NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F090226

Metagenome Family F090226

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F090226
Family Type Metagenome
Number of Sequences 108
Average Sequence Length 41 residues
Representative Sequence MKYLLLVCWDAEKMDAQTEPDPGNTPDEESFPWLDDLQAR
Number of Associated Samples 97
Number of Associated Scaffolds 108

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 99.07 %
% of genes near scaffold ends (potentially truncated) 95.37 %
% of genes from short scaffolds (< 2000 bps) 93.52 %
Associated GOLD sequencing projects 97
AlphaFold2 3D model prediction Yes
3D model pTM-score0.26

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (83.333 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(22.222 % of family members)
Environment Ontology (ENVO) Unclassified
(24.074 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(51.852 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 17.65%    β-sheet: 0.00%    Coil/Unstructured: 82.35%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.26
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 108 Family Scaffolds
PF07883Cupin_2 9.26
PF00072Response_reg 2.78
PF00106adh_short 2.78
PF03795YCII 2.78
PF00027cNMP_binding 2.78
PF02909TetR_C_1 1.85
PF00583Acetyltransf_1 1.85
PF13649Methyltransf_25 1.85
PF00501AMP-binding 0.93
PF00196GerE 0.93
PF01113DapB_N 0.93
PF13376OmdA 0.93
PF02674Colicin_V 0.93
PF00903Glyoxalase 0.93
PF01741MscL 0.93
PF01738DLH 0.93
PF01494FAD_binding_3 0.93
PF08818DUF1801 0.93
PF02673BacA 0.93
PF01883FeS_assembly_P 0.93
PF00005ABC_tran 0.93
PF02803Thiolase_C 0.93
PF01061ABC2_membrane 0.93
PF08448PAS_4 0.93
PF01594AI-2E_transport 0.93
PF04828GFA 0.93
PF12681Glyoxalase_2 0.93
PF00246Peptidase_M14 0.93
PF08241Methyltransf_11 0.93
PF08386Abhydrolase_4 0.93
PF13539Peptidase_M15_4 0.93
PF09360zf-CDGSH 0.93
PF03006HlyIII 0.93
PF13378MR_MLE_C 0.93
PF01370Epimerase 0.93
PF06803DUF1232 0.93
PF07040DUF1326 0.93
PF012572Fe-2S_thioredx 0.93
PF07732Cu-oxidase_3 0.93
PF04237YjbR 0.93
PF00226DnaJ 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 108 Family Scaffolds
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 2.78
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 1.85
COG1309DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmATranscription [K] 1.85
COG3791Uncharacterized conserved proteinFunction unknown [S] 0.93
COG4430Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 familyFunction unknown [S] 0.93
COG5588Uncharacterized conserved protein, DUF1326 domainFunction unknown [S] 0.93
COG5646Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis)Posttranslational modification, protein turnover, chaperones [O] 0.93
COG5649Uncharacterized conserved protein, DUF1801 domainFunction unknown [S] 0.93
COG0183Acetyl-CoA acetyltransferaseLipid transport and metabolism [I] 0.93
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.93
COG0628Predicted PurR-regulated permease PerMGeneral function prediction only [R] 0.93
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.93
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 0.93
COG1272Predicted membrane channel-forming protein YqfA, hemolysin III familyIntracellular trafficking, secretion, and vesicular transport [U] 0.93
COG1286Colicin V production accessory protein CvpA, regulator of purF expression and biofilm formationCell wall/membrane/envelope biogenesis [M] 0.93
COG1905NADH:ubiquinone oxidoreductase 24 kD subunit (chain E)Energy production and conversion [C] 0.93
COG1968Undecaprenyl pyrophosphate phosphataseLipid transport and metabolism [I] 0.93
COG1970Large-conductance mechanosensitive channelCell wall/membrane/envelope biogenesis [M] 0.93
COG2132Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA)Cell cycle control, cell division, chromosome partitioning [D] 0.93
COG2315Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR familyTranscription [K] 0.93
COG3339Uncharacterized membrane protein YkvA, DUF1232 familyFunction unknown [S] 0.93

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms83.33 %
UnclassifiedrootN/A16.67 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908016|OU_2_1_1_newblercontig19036All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Dormibacteraeota → unclassified Candidatus Dormibacteraeota → Candidatus Dormibacteraeota bacterium658Open in IMG/M
2124908045|KansclcFeb2_ConsensusfromContig1237669All Organisms → cellular organisms → Bacteria652Open in IMG/M
2170459003|FZ032L002H5PJWAll Organisms → cellular organisms → Bacteria510Open in IMG/M
3300000858|JGI10213J12805_10197206All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300000956|JGI10216J12902_121565903All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1084Open in IMG/M
3300003321|soilH1_10287584Not Available1660Open in IMG/M
3300003373|JGI25407J50210_10003615All Organisms → cellular organisms → Bacteria3716Open in IMG/M
3300004153|Ga0063455_100041005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_91497Open in IMG/M
3300004153|Ga0063455_100186445Not Available1007Open in IMG/M
3300004643|Ga0062591_100729765All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9901Open in IMG/M
3300005177|Ga0066690_10114481All Organisms → cellular organisms → Bacteria1745Open in IMG/M
3300005179|Ga0066684_10245347Not Available1174Open in IMG/M
3300005328|Ga0070676_11204902All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300005355|Ga0070671_102101011All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300005444|Ga0070694_100785254All Organisms → cellular organisms → Bacteria780Open in IMG/M
3300005544|Ga0070686_100880087All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300005544|Ga0070686_101695685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium536Open in IMG/M
3300005557|Ga0066704_11054075Not Available501Open in IMG/M
3300005558|Ga0066698_10293091All Organisms → cellular organisms → Bacteria1127Open in IMG/M
3300005563|Ga0068855_100940274All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria911Open in IMG/M
3300005576|Ga0066708_10388602Not Available896Open in IMG/M
3300005874|Ga0075288_1090479All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300005937|Ga0081455_10915068All Organisms → cellular organisms → Bacteria → Terrabacteria group545Open in IMG/M
3300006032|Ga0066696_10695368All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300006034|Ga0066656_10794627All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300006046|Ga0066652_101117264All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9746Open in IMG/M
3300006049|Ga0075417_10278927All Organisms → cellular organisms → Bacteria806Open in IMG/M
3300006049|Ga0075417_10567529All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria575Open in IMG/M
3300006755|Ga0079222_10185926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_91231Open in IMG/M
3300006846|Ga0075430_100874189All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria741Open in IMG/M
3300006847|Ga0075431_101415115All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria655Open in IMG/M
3300006880|Ga0075429_100060464All Organisms → cellular organisms → Bacteria3300Open in IMG/M
3300009012|Ga0066710_101883330All Organisms → cellular organisms → Bacteria897Open in IMG/M
3300009098|Ga0105245_11167040All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9817Open in IMG/M
3300009840|Ga0126313_11736684Not Available521Open in IMG/M
3300010037|Ga0126304_10139014Not Available1563Open in IMG/M
3300010037|Ga0126304_10149543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1510Open in IMG/M
3300010037|Ga0126304_10237435All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1197Open in IMG/M
3300010044|Ga0126310_10120150All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales → Thermaceae → Calidithermus → Calidithermus chliarophilus1627Open in IMG/M
3300010301|Ga0134070_10420492All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria530Open in IMG/M
3300010322|Ga0134084_10339834Not Available569Open in IMG/M
3300010325|Ga0134064_10384349Not Available556Open in IMG/M
3300010398|Ga0126383_11670069Not Available726Open in IMG/M
3300010403|Ga0134123_11528246All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium713Open in IMG/M
3300011000|Ga0138513_100038294All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria711Open in IMG/M
3300012008|Ga0120174_1103376All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria703Open in IMG/M
3300012014|Ga0120159_1093464All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria870Open in IMG/M
3300012022|Ga0120191_10044298All Organisms → cellular organisms → Bacteria751Open in IMG/M
3300012186|Ga0136620_10245877All Organisms → cellular organisms → Bacteria784Open in IMG/M
3300012200|Ga0137382_10333816All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_91062Open in IMG/M
3300012207|Ga0137381_10213680All Organisms → cellular organisms → Bacteria1673Open in IMG/M
3300012207|Ga0137381_11673911All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300012361|Ga0137360_10316366All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1299Open in IMG/M
3300012672|Ga0137317_1013021Not Available730Open in IMG/M
3300012680|Ga0136612_10490040All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300012893|Ga0157284_10261750All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300012897|Ga0157285_10188995All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300012922|Ga0137394_10950632All Organisms → cellular organisms → Bacteria716Open in IMG/M
3300012951|Ga0164300_10001709All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5277Open in IMG/M
3300012957|Ga0164303_11329824All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9533Open in IMG/M
3300012985|Ga0164308_12133589All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium522Open in IMG/M
3300014326|Ga0157380_10874619All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium922Open in IMG/M
3300014827|Ga0120171_1053160Not Available1217Open in IMG/M
3300015262|Ga0182007_10253014All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300017787|Ga0183260_10144196All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1701Open in IMG/M
3300017789|Ga0136617_10036538All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4367Open in IMG/M
3300018071|Ga0184618_10070943All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1313Open in IMG/M
3300018081|Ga0184625_10081649All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1654Open in IMG/M
3300018422|Ga0190265_11271796All Organisms → cellular organisms → Bacteria853Open in IMG/M
3300018422|Ga0190265_13829567All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300018432|Ga0190275_13468277All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria510Open in IMG/M
3300018433|Ga0066667_10008020All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4866Open in IMG/M
3300018433|Ga0066667_11063023Not Available699Open in IMG/M
3300018466|Ga0190268_10238897All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1032Open in IMG/M
3300019377|Ga0190264_11744717All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300019884|Ga0193741_1074968All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria869Open in IMG/M
3300020016|Ga0193696_1112561All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → unclassified Nocardioides → Nocardioides sp. Soil774694Open in IMG/M
3300021445|Ga0182009_10785230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium520Open in IMG/M
3300021560|Ga0126371_13451371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium534Open in IMG/M
3300022756|Ga0222622_11124560All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300025918|Ga0207662_10885873All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300025930|Ga0207701_11346981All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia583Open in IMG/M
3300025945|Ga0207679_11081793Not Available735Open in IMG/M
3300026088|Ga0207641_12169298Not Available556Open in IMG/M
3300026095|Ga0207676_11059125Not Available801Open in IMG/M
3300026306|Ga0209468_1017190All Organisms → cellular organisms → Bacteria2615Open in IMG/M
3300026316|Ga0209155_1203963Not Available622Open in IMG/M
3300027907|Ga0207428_10814293All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria663Open in IMG/M
3300028721|Ga0307315_10087462All Organisms → cellular organisms → Bacteria906Open in IMG/M
3300028787|Ga0307323_10212071All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium699Open in IMG/M
3300028796|Ga0307287_10394882All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300028799|Ga0307284_10013334All Organisms → cellular organisms → Bacteria2506Open in IMG/M
3300028800|Ga0265338_11166443All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium517Open in IMG/M
3300028811|Ga0307292_10121704All Organisms → cellular organisms → Bacteria1039Open in IMG/M
3300028811|Ga0307292_10426461All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria565Open in IMG/M
3300028824|Ga0307310_10748852All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300028884|Ga0307308_10555320All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300028885|Ga0307304_10413292All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300030619|Ga0268386_10897695All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium555Open in IMG/M
3300031199|Ga0307495_10076501All Organisms → cellular organisms → Bacteria747Open in IMG/M
3300031716|Ga0310813_12273181All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria514Open in IMG/M
3300031731|Ga0307405_12158029All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300031740|Ga0307468_101041952All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium724Open in IMG/M
3300031995|Ga0307409_100934570All Organisms → cellular organisms → Bacteria882Open in IMG/M
3300031995|Ga0307409_101282549All Organisms → cellular organisms → Bacteria757Open in IMG/M
3300033551|Ga0247830_10929799Not Available693Open in IMG/M
3300033551|Ga0247830_11341475All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300034417|Ga0364941_039315All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1031Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil22.22%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil11.11%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.56%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.63%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil4.63%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand3.70%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.78%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost2.78%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.78%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.78%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere2.78%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere2.78%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.85%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.85%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.93%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.93%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.93%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.93%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.93%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.93%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.93%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.93%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.93%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.93%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.93%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.93%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.93%
Environmental → Unclassified → Unclassified → Unclassified → Unclassified → 0.93%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.93%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.93%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.93%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.93%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908016Sample 642EnvironmentalOpen in IMG/M
2124908045Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011EnvironmentalOpen in IMG/M
2170459003Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
3300000858Soil microbial communities from Great Prairies - Wisconsin Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300003321Sugarcane bulk soil Sample H1EnvironmentalOpen in IMG/M
3300003373Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005874Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404EnvironmentalOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011000Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015EnvironmentalOpen in IMG/M
3300012008Permafrost microbial communities from Nunavut, Canada - A39_80cm_12MEnvironmentalOpen in IMG/M
3300012014Permafrost microbial communities from Nunavut, Canada - A10_80cm_6MEnvironmentalOpen in IMG/M
3300012022Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6EnvironmentalOpen in IMG/M
3300012186Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ416 (21.06)EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012672Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT266_2EnvironmentalOpen in IMG/M
3300012680Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06)EnvironmentalOpen in IMG/M
3300012893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1EnvironmentalOpen in IMG/M
3300012897Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1EnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014827Permafrost microbial communities from Nunavut, Canada - A3_80cm_18MEnvironmentalOpen in IMG/M
3300015262Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaGHost-AssociatedOpen in IMG/M
3300017787Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2)EnvironmentalOpen in IMG/M
3300017789Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06)EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300019884Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2EnvironmentalOpen in IMG/M
3300020016Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1EnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026306Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes)EnvironmentalOpen in IMG/M
3300026316Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028721Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300030619Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq)EnvironmentalOpen in IMG/M
3300031199Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_SEnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034417Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
OU_013007202124908016VKFLLLVCWDGEAMNAQTEPEPGEAQEEESFPWLDDLQAR
KansclcFeb2_103353102124908045SoilMKYLMLVCWDVEKMNAQPEPDPSAAADEESFPWLDD
E4A_057604602170459003Grass SoilMKFLLLVCWDAEKMDAQAEPDSTDAPNEEEGFPWLDDLQARGIWVTG
JGI10213J12805_1019720613300000858SoilMRYLLLVCWDAEKMNAQTEPDPGESREEESFPWLDDLHARAIWVTG
JGI10216J12902_12156590343300000956SoilMKFLLLVCWDAEKMDAQTEPDPNETQEEEGFPWLDDLQ
soilH1_1028758413300003321Sugarcane Root And Bulk SoilVKYLLLVCWDAERMNRQAEPDRSALPTDDDEEEPFPWVDDL
JGI25407J50210_1000361513300003373Tabebuia Heterophylla RhizosphereMKYLLLICWNAERMDGQTEPDPSEQTEPESFPWLDDLQAQGKWI
Ga0063455_10004100513300004153SoilMLLVCWDAERMNAREEPRPGDARDHEGFPWLNDLQARGKWV
Ga0063455_10018644533300004153SoilMKYLLLVCWDAEQMNSQTEPEPGEAQDEEGFPWLDDLQARGI
Ga0062591_10072976513300004643SoilMKYMLLVCWDAERMNAREEPRPGDARDDEGFPWLNDLQARGK
Ga0066690_1011448113300005177SoilMKYLLLVCWDAEKMDAQTEPDPGNTPDEESFPWLDDLQAR
Ga0066684_1024534713300005179SoilMKYLLLVCWDAEKMDAQTEPDPGNTPDEESFPWLDDLQARKMWI
Ga0070676_1120490213300005328Miscanthus RhizosphereMKFLLFVCWDGDKMNAQPEPDPSQPRTEESFPWLDELQARGT
Ga0070671_10210101123300005355Switchgrass RhizosphereMKYLLLVCWDGDRMNDQTEPEPGEEQPDKGFWWVDELREQGIWQ
Ga0070694_10078525423300005444Corn, Switchgrass And Miscanthus RhizosphereMRFLMLVCWDGEKMDAQTEPESSNDAADDESFPWLDDLQARGIWV
Ga0070686_10088008713300005544Switchgrass RhizosphereMKFLLLVCWDAEKMNELEEPDGSEAEDQDGFPWLDELQARGAW
Ga0070686_10169568523300005544Switchgrass RhizosphereMKYLLLVCWDAEHMNGQTEPDATAKAADAEEEPFPWVDEL
Ga0066704_1105407513300005557SoilMKYLLLVCWDAERMNGQTEPDPNTAPAEEEEGFPWVDHLR
Ga0066698_1029309123300005558SoilMKYLMLVCWDAEKMNAQTEPDPNDTSDEETFPWLDDF*
Ga0068855_10094027423300005563Corn RhizosphereMKYLLLVCWDTERMNGQTEPEPVATPAEDEEGFPWVDDLRER
Ga0066708_1038860213300005576SoilMKYLLLVCWDAERMNGQTEPEPGAARDEDEESFPWL
Ga0075288_109047913300005874Rice Paddy SoilMKYLLLVCWDAERMDARTEPDPGETAEEESFPWLDDLQARGAWITGDQ
Ga0081455_1091506813300005937Tabebuia Heterophylla RhizosphereMKYLLFVCWDTERMNAQIEPDPGDTPDEEEGFPWVD
Ga0066696_1069536813300006032SoilMKYLLLVCWDAENMDAQTEPDPGEAPNDESFPWLDDLQ
Ga0066656_1079462713300006034SoilMKYLMLVCWDAENMDALTEPDPADSPDEESFPWLDDLQARG
Ga0066652_10111726413300006046SoilVKYMLLVCWDAERMNAREEPRPGDARDHEGFPWLNDLQARGKWVTG
Ga0075417_1027892713300006049Populus RhizosphereMKYLLLICWDAERMDAQTEPDPTDPPEEDTFPWLDDI
Ga0075417_1056752923300006049Populus RhizosphereMKYLMLVCWDAERMDAQVEPDPNALPDVEEPFPWVDDLQ
Ga0079222_1018592643300006755Agricultural SoilMKFMLLVSWDAERMNAEEEPKPGEREEESFPWLDDLQARGVWVTGDR
Ga0075430_10087418923300006846Populus RhizosphereMKYMLLVCWGAERMDAQVEPEPSDTPEEPESFPWLGDVQER
Ga0075431_10141511523300006847Populus RhizosphereMKYMLLVCWGAERMDAQVEPEPSDTPEEPESFPWLGDVQERGIWVT
Ga0075429_10006046413300006880Populus RhizosphereMKYMLLVCWDAERMDAQVEPDPTDTPEEPESFPWLDD
Ga0066710_10188333013300009012Grasslands SoilMKFLLLVCWDAEKMDAQTEPDATESADEESFPWLDDLQARGIWVTG
Ga0105245_1116704033300009098Miscanthus RhizosphereMKFLLLVCWDAEKMNELEEPDGSEAEDQDGFPWLDELQARGAWVIGD
Ga0126313_1173668423300009840Serpentine SoilMKYLMLVCWDAERMNAQVEPDPGETQDEESFPWLEDVQARGAWITG
Ga0126304_1013901423300010037Serpentine SoilMKYLLLVCWDGDRMNAQTEPDPAEPQDEEEGFPWVDDL
Ga0126304_1014954343300010037Serpentine SoilMRFLLLVCWDAEKMDALTVLDAAATTEKESFPWLDDLQSRGVWVMGDQV
Ga0126304_1023743513300010037Serpentine SoilMKYLLLVCWDAERMNGQTEPDRRAASDEGEGFPWV
Ga0126310_1012015033300010044Serpentine SoilMKYLLLVCWDADRMNADTEPVPASGTEPPEKESFPWLD
Ga0134070_1042049213300010301Grasslands SoilMKFLLLLCWDAERMNAQTEPDPTDTPDEESFPWLDDLQARG
Ga0134084_1033983413300010322Grasslands SoilMKYLLLVCWDAERMNGQTEPEPGAARDEDEESFPWLDDLQARGAW
Ga0134064_1038434913300010325Grasslands SoilMKFLLMVCWDTDRMNAQTEPDPNEPQADEGFWWVDDLR
Ga0126383_1167006913300010398Tropical Forest SoilMKYLLLVCWNGERMNGQTEPDAEALKAAEEEGFPWVD
Ga0134123_1152824623300010403Terrestrial SoilMKFMMLVCWDAGAMDAQTEPDPAEEYEPESFPWLDDVQGRGKW
Ga0138513_10003829423300011000SoilMKYMMLICWDAERMDAQEEPDPSEAAEVESFPWLDDVQA
Ga0120174_110337623300012008PermafrostMKYLMLVCWDAEKMDGQTEPDPADTPDEESFPWLDDVQARGM*
Ga0120159_109346413300012014PermafrostMKYLLLVCWDAEKMDALTEPEPTDTSDEESFPWLDDLQ
Ga0120191_1004429823300012022TerrestrialMKYLLLVCWDAERMDAQTEPDPGETPDDDSFPWVDDLEARGI
Ga0136620_1024587713300012186Polar Desert SandMKYLLVCWDAERMDAQTEPDPGTSQSEDEEGFPWVDDLQARGIW
Ga0137382_1033381623300012200Vadose Zone SoilMLLVCWDAERMNAREEPRPGDARDHEGFPWLNDLQARGKWVTG
Ga0137381_1021368043300012207Vadose Zone SoilMKYLMLVCWDAENMDAQTEPDPTDTPEEESFPWLDDLQARGSWIT
Ga0137381_1167391123300012207Vadose Zone SoilMKYLLLVCWDAENMDAQTEPDPTDTPEEESFPWLDDLQARGSWIT
Ga0137360_1031636613300012361Vadose Zone SoilMKYLLLVFWDGESMNGQAEPEPGEAPDDTSFPWLDDLQ
Ga0137317_101302123300012672SoilMKYMLLVCWETERMDAQVEPDPTDSPEEPESFPWLDDVQERGIWVTG
Ga0136612_1049004023300012680Polar Desert SandMKYLLLVCWDAENMDAQTEPDPTDTPDEESFPWLDD
Ga0157284_1026175013300012893SoilMKFMMLVCWDAQSMDAQTEPDPTDTPDEKSFPWLDDVQARGI
Ga0157285_1018899523300012897SoilMKYLLPVCRDNGKMNGQTEPDPGAAGEEEPFPWVDELRARASG*
Ga0137394_1095063213300012922Vadose Zone SoilMKYLMLVCWDAENMDAQTEPDPTDTPDEESFPWLDD
Ga0164300_1000170973300012951SoilMKFLMLVCWDAEKMDAQTEPEASNDAADDESFPWLDDLQARGIWV
Ga0164303_1132982413300012957SoilMKFMLLVSWDAERMNAEEEPKPGEREEESFPWLDDLQ
Ga0164308_1213358913300012985SoilMKFLLLVTWDTERMNAQDEPEPGTEDEDDKGFPWL
Ga0157380_1087461943300014326Switchgrass RhizosphereMSLYLLLICWDAERMDAQEEPAPGTAEEPESFPWLDELQARGRWV
Ga0120171_105316033300014827PermafrostMKFLMFVCWDAKNMDAQAEPDPANPPDEESFPWLDDLQARGIWVLG
Ga0182007_1025301413300015262RhizosphereMKYLLLVCWDRERMDGQTEPDPGAPSDDRGFPWVD
Ga0183260_1014419643300017787Polar Desert SandMKYLRLVCWDAERMNAQTEPDPGTSQSEDEEGFPWVDDLQARGIC
Ga0136617_1003653863300017789Polar Desert SandMKYLMLVCWDAEKMDAQTEPDPTDTPNDESFPWLDDLQARGIWV
Ga0184618_1007094323300018071Groundwater SedimentMKFLMLVCWDAEKMDAQTEPESSNDTADNESFPWLDDLQARGIWVTG
Ga0184625_1008164933300018081Groundwater SedimentMKYLMLVCWEAERMDAQTEPDPTDTPDEESFPWLDDLQAQG
Ga0190265_1127179613300018422SoilMKYMMLVCWGAEKMDAQPEPEPTGTPDEEGFPWLDDLQA
Ga0190265_1382956713300018422SoilMRYLMLVCWDAEKMDAQTEPDPTGDPDEESFPWLDDLQARGIWVT
Ga0190275_1346827713300018432SoilMRFLMLVCWDAENMDAQTEPGPTDTPDEESFPWLDDVQERG
Ga0066667_1000802013300018433Grasslands SoilMKYLMLVCWDAEKMNAQTEPDPNDTPDEETFPWLDDLQARG
Ga0066667_1106302323300018433Grasslands SoilMKYLLLVCWDAERMNGQTEPEPGAARDEAEESFPWLDDLQARGASVPGA
Ga0190268_1023889733300018466SoilMRYLLLVCWDRERMDAQDEPEPGAAPDDDGFLWVDDL
Ga0190264_1174471713300019377SoilMKYLLLVCWDAERMDAQTEPDPTEAPDEESFPWLDD
Ga0193741_107496813300019884SoilMKYMLLVCWDAERMDAQVEPDPTDTSEPESFPWLEDVQERGIWVTGD
Ga0193696_111256113300020016SoilMKYLMLVCWDAEKMDAQAEPDPNESTEEESFPWLD
Ga0182009_1078523013300021445SoilMKCLLLVCWDSASMNAQDEPAPGTPPPAEEEPFPWVDDLRAAGIWKI
Ga0126371_1345137113300021560Tropical Forest SoilMKFMLLVCWDAENMNGQTEPDPGEDDADKGFPWLDDL
Ga0222622_1112456013300022756Groundwater SedimentMKFILLVCWDAKNMDAQTEPDSNTKETSEDEGFPWLDD
Ga0207662_1088587313300025918Switchgrass RhizosphereMKFLLLVCWDAKKMDARTEPAATAASGTESFPWLDDLVARG
Ga0207701_1134698123300025930Corn, Switchgrass And Miscanthus RhizosphereMKYLLLVCWDAERMDARTEPDPTDAPHEEEEGFPWLD
Ga0207679_1108179333300025945Corn RhizosphereVKYLLLVCWDAENMDALTEPEPGDAAEEEGFPWLDDLQARGR
Ga0207641_1216929813300026088Switchgrass RhizosphereMKYLLLVCWDGDRMNDQTEPEPGEEQPDKGFWWVDELREQGIWQI
Ga0207676_1105912523300026095Switchgrass RhizosphereVKYLLLVCWDADRMNAQTEPLPSTDAEPPVEESFPWLDELRA
Ga0209468_101719053300026306SoilMNFLMLVYWDAKKMDAQTEPDSTDAASTQSFPWLDDLQARGRWITGD
Ga0209155_120396323300026316SoilMKYLLLVCWDAEKMDAQTEPDPGNTPDEESFPWLDDLQARE
Ga0207428_1081429313300027907Populus RhizosphereMRFLLLVCWDAGKMDAQSEPDPGDTTEKESFPWLDDLQAR
Ga0307315_1008746223300028721SoilMKYLLLVCWDGERMNAQTEPDAADPPDEEEPFPWVDDLQ
Ga0307323_1021207123300028787SoilMKFLLLVCWDAENMNAQTEPGPDDPSDKEEGFPWLND
Ga0307287_1039488223300028796SoilMKYLMLVCWDAEKMDAQTEPVPNENTEEESFPWLDDLRARGIWVT
Ga0307284_1001333453300028799SoilMKFLMLVCWDAKKMDAQTEPDPTQTPVEESFPWLDDLR
Ga0265338_1116644323300028800RhizosphereMKYLLLVCWDAEQMDAQVEPDPGAADDEKGFPWLDELQ
Ga0307292_1012170413300028811SoilMKFLMLVCWDAEKMDAQTEPESSNDAADDESFPWLDDLQA
Ga0307292_1042646113300028811SoilMKFLMLVCWDAEQMNARTEPDPSDAPEEEEGFPWLDD
Ga0307310_1074885223300028824SoilMKYLLLVCWDGERMNAQTEPDAADPPDEEEPFPWVDDLQAR
Ga0307308_1055532023300028884SoilMKFLMFVCWDAKKMDAQTEPDPKQAPAEESFPWLDDLRSRGAWITGDQL
Ga0307304_1041329213300028885SoilVKYLLLVCWDAERMDAQTEPEPDSAPEEDEGFPWVD
Ga0268386_1089769513300030619SoilMKYVMLVCWDAERMDAQIEPDPRDSPEEESFPWLDDLQA
Ga0307495_1007650113300031199SoilMKFLMLVCWDAEKMDAQTEPESSNDAADDESFPWLDDLQARGIWVT
Ga0310813_1227318123300031716SoilMKYLLLICWDTEHMNGQTEPEPGAAPAEEGGFPWADDLDARGIRL
Ga0307405_1215802923300031731RhizosphereMKYLLLVCWDAEAMDAQVEPDPAEAQADESLPWLDDLQA
Ga0307468_10104195213300031740Hardwood Forest SoilMKFMMLVCWDAGAMDAQTEPDPAEEYEPESFPWLEDVQGR
Ga0307409_10093457023300031995RhizosphereMKYLMLVCWDADKMNARPDPEPTAEVAEEEPFPWLDDLRDHLAHR
Ga0307409_10128254923300031995RhizosphereMKYLLLVCWDAERMNDQTEPDPSAAPAEDDEGFPWVDDLRAQGIW
Ga0247830_1092979913300033551SoilMKYLLLVCWDAERMDAQTEPDPTHTPDVEQEGFPWLDDLQAKGSWI
Ga0247830_1134147513300033551SoilMKYLLLVCWDAERMNAQAEPDAADPPDEEEPFPWVDDLQARGIWKIG
Ga0364941_039315_1_1293300034417SedimentMKYMLLVCWDAEQMDAQNEPGPNDTPDEKSFPWLDDLQARGMW

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.