10945906 | Not Available | 1029 | Open in IMG/M |
3300032180|Ga0307471_101886497 | Not Available | 747 | Open in IMG/M |
3300032180|Ga0307471_104087142 | Not Available | 515 | Open in IMG/M |
3300032783|Ga0335079_11988104 | Not Available | 560 | Open in IMG/M |
3300033158|Ga0335077_10260440 | Not Available | 1917 | Open in IMG/M |
3300033887|Ga0334790_007848 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6053 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 26.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.81% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 9.26% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 8.33% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.48% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.70% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.78% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.85% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.85% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.85% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.85% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.93% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.93% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.93% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.93% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.93% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.93% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.93% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.93% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.93% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.93% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.93% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.93% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.93% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.93% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.93% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
3300004104 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF218 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
3300030687 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_1 | Environmental | Open in IMG/M |
3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12659J15293_101364531 | 3300001546 | Forest Soil | MSSLKLLVVEDDLPSLELMDEVFTSLKAEVRPVSDGQTAADLINRVK |
JGI12635J15846_105689033 | 3300001593 | Forest Soil | MAALKLLVVEDDAASLELMAELLQQFKAEVRPIIDSQEA |
JGI12053J15887_102471072 | 3300001661 | Forest Soil | MTPLRLLVVEDDLASLELMVEVFTSLKAEVNPVSDSKKAVDMINQE |
JGIcombinedJ26739_1002279704 | 3300002245 | Forest Soil | MTPLRLLIVEDDLASLELMTEVFTSLKAEVRPVSDS |
C688J35102_1196081492 | 3300002568 | Soil | MLSLKLLIVEDDAASLELMTEVLGSLEAEVRPISDSQKAA |
soilH1_104008871 | 3300003321 | Sugarcane Root And Bulk Soil | MNPLKLLIVEDDTPSLELMAEVFSNLQANVYAVGDSKKAADLVSM |
Ga0058891_14100902 | 3300004104 | Forest Soil | MQPLKLLVVEDNIPCLELMTEVFMSLKAEVRPISDSEKAVAVVNQ |
Ga0065715_103355302 | 3300005293 | Miscanthus Rhizosphere | MASLKLLIVEDDIANLELMAEVFTSLKAEVCPVSDSEIAADM |
Ga0070714_1000936061 | 3300005435 | Agricultural Soil | MLSLKLLVVEDDPSSLELMTEVLRSLEAEVRPFSDSQKAAVLVHQE |
Ga0070735_103821272 | 3300005534 | Surface Soil | MASLKLLVVEDDIASLELMTEVFKSLEAEVRPISDSNNAVKIVSQEKFDG |
Ga0070697_1004115401 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MAFLKLLVVEDHIPSLELMAEVFTSLEAEVWPLSDSREAASLI |
Ga0070731_105971091 | 3300005538 | Surface Soil | MGSLKLLVVEDDLPSLELMEEVFTSLQAEVRPVNNSETAAVLVGKEKF |
Ga0066670_101548782 | 3300005560 | Soil | MAPLKLLIVEDDVASLELMAEVFTSLKAEVRPVSDSRE |
Ga0066691_103752942 | 3300005586 | Soil | MIPLKLLVVEDDPASLELMTEVFQSLKAHVRPVITGRTCA |
Ga0068861_1004386722 | 3300005719 | Switchgrass Rhizosphere | MDNLNLLLVEDDIPSLEMMTEVFGSLNAEVRPVSDSERAAAMV |
Ga0075017_1006399141 | 3300006059 | Watersheds | MASLKLLVVEDDLPCLELMTEVFTSLQAEVRPVSDSEQAAT |
Ga0066660_111535711 | 3300006800 | Soil | MTPLKLLVVEDDTASLELMTEVFTYLKAEVRPVSDSETAAGMV |
Ga0099793_105743771 | 3300007258 | Vadose Zone Soil | MASLKLLIVEDDIASLDLMAEVFTYLQAEVRPVSDS |
Ga0099830_112550382 | 3300009088 | Vadose Zone Soil | KDEDGCMQPLKLLTVEDNLASLELMTDVFTSLKAEVRPISDSEQALRVSGTP* |
Ga0099828_100911523 | 3300009089 | Vadose Zone Soil | MQPLKLLTVEDNLARLELMTEVFTSLKAEVRPISDSEQALRVSGTP* |
Ga0105245_129390222 | 3300009098 | Miscanthus Rhizosphere | MGGVMESLKLLVVEDDLPSLELMTEVFQSLKADVRPIADSSKAAL |
Ga0099792_101986762 | 3300009143 | Vadose Zone Soil | MATLKLLVVEDDLASLELMTEVFTSLKAEVHPVSDSEKAADMVNREKFDG |
Ga0099792_105501492 | 3300009143 | Vadose Zone Soil | MLALKLLVVEDDAASLELMTEVFRSLKAEVLPVSDSEEAARRVNQEKFD |
Ga0134125_106699724 | 3300010371 | Terrestrial Soil | MGSLKLLVVEDDMPSLELMEEVFTSLQAEVRPVNNSETAAALVG |
Ga0105239_119714442 | 3300010375 | Corn Rhizosphere | MGSLKLLVVEDDMPSLELMEEVFTSLQAEVRPVNNSETAAALVGKEGEGF |
Ga0126383_127829282 | 3300010398 | Tropical Forest Soil | MAALKLLVVEDDIPCLELMTEVFTSLQADVKPVSD |
Ga0150983_154220773 | 3300011120 | Forest Soil | MPPLKLLVVEDNIPCLELMTEVFMSLKAEVRPISDSEKAVAVVNQEKF |
Ga0137392_101280922 | 3300011269 | Vadose Zone Soil | MVELKLLVVEDDAASLELMTEVFRSLKADVRPVSDSQEAAL |
Ga0137392_102295531 | 3300011269 | Vadose Zone Soil | MASLKLLVVEDHIPSLELMAEVFTSLEAEVWPLSDSPEAASL |
Ga0137392_104962382 | 3300011269 | Vadose Zone Soil | MQPLKLLTVEDNLASLELMTDVFTSLKAEVRPISDSEQALRVSGTP* |
Ga0137391_110039012 | 3300011270 | Vadose Zone Soil | MTPLKLLVVEDDAASLELMTEVFRYLKAEVRPVSDSEKAV |
Ga0137389_100257528 | 3300012096 | Vadose Zone Soil | MASLKLLVVEDHIPSLELMAEVFVSLEAEVWPLSDSREAASLIDKEKFDG |
Ga0137389_115271271 | 3300012096 | Vadose Zone Soil | MASLKLLVVEDHIPSLELMAEVFTSLEAEVWPLSDS |
Ga0137383_107468011 | 3300012199 | Vadose Zone Soil | MTPLKLLVVEDDLASLELTVEVFTSLKAEIHPVSDSEKA |
Ga0137376_104252652 | 3300012208 | Vadose Zone Soil | MGLEEDRRMTSLKLLVVEDDLASLELMVEVFTSLKAEVHPV |
Ga0137395_109785942 | 3300012917 | Vadose Zone Soil | MASLKLLVVEDDLASLELMVEVFTSLKAEVHPVSDS |
Ga0137395_110043581 | 3300012917 | Vadose Zone Soil | MTSLKLLVVEDDLASLELMVEVFTSLKAEVHPVSDSEKA |
Ga0137395_112287722 | 3300012917 | Vadose Zone Soil | MTALKLLVVEDDAASLELMNEVFTSLKAEVRPVNDSEKAVGIVNQEKFD |
Ga0137359_111455732 | 3300012923 | Vadose Zone Soil | MPSLKLLIVEDDIASLELMAEVFRSLTAEVHPVSDSVRGA |
Ga0137413_111753531 | 3300012924 | Vadose Zone Soil | MALVKLLLVEDDIASLELMTEVFSALEAEVHPTSDSENAAR |
Ga0137416_112112381 | 3300012927 | Vadose Zone Soil | MASLKLLVVEDDIANLELMTEVFKTLEAEVRPISDSE |
Ga0137416_113412252 | 3300012927 | Vadose Zone Soil | LGLEEDRLVTPLRLLVVEDDLASLELMVEVFTSLKAEVHP |
Ga0137416_114487162 | 3300012927 | Vadose Zone Soil | MQSLKLLVVEDDIANLELMTEVFRSLAAKVCSISDSEKAADLVN |
Ga0137404_109303051 | 3300012929 | Vadose Zone Soil | MATLKLLVVEDDLASLELMAEVFTSLKAEVHPVSDSEKAADMVTREKFD |
Ga0137404_109543131 | 3300012929 | Vadose Zone Soil | MASLKLLVVEDHIPSLELMAEVFTSLEAEVWPLSDSREA |
Ga0137407_101107324 | 3300012930 | Vadose Zone Soil | MQSLKLLVVEDDVASLELMTEVFRSLAAEVCSTSDSEKAADLVNR |
Ga0182015_100302954 | 3300014495 | Palsa | MVSLKLLIVEDDIASLELMTEVFTSLEAEVSPVSDSQK |
Ga0182024_122779272 | 3300014501 | Permafrost | MEALKLLVVEDDAVTLELMTEVFKSLNAEVRPMRDSE |
Ga0137412_100528495 | 3300015242 | Vadose Zone Soil | MALVKLLLVEDDIASLELMTEVFSALEAEVHPTSDSENAAKIVNL |
Ga0137403_103627961 | 3300015264 | Vadose Zone Soil | MASLKLLVVEDHIPSLELMAEVFTSLEAEVWPLSDSREAASLIDKENFDGIF |
Ga0187818_100902151 | 3300017823 | Freshwater Sediment | MSSLKLLVVEDDVPSLELMEEVLTSLKAQVLPTNDGQN |
Ga0187821_101765031 | 3300017936 | Freshwater Sediment | MASLKLLIVEDDIASLELMAEVFTSLKAEVLPVSDSREAAGLVDKER |
Ga0187869_100200781 | 3300018030 | Peatland | MPPLKVLVVEDDLACLELMTEVFTSLKAEVRAVGKSEKAAAMVNQ |
Ga0187784_105693851 | 3300018062 | Tropical Peatland | VSSLKLLVIEDDRDCLELMTEVFTSLKAEVRPLSDSQEAAALLDREKFDG |
Ga0193735_10924802 | 3300020006 | Soil | MTPLKLLVVEDDTASLELMTEVFTYLKAEVRPVSDSEKAAGMIDQEKFDGI |
Ga0210407_101132292 | 3300020579 | Soil | VLASLKLPVVEDDIASLELMAEVFTYLKAEVYPISDSERVADLVNCEKFDGISWT |
Ga0210403_110616832 | 3300020580 | Soil | MQPLKLLVVEDHIPSLELMTEVFTTLKAEVRPISES |
Ga0210403_111031441 | 3300020580 | Soil | MKPLKLLVVEDHIPSLELMTEVFTSLKAEVRPISESEKAAALVNQEKF |
Ga0210403_114718531 | 3300020580 | Soil | MQPLKLLIVEDNIPSLELMTEVFRSLKAEVHPISESEKAA |
Ga0210404_106116882 | 3300021088 | Soil | MQPLKLLVVEDHIPSLELMTEVFTSLKAEVRPISESEKAVAMVNQEKFDG |
Ga0210405_102119831 | 3300021171 | Soil | MKPLKLLVVEDHIPSLELMTEVFTSLKAEVRPISESEKAAALV |
Ga0210408_106893841 | 3300021178 | Soil | MASLKLLIVEDDIASLELMAEVFRSLQADVLAVSDSQKAAGL |
Ga0210388_108255701 | 3300021181 | Soil | MSSLRLLIVEDDPASLELMDEVFSSLKAVVRPVDD |
Ga0210393_111455752 | 3300021401 | Soil | MQPLKLLVVEDHIPSLELMTEVFTSLKAEVRPISESEKAVAM |
Ga0210393_114631521 | 3300021401 | Soil | LKSREPQLKLLVVEDDLASLELMAEVFGSLHADVHTIYESTKAAAV |
Ga0210384_100091752 | 3300021432 | Soil | MASLKILTVEDDIASLELMTEVFRSLKAEVRAVSDSQKAAVLVDQ |
Ga0210391_104537551 | 3300021433 | Soil | MQPLKVLVVEDDLANLELMTEVFTSLKAEVRSISDSEKAVGVVNQEKF |
Ga0210402_119674491 | 3300021478 | Soil | VNSKEQSPELKLLVVEDDLANLELMAEVFGSLRADVRTVSESTKAVSLVA |
Ga0210410_103531754 | 3300021479 | Soil | MASLKLLIVEDDIASLELMDEVFTSLKAKVRPVSDS |
Ga0210409_114586061 | 3300021559 | Soil | MQPLKLLVVEDHIPSLELMTEVFTTLKAEVRPISESEKA |
Ga0212123_104552733 | 3300022557 | Iron-Sulfur Acid Spring | MPPLKLLVVEDNIPCLELMTEVFMSLKAEVRPISDSEKAVAVVNQ |
Ga0179589_101512451 | 3300024288 | Vadose Zone Soil | MASLKLLVVEDDIANLELMTEVFKTLEAEVRPISDS |
Ga0207707_113699241 | 3300025912 | Corn Rhizosphere | MASLKLLIVEDDIASLELMAEVFTSLKAEVLPVSDSR |
Ga0207663_111305212 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VKLLIVEDDIASLELMTEVFTSLKAEVRPLSDSQE |
Ga0207665_114826072 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MASLKLLIVEDDIANLELMAEVFTSLKAEVCPVSDSEIAADMV |
Ga0209375_13010852 | 3300026329 | Soil | MTPLKLLVVEDDTASLELMTEVFTYLKAEVRPVSDSEKAAGMIDQEK |
Ga0209116_10339643 | 3300027590 | Forest Soil | MTPLKLLVVEDDLASLELMTEVFVSLKAEVLPINDSEQAARVVNEEK |
Ga0208827_10804512 | 3300027641 | Peatlands Soil | MSLRLLLVEDDLPSLELMEEVFTSLKADVRPISDG |
Ga0209009_11040091 | 3300027667 | Forest Soil | MQPLKVLVVEDDLANLELMTEVFTSLKAEVRSISDSEK |
Ga0209773_102891352 | 3300027829 | Bog Forest Soil | VKDQALAELKILVVEDDLASLELMGEVFGSLKADV |
Ga0209693_103211631 | 3300027855 | Soil | MSSLKLLVVEDDLPSLELMDEVFTSLKADVHPISDGDRAADL |
Ga0209488_106314061 | 3300027903 | Vadose Zone Soil | MLALKLLVVEDDAASLELMTEVFRSLKAEVLPVSDSEE |
Ga0209526_107009012 | 3300028047 | Forest Soil | MAALKLLVVEDDTASLELMAELLQELRPLSDSQEASGLIQQ |
Ga0137415_103703231 | 3300028536 | Vadose Zone Soil | MQSLKLLVVEDDIANLELMTEVFRSLAAKVCSISDSEKAADLVNREKF |
Ga0308309_115796421 | 3300028906 | Soil | MSLKLLIAEDDGPSLELMTEVFTSLKAAVFPVDDGRKA |
Ga0311369_100866063 | 3300029910 | Palsa | MGSLKLLIVEDDIASLELMTEVFTSLEAEVSPVSDSQKAAGLV |
Ga0311352_104137371 | 3300029944 | Palsa | MKLRDAMPSLKLLVVEDDLPSLELMDEVFTSLEACVRPINDGETAAELINRE |
Ga0311352_111731211 | 3300029944 | Palsa | MVSLKLLIVEDDIASLELMTEVFTSLEAEVSPVSDSQEAAGLVNQ |
Ga0311371_116730823 | 3300029951 | Palsa | MKLRDAMPSLKLLVVEDDLPSLELMDEVFTSLEACVRPINDGETAAE |
Ga0302176_100732002 | 3300030057 | Palsa | MGSLKLLIVEDDIASLELMTEVFTSLEAEVSPVSDS |
Ga0302309_104625882 | 3300030687 | Palsa | MGSLKLLIVEDDIASLELMTEVFTSLEAEVSPVSDSQKAAG |
Ga0073994_121603341 | 3300030991 | Soil | MTPLRLLVAEDDLASLELMGEVFRSLKAEVHPVSDSEKV |
Ga0302324_1001076191 | 3300031236 | Palsa | MVSLKLLIVEDDIASLELMTEVFTSLEAEVSPVSDSQEAAG |
Ga0170818_1108061061 | 3300031474 | Forest Soil | MEPLKLLVVEDDVASLELMTEVFRSLKAQVFPLNDS |
Ga0307476_100651931 | 3300031715 | Hardwood Forest Soil | MLALKLLVVEDDPASLELMTEVFRSLKADVRPVSDSE |
Ga0307476_102780162 | 3300031715 | Hardwood Forest Soil | MALLKLLVVEDDIASLELMTEVFKSLEADVRPISDSQIAV |
Ga0307476_105481562 | 3300031715 | Hardwood Forest Soil | MTPLKLLVVEDDPASLELMTEVFTSLKAAVRALSDSE |
Ga0307476_109682982 | 3300031715 | Hardwood Forest Soil | MPPLKLLVVEDNIPSLELMTEVFRSLKAEVRPISDSEKAVAVVN |
Ga0307476_114085801 | 3300031715 | Hardwood Forest Soil | MSSLRLLIVEDDPASLELMDEVFTSLKAVVRPIDDGREA |
Ga0307474_106076151 | 3300031718 | Hardwood Forest Soil | MASLKLLVIEDDIANLELMSEVFASLEAEVIPIRDSREAAGLI |
Ga0307475_110339422 | 3300031754 | Hardwood Forest Soil | MASLKILIVEDDVPSLELMAEVFTSLEAEVRPVSDS |
Ga0307478_102918841 | 3300031823 | Hardwood Forest Soil | MAALKLLVVEDDIASLELMAEVFTSLDAEVRSLSDSQQAANLIN |
Ga0306926_109459062 | 3300031954 | Soil | VSPVKLLVVEDDRASLELMAEVFTALKAEVRPLND |
Ga0307471_1018864972 | 3300032180 | Hardwood Forest Soil | MQTPLKLLVVEDDTASLELMTEVFTHLKAEVRAVNDSEK |
Ga0307471_1040871421 | 3300032180 | Hardwood Forest Soil | MGSLKLLVVEDDIAGLELMTEVLTSLNAEVRPVSDSRKAA |
Ga0335079_119881041 | 3300032783 | Soil | MTTLRLLIVEDDEASLELMTEVFSSLEADVHPVSEARH |
Ga0335077_102604401 | 3300033158 | Soil | MASLKILVVDDDRTDSELMTEVFTSLQAEVRPVADSDEAIALI |
Ga0334790_007848_5903_6052 | 3300033887 | Soil | MTPLKLLVVEDDLASLELMAEVFTSLKAEVRPVSDSEKAVGMVNQEKFDG |
⦗Top⦘ |