Metagenome / Metatranscriptome Family F090348

Basic Information
Family ID	F090348
Family Type	Metagenome / Metatranscriptome
Number of Sequences	108
Average Sequence Length	41 residues
Representative Sequence	ASPVNARWQAEMAALIDPCTDPATGFHRRLEEVFRLD
Number of Associated Samples	101
Number of Associated Scaffolds	108

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	2.78 %
% of genes near scaffold ends (potentially truncated)	91.67 %
% of genes from short scaffolds (< 2000 bps)	92.59 %
Associated GOLD sequencing projects	96
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.45

Most Common Taxonomy
Group	Bacteria (75.926 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (12.037 % of family members)
Environment Ontology (ENVO)	Unclassified (21.296 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (39.815 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 20.00% β-sheet: 3.08% Coil/Unstructured: 76.92%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 108 Family Scaffolds
PF00370	FGGY_N	12.04
PF02782	FGGY_C	7.41
PF00596	Aldolase_II	6.48
PF01261	AP_endonuc_2	4.63
PF05336	rhaM	4.63
PF05448	AXE1	4.63
PF12833	HTH_18	3.70
PF00092	VWA	1.85
PF02424	ApbE	1.85
PF02311	AraC_binding	1.85
PF00128	Alpha-amylase	1.85
PF13823	ADH_N_assoc	1.85
PF13407	Peripla_BP_4	1.85
PF06224	HTH_42	0.93
PF10944	DUF2630	0.93
PF04075	F420H2_quin_red	0.93
PF01019	G_glu_transpept	0.93
PF13602	ADH_zinc_N_2	0.93
PF07681	DoxX	0.93
PF13180	PDZ_2	0.93
PF00676	E1_dh	0.93
PF00801	PKD	0.93
PF00313	CSD	0.93
PF01594	AI-2E_transport	0.93
PF04945	YHS	0.93
PF05592	Bac_rhamnosid	0.93
PF00480	ROK	0.93
PF07883	Cupin_2	0.93
PF08240	ADH_N	0.93

COG ID	Name	Functional Category	% Frequency in 108 Family Scaffolds
COG1506	Dipeptidyl aminopeptidase/acylaminoacyl peptidase	Amino acid transport and metabolism [E]	4.63
COG3254	L-rhamnose mutarotase	Cell wall/membrane/envelope biogenesis [M]	4.63
COG3458	Cephalosporin-C deacetylase or related acetyl esterase	Secondary metabolites biosynthesis, transport and catabolism [Q]	4.63
COG0296	1,4-alpha-glucan branching enzyme	Carbohydrate transport and metabolism [G]	1.85
COG0366	Glycosidase/amylase (phosphorylase)	Carbohydrate transport and metabolism [G]	1.85
COG1477	FAD:protein FMN transferase ApbE	Posttranslational modification, protein turnover, chaperones [O]	1.85
COG1523	Pullulanase/glycogen debranching enzyme	Carbohydrate transport and metabolism [G]	1.85
COG1940	Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain	Transcription [K]	1.85
COG3280	Maltooligosyltrehalose synthase	Carbohydrate transport and metabolism [G]	1.85
COG0405	Gamma-glutamyltranspeptidase	Amino acid transport and metabolism [E]	0.93
COG0567	2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes	Energy production and conversion [C]	0.93
COG0628	Predicted PurR-regulated permease PerM	General function prediction only [R]	0.93
COG1071	TPP-dependent pyruvate or acetoin dehydrogenase subunit alpha	Energy production and conversion [C]	0.93
COG2259	Uncharacterized membrane protein YphA, DoxX/SURF4 family	Function unknown [S]	0.93
COG3214	DNA glycosylase YcaQ, repair of DNA interstrand crosslinks	Replication, recombination and repair [L]	0.93
COG3408	Glycogen debranching enzyme (alpha-1,6-glucosidase)	Carbohydrate transport and metabolism [G]	0.93
COG4270	Uncharacterized membrane protein	Function unknown [S]	0.93

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	75.93 %
Unclassified	root	N/A	24.07 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	75.93 %
Unclassified	root	N/A	24.07 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	75.93 %
Unclassified	root	N/A	24.07 %

Name	Rank	Taxonomy	Distribution
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	47.22 %
Unclassified	root	N/A	24.07 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	1.85 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	24.07 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	18.52 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	8.33 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	1.85 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	24.07 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	17.59 %
unclassified Chloroflexi	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi	6.48 %
unclassified Planctomycetota	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota	1.85 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	24.07 %
Micrococcales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales	6.48 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	5.56 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	2.78 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	1.85 %
Chloroflexi bacterium RBG_16_72_14	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_72_14	0.93 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	24.07 %
Cellulomonadaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae	5.56 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	5.56 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	2.78 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	1.85 %
Microbacteriaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae	0.93 %
Chloroflexi bacterium RBG_16_72_14	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_72_14	0.93 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	24.07 %
Oerskovia	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Oerskovia	5.56 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	5.56 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	2.78 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	1.85 %
Yonghaparkia	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Yonghaparkia	0.93 %
Chloroflexi bacterium RBG_16_72_14	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_72_14	0.93 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	24.07 %
Oerskovia douganii	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Oerskovia → Oerskovia douganii	5.56 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	5.56 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	2.78 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	1.85 %
Yonghaparkia	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Yonghaparkia	0.93 %
Chloroflexi bacterium RBG_16_72_14	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_72_14	0.93 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.93 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2140918008\|ConsensusfromContig369035	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Oerskovia → Oerskovia douganii	772	Open in IMG/M
3300001213\|JGIcombinedJ13530_100170321	All Organisms → cellular organisms → Bacteria	1780	Open in IMG/M
3300001213\|JGIcombinedJ13530_108945559	All Organisms → cellular organisms → Bacteria → Terrabacteria group	636	Open in IMG/M
3300001870\|JGI24129J20441_1042454	All Organisms → cellular organisms → Bacteria	1058	Open in IMG/M
3300002066\|JGIcombinedJ21911_10052951	All Organisms → cellular organisms → Bacteria	1361	Open in IMG/M
3300002069\|JGIcombinedJ21912_10040778	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	2096	Open in IMG/M
3300002549\|JGI24130J36418_10027647	All Organisms → cellular organisms → Bacteria	1672	Open in IMG/M
3300004079\|Ga0055514_10048043	All Organisms → cellular organisms → Bacteria	916	Open in IMG/M
3300004081\|Ga0063454_100464652	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	875	Open in IMG/M
3300004156\|Ga0062589_102287881	All Organisms → cellular organisms → Bacteria	555	Open in IMG/M
3300004808\|Ga0062381_10252573	All Organisms → cellular organisms → Bacteria	632	Open in IMG/M
3300005353\|Ga0070669_101994014	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	507	Open in IMG/M
3300005356\|Ga0070674_100624806	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	913	Open in IMG/M
3300005440\|Ga0070705_101515517	Not Available	562	Open in IMG/M
3300005466\|Ga0070685_10941457	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	645	Open in IMG/M
3300005468\|Ga0070707_101070196	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	772	Open in IMG/M
3300005535\|Ga0070684_101414366	Not Available	655	Open in IMG/M
3300005764\|Ga0066903_101685818	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	1206	Open in IMG/M
3300005980\|Ga0066798_10056919	All Organisms → cellular organisms → Bacteria	1215	Open in IMG/M
3300006605\|Ga0074057_11148244	All Organisms → cellular organisms → Bacteria → Terrabacteria group	688	Open in IMG/M
3300006853\|Ga0075420_101852258	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	516	Open in IMG/M
3300009081\|Ga0105098_10492216	Not Available	623	Open in IMG/M
3300009147\|Ga0114129_12864111	Not Available	571	Open in IMG/M
3300009148\|Ga0105243_11001981	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	838	Open in IMG/M
3300009167\|Ga0113563_11687748	All Organisms → cellular organisms → Bacteria → Terrabacteria group	751	Open in IMG/M
3300009551\|Ga0105238_12769939	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	527	Open in IMG/M
3300010359\|Ga0126376_13059767	Not Available	517	Open in IMG/M
3300010371\|Ga0134125_12132115	Not Available	609	Open in IMG/M
3300010373\|Ga0134128_11277311	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	809	Open in IMG/M
3300010373\|Ga0134128_12167093	Not Available	612	Open in IMG/M
3300011007\|Ga0139299_1047778	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1066	Open in IMG/M
3300011408\|Ga0137460_1108311	All Organisms → cellular organisms → Bacteria → Terrabacteria group	550	Open in IMG/M
3300012093\|Ga0136632_10312835	Not Available	706	Open in IMG/M
3300012212\|Ga0150985_109103862	Not Available	525	Open in IMG/M
3300012960\|Ga0164301_10488281	All Organisms → cellular organisms → Bacteria	885	Open in IMG/M
3300012986\|Ga0164304_10901047	All Organisms → cellular organisms → Bacteria	692	Open in IMG/M
3300012987\|Ga0164307_11309880	Not Available	606	Open in IMG/M
3300012988\|Ga0164306_10836233	Not Available	744	Open in IMG/M
3300013096\|Ga0157307_1077227	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	671	Open in IMG/M
3300013296\|Ga0157374_10548674	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1163	Open in IMG/M
3300013296\|Ga0157374_11180357	Not Available	787	Open in IMG/M
3300013297\|Ga0157378_10530818	All Organisms → cellular organisms → Bacteria	1180	Open in IMG/M
3300013308\|Ga0157375_13290873	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Yonghaparkia	539	Open in IMG/M
3300014325\|Ga0163163_10465337	All Organisms → cellular organisms → Bacteria	1325	Open in IMG/M
3300014498\|Ga0182019_10004474	All Organisms → cellular organisms → Bacteria	7213	Open in IMG/M
3300014502\|Ga0182021_10110103	All Organisms → cellular organisms → Bacteria	3199	Open in IMG/M
3300014502\|Ga0182021_10187691	All Organisms → cellular organisms → Bacteria	2413	Open in IMG/M
3300014745\|Ga0157377_10233730	Not Available	1183	Open in IMG/M
3300014745\|Ga0157377_10588630	All Organisms → cellular organisms → Bacteria	792	Open in IMG/M
3300014875\|Ga0180083_1018093	All Organisms → cellular organisms → Bacteria	1305	Open in IMG/M
3300015077\|Ga0173483_10021461	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2283	Open in IMG/M
3300015200\|Ga0173480_10247793	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	969	Open in IMG/M
3300015201\|Ga0173478_10726134	Not Available	535	Open in IMG/M
3300017695\|Ga0180121_10139272	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	885	Open in IMG/M
3300017941\|Ga0187850_10434525	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Oerskovia → Oerskovia douganii	571	Open in IMG/M
3300017998\|Ga0187870_1115696	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Oerskovia → Oerskovia douganii	1017	Open in IMG/M
3300018028\|Ga0184608_10294420	All Organisms → cellular organisms → Bacteria	713	Open in IMG/M
3300018055\|Ga0184616_10395261	All Organisms → cellular organisms → Bacteria → Terrabacteria group	518	Open in IMG/M
3300018071\|Ga0184618_10366498	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	613	Open in IMG/M
3300018077\|Ga0184633_10348970	Not Available	747	Open in IMG/M
3300018084\|Ga0184629_10538558	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	603	Open in IMG/M
3300019257\|Ga0180115_1232079	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	618	Open in IMG/M
3300023077\|Ga0247802_1080783	Not Available	548	Open in IMG/M
3300023311\|Ga0256681_10966159	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Oerskovia → Oerskovia douganii	910	Open in IMG/M
3300025692\|Ga0209744_1048137	All Organisms → cellular organisms → Bacteria	1594	Open in IMG/M
3300025711\|Ga0207696_1165859	Not Available	587	Open in IMG/M
3300025716\|Ga0209746_1061465	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Oerskovia → Oerskovia douganii	1234	Open in IMG/M
3300025846\|Ga0209538_1350703	All Organisms → cellular organisms → Bacteria → Terrabacteria group	506	Open in IMG/M
3300025885\|Ga0207653_10340645	Not Available	585	Open in IMG/M
3300025888\|Ga0209540_10654640	All Organisms → cellular organisms → Bacteria → Terrabacteria group	520	Open in IMG/M
3300025908\|Ga0207643_11002199	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	540	Open in IMG/M
3300025935\|Ga0207709_10189114	Not Available	1461	Open in IMG/M
3300025944\|Ga0207661_11583408	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	600	Open in IMG/M
3300025980\|Ga0210137_1062779	All Organisms → cellular organisms → Bacteria → Terrabacteria group	569	Open in IMG/M
3300026116\|Ga0207674_10977888	Not Available	815	Open in IMG/M
3300026142\|Ga0207698_11512546	Not Available	687	Open in IMG/M
3300026142\|Ga0207698_12019906	All Organisms → cellular organisms → Bacteria	591	Open in IMG/M
3300026142\|Ga0207698_12242134	All Organisms → cellular organisms → Bacteria → Acidobacteria	559	Open in IMG/M
3300026324\|Ga0209470_1042260	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	2246	Open in IMG/M
3300027841\|Ga0209262_10216836	All Organisms → cellular organisms → Bacteria → Terrabacteria group	927	Open in IMG/M
3300027887\|Ga0208980_10623150	All Organisms → cellular organisms → Bacteria → Terrabacteria group	614	Open in IMG/M
3300027896\|Ga0209777_10287650	All Organisms → cellular organisms → Bacteria	1276	Open in IMG/M
3300028556\|Ga0265337_1158903	All Organisms → cellular organisms → Bacteria → Terrabacteria group	613	Open in IMG/M
3300028577\|Ga0265318_10073679	All Organisms → cellular organisms → Bacteria	1264	Open in IMG/M
3300028654\|Ga0265322_10033094	All Organisms → cellular organisms → Bacteria	1474	Open in IMG/M
3300028796\|Ga0307287_10176053	Not Available	813	Open in IMG/M
3300028802\|Ga0307503_10074156	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1378	Open in IMG/M
3300028814\|Ga0307302_10694384	All Organisms → cellular organisms → Bacteria → Terrabacteria group	506	Open in IMG/M
3300028828\|Ga0307312_10805115	Not Available	623	Open in IMG/M
3300028855\|Ga0302257_1006221	All Organisms → cellular organisms → Bacteria	2597	Open in IMG/M
3300028885\|Ga0307304_10322958	Not Available	686	Open in IMG/M
3300029990\|Ga0311336_10114502	All Organisms → cellular organisms → Bacteria	2146	Open in IMG/M
3300030002\|Ga0311350_10592854	All Organisms → cellular organisms → Bacteria → Terrabacteria group	996	Open in IMG/M
3300030114\|Ga0311333_10807953	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Oerskovia → Oerskovia douganii	787	Open in IMG/M
3300030294\|Ga0311349_12141535	All Organisms → cellular organisms → Bacteria	513	Open in IMG/M
3300030339\|Ga0311360_10936996	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	685	Open in IMG/M
3300031235\|Ga0265330_10116793	All Organisms → cellular organisms → Bacteria	1138	Open in IMG/M
3300031726\|Ga0302321_101531394	All Organisms → cellular organisms → Bacteria → Terrabacteria group	769	Open in IMG/M
3300031833\|Ga0310917_10459104	Not Available	867	Open in IMG/M
3300031854\|Ga0310904_10389812	Not Available	909	Open in IMG/M
3300031873\|Ga0315297_10834546	All Organisms → cellular organisms → Bacteria → Terrabacteria group	767	Open in IMG/M
3300031902\|Ga0302322_103044734	All Organisms → cellular organisms → Bacteria → Terrabacteria group	576	Open in IMG/M
3300031997\|Ga0315278_11604257	All Organisms → cellular organisms → Bacteria → Terrabacteria group	622	Open in IMG/M
3300032008\|Ga0318562_10363776	All Organisms → cellular organisms → Bacteria	841	Open in IMG/M
3300032397\|Ga0315287_11437976	All Organisms → cellular organisms → Bacteria → Terrabacteria group	782	Open in IMG/M
3300034123\|Ga0370479_0263372	All Organisms → cellular organisms → Bacteria → Terrabacteria group	501	Open in IMG/M
3300034195\|Ga0370501_0367033	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_72_14	525	Open in IMG/M
3300034257\|Ga0370495_0031055	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1602	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	76.85%
Host-Associated	Host-Associated	23.15%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	51.85%
Aquatic	Environmental → Aquatic	25.00%
Plants	Host-Associated → Plants	23.15%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	44.44%
Rhizosphere	Host-Associated → Plants → Rhizosphere	16.67%
Freshwater	Environmental → Aquatic → Freshwater	13.89%
Peat	Environmental → Terrestrial → Peat	7.41%
Sediment	Environmental → Aquatic → Sediment	6.48%
Rhizoplane	Host-Associated → Plants → Rhizoplane	5.56%
Marine	Environmental → Aquatic → Marine	4.63%
Roots	Host-Associated → Plants → Roots	0.93%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	30.56%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	11.11%
Loam	Environmental → Terrestrial → Soil → Loam	7.41%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	7.41%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	6.48%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	6.48%
Soil	Host-Associated → Plants → Rhizosphere → Soil	5.56%
Wetlands	Environmental → Aquatic → Marine → Wetlands	4.63%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	4.63%
Lake	Environmental → Aquatic → Freshwater → Lake	3.70%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	3.70%
Ice	Environmental → Aquatic → Freshwater → Ice	2.78%
Sediment	Environmental → Aquatic → Freshwater → Sediment	1.85%
Lentic	Environmental → Aquatic → Freshwater → Lentic	0.93%
Pond	Environmental → Aquatic → Freshwater → Pond	0.93%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.93%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.93%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	16.67%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	11.11%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	8.33%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	7.41%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	6.48%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	5.56%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	5.56%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	4.63%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	3.70%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	2.78%
Sediment	Environmental → Aquatic → Marine → Wetlands → Sediment	2.78%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	2.78%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	1.85%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	1.85%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	1.85%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	1.85%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	1.85%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	1.85%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	1.85%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	0.93%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	0.93%
Glacier	Environmental → Aquatic → Freshwater → Ice → Glacier	0.93%
Sediment	Environmental → Aquatic → Freshwater → Pond → Sediment	0.93%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	0.93%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.93%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.93%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	0.93%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.93%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.93%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	12.04%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	7.41%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	6.48%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	5.56%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	4.63%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	3.70%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	3.70%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	2.78%
Wetland	Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland	2.78%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.78%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	2.78%
Fen	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen	2.78%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.78%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	1.85%
Polar Desert Sand	Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand	1.85%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	1.85%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	1.85%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.85%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	1.85%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	1.85%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.85%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.93%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.93%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment	0.93%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	0.93%
Wetland Sediment	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment	0.93%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.93%
Basal Ice	Environmental → Aquatic → Freshwater → Ice → Glacier → Basal Ice	0.93%
Freshwater	Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater	0.93%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.93%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	0.93%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.93%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.93%
Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil	0.93%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	0.93%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.93%
Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil	0.93%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.93%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.93%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.93%
Bog	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog	0.93%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.93%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.93%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.93%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.93%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.93%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.93%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.93%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2140918008	Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_all	Environmental	Open in IMG/M
3300001213	Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)	Environmental	Open in IMG/M
3300001870	Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-211	Environmental	Open in IMG/M
3300002066	Barrow Graham LP Ref core NGADG0002-211 (Barrow Graham LP Ref core NGADG0002-211,NGADG0004-311, ASSEMBLY_DATE=20131004)	Environmental	Open in IMG/M
3300002069	Barrow Graham LP Ref core NGADG0002-212 (Barrow Graham LP Ref core NGADG0002-212,NGADG0004-211, ASSEMBLY_DATE=20131010)	Environmental	Open in IMG/M
3300002549	Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212	Environmental	Open in IMG/M
3300004079	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleC_D2	Environmental	Open in IMG/M
3300004081	Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)	Environmental	Open in IMG/M
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental	Open in IMG/M
3300004808	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh	Environmental	Open in IMG/M
3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Host-Associated	Open in IMG/M
3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Host-Associated	Open in IMG/M
3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Environmental	Open in IMG/M
3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Environmental	Open in IMG/M
3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Environmental	Open in IMG/M
3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005980	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil leachate replicate DNA2013-203	Environmental	Open in IMG/M
3300006605	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006853	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4	Host-Associated	Open in IMG/M
3300009081	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015	Environmental	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009167	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)	Environmental	Open in IMG/M
3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Host-Associated	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300011007	Basal ice microbial communities from Matanuska glacier, Alaska, USA - MataB	Environmental	Open in IMG/M
3300011408	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT723_2	Environmental	Open in IMG/M
3300012093	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06)	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental	Open in IMG/M
3300012986	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG	Environmental	Open in IMG/M
3300012987	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG	Environmental	Open in IMG/M
3300012988	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG	Environmental	Open in IMG/M
3300013096	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2	Environmental	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014498	Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG	Environmental	Open in IMG/M
3300014502	Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)	Environmental	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300014875	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_1_16_10D	Environmental	Open in IMG/M
3300015077	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)	Environmental	Open in IMG/M
3300015200	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)	Environmental	Open in IMG/M
3300015201	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)	Environmental	Open in IMG/M
3300017695	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2)	Environmental	Open in IMG/M
3300017941	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150	Environmental	Open in IMG/M
3300017998	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150	Environmental	Open in IMG/M
3300018028	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex	Environmental	Open in IMG/M
3300018055	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coex	Environmental	Open in IMG/M
3300018071	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1	Environmental	Open in IMG/M
3300018077	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1	Environmental	Open in IMG/M
3300018084	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1	Environmental	Open in IMG/M
3300019257	Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_16_1Ra (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300023077	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S076-202R-6	Environmental	Open in IMG/M
3300023311	Combined Assembly of Gp0281739, Gp0281740, Gp0281741	Environmental	Open in IMG/M
3300025692	Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-311 (SPAdes)	Environmental	Open in IMG/M
3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025716	Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-211 (SPAdes)	Environmental	Open in IMG/M
3300025846	Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-211 (SPAdes)	Environmental	Open in IMG/M
3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025888	Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A (SPAdes)	Environmental	Open in IMG/M
3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025980	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleC_D2 (SPAdes)	Environmental	Open in IMG/M
3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026324	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)	Environmental	Open in IMG/M
3300027841	Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 (SPAdes)	Environmental	Open in IMG/M
3300027887	Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk	Environmental	Open in IMG/M
3300027896	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes)	Environmental	Open in IMG/M
3300028556	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG	Host-Associated	Open in IMG/M
3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Host-Associated	Open in IMG/M
3300028654	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG	Host-Associated	Open in IMG/M
3300028796	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141	Environmental	Open in IMG/M
3300028802	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S	Environmental	Open in IMG/M
3300028814	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183	Environmental	Open in IMG/M
3300028828	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202	Environmental	Open in IMG/M
3300028855	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N1_4	Environmental	Open in IMG/M
3300028885	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185	Environmental	Open in IMG/M
3300029990	I_Fen_N2 coassembly	Environmental	Open in IMG/M
3300030002	II_Fen_N1 coassembly	Environmental	Open in IMG/M
3300030114	I_Fen_E2 coassembly	Environmental	Open in IMG/M
3300030294	II_Fen_E3 coassembly	Environmental	Open in IMG/M
3300030339	III_Bog_N1 coassembly	Environmental	Open in IMG/M
3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Host-Associated	Open in IMG/M
3300031726	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1	Environmental	Open in IMG/M
3300031833	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178	Environmental	Open in IMG/M
3300031854	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1	Environmental	Open in IMG/M
3300031873	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0	Environmental	Open in IMG/M
3300031902	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2	Environmental	Open in IMG/M
3300031997	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0	Environmental	Open in IMG/M
3300032008	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18	Environmental	Open in IMG/M
3300032397	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0	Environmental	Open in IMG/M
3300034123	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_15	Environmental	Open in IMG/M
3300034195	Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17	Environmental	Open in IMG/M
3300034257	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Bog_all_C_01802320	2140918008	Soil	RFRTMMDEAPVNARWQAEMAALIDPCIDPATGFHRRLDEVFHLD
JGIcombinedJ13530_1001703211	3300001213	Wetland	AHMAAQEVNDRWQADMTRLIDPCTDPATGFHRRLEEIFRLD*
JGIcombinedJ13530_1089455591	3300001213	Wetland	SMAAAPVNDRWQADMARLIDPCTDPATGFHRRLEEVFRLD*
JGI24129J20441_10424542	3300001870	Arctic Peat Soil	VNARWQADMAALIDPCTDPATGFHRRLDEVFRLD*
JGIcombinedJ21911_100529512	3300002066	Arctic Peat Soil	PVNARWQADMAALIDPCTDPATGFHRRLDEVFRLD*
JGIcombinedJ21912_100407783	3300002069	Arctic Peat Soil	LDFDRFRAMMDVSPVNARWQADMAALIDPCTDPATGFHRRLDEVFRLD*
JGI24130J36418_100276472	3300002549	Arctic Peat Soil	RFRAMMDVSPVNARWQADMAALIDPCTDPATGFHRRLDEVFRLD*
Ga0055514_100480432	3300004079	Natural And Restored Wetlands	RAHMAAQPVNDRWQAEMTRLIDPCTDPATGFHRRLEEVFRLD*
Ga0063454_1004646521	3300004081	Soil	FRRHMAASAVNERWQHEMQALIDPLTDPETGFHRRLDEVFHLE*
Ga0062589_1022878811	3300004156	Soil	FRVSMAAAPINERWQAEMAALIDPLTDPTTGFHQRLEEIFHLD*
Ga0062381_102525732	3300004808	Wetland Sediment	FRAHMAAQPVNDRWQADMARLIDPCTDPATGFHRRLEEVFRLD*
Ga0070669_1019940141	3300005353	Switchgrass Rhizosphere	VDDFAAFTTAMADSEANARWQEEMAALIDPLTDPATGFHRRLDEVFHLG*
Ga0070674_1006248062	3300005356	Miscanthus Rhizosphere	YLEVEDLGRFQQHMNDSEVNARWQAHMGVLIDPLTDPATGFHRRLDEVFHLE*
Ga0070705_1015155172	3300005440	Corn, Switchgrass And Miscanthus Rhizosphere	RYMAASAVNARWQADMGVLIDPLTDPATGFHRQLDEVFHLG*
Ga0070685_109414571	3300005466	Switchgrass Rhizosphere	TAFTEAMATSEANARWQEQMAALIDPLTDPATGFHRRLDEVFHLE*
Ga0070707_1010701961	3300005468	Corn, Switchgrass And Miscanthus Rhizosphere	MAANPVNDRWQAEMAALIDPLTDPETGFHQRLEEIFHLD*
Ga0070684_1014143662	3300005535	Corn Rhizosphere	HLADSPVNARWQAEMGVLIDPLTDPATGFHRQLDEVFHLG*
Ga0066903_1016858181	3300005764	Tropical Forest Soil	ASEVNARWQASMGVLIDPLTDPETGFHQQLDEVFHLA*
Ga0066798_100569192	3300005980	Soil	GSFRAMMDAAPVNARWQADMASLIDPCTDPATGFHRRLEEVFRLD*
Ga0074057_111482443	3300006605	Soil	DDFDRFRAMMDASPVNARWQAEMADLIDPMIDPATGFHQRLDEIFRLD*
Ga0075420_1018522582	3300006853	Populus Rhizosphere	GSAANARWQTEMAELIDPLTDPDTGFHRRIPEVFHLE*
Ga0105098_104922161	3300009081	Freshwater Sediment	DRFRALMDAAPVNARWQAEMAALIDPCTDPATGFHRRLEEVFRLD*
Ga0114129_128641111	3300009147	Populus Rhizosphere	TAVNDRWQADMAALIDPLTDPATGFHRRLEEVFHLE*
Ga0105243_110019811	3300009148	Miscanthus Rhizosphere	AAFRAHLAESAVNARWQAEMGDLIDPLTDPATGFHRQLDEVFHLD*
Ga0113563_116877482	3300009167	Freshwater Wetlands	VNARWQAEMAALIDPCTDPATGFHRRLEEVFHLD*
Ga0105238_127699391	3300009551	Corn Rhizosphere	TTMAAAPINGPWQADMAPLIDPLTDPATGFHRRLDEVFHLD*
Ga0126376_130597671	3300010359	Tropical Forest Soil	SDANRRWQPDMASLIDPLTDPDTGFHHRMREVFHLD*
Ga0134125_121321151	3300010371	Terrestrial Soil	VNDRWQAEMAALIDPLTDPATGFHHRLEEIFHLD*
Ga0134128_112773111	3300010373	Terrestrial Soil	NPVNDRWQADMASLIDPLTDPATGFHRRLDEVFHLD*
Ga0134128_121670931	3300010373	Terrestrial Soil	ASTVNARWQADMGVLIDPLTDPATGFHRQLDEVFHLG*
Ga0139299_10477782	3300011007	Basal Ice	MMAASPINDRWQADMARLIDPCTDPATGFHRRLEEVFRLD*
Ga0137460_11083112	3300011408	Soil	DDFDRFRRLMDASSVNARWQAEMAGLIDPCTDPATGFHRRLEEVFRLD*
Ga0136632_103128352	3300012093	Polar Desert Sand	LEVEDFDRFRRHMSASQVNERWQADMAGLIDPMTDPDTGFHRRLDEVFRL*
Ga0150985_1091038621	3300012212	Avena Fatua Rhizosphere	ESDANERWQPEMASLIDPLTDADTGFHHRMREVFHLD*
Ga0164301_104882812	3300012960	Soil	AFRAYLAESAVNARWQAEMGDLIDPLTDAATGFHRQLDEVFHLD*
Ga0164304_109010471	3300012986	Soil	FARFREQMAAAEINDRWQAEMAELIDPLTDPATGFHQRLEEIFHLD*
Ga0164307_113098802	3300012987	Soil	GHSDANERWQAEMASLIDPLTDPATGFHQRLEEVFHLD*
Ga0164306_108362331	3300012988	Soil	AFRSAMAAAPVNDRWQAEMASLIDPLTDPATGFHQRLEEIFHLD*
Ga0157307_10772272	3300013096	Soil	VDDFTAFTEAMATSEANARWQEQMAALIDPLTDPATGFHRRLDEVFHLE*
Ga0157374_105486741	3300013296	Miscanthus Rhizosphere	SDVNARWQASMGVLIDPLTDPATGFHQQLDEVFHLE*
Ga0157374_111803572	3300013296	Miscanthus Rhizosphere	MAATPVNDRWQAEMASLIDPLTDPATGFHQRLEEIFHLD*
Ga0157378_105308184	3300013297	Miscanthus Rhizosphere	PVNDRWQADMAPLIDPLIDPSTGFHRRLDEVFHLD*
Ga0157375_132908731	3300013308	Miscanthus Rhizosphere	MAASPVNDRWQAEMASLIDPLTDPATGFHQRLEEIFHLD*
Ga0163163_104653371	3300014325	Switchgrass Rhizosphere	TEVNDRWQAEMAELIDPLTDPATGFHQRLEEIFHLD*
Ga0182019_1000447410	3300014498	Fen	MDEAPINAPWQAEMAALIDPCIDPATGFHRRLDEVFRLD*
Ga0182021_101101031	3300014502	Fen	MDAAPANARWQAEMTSLIDPCIDPATGFHGRLDEVFHLD*
Ga0182021_101876913	3300014502	Fen	FERFRKMMDEAPINAPWQAEMAALIDPCIDPATGFHRRLDEVFRLD*
Ga0157377_102337302	3300014745	Miscanthus Rhizosphere	MADSEANARWQEEMAALIDPLTDPATGFHRRLDEVFHLG*
Ga0157377_105886302	3300014745	Miscanthus Rhizosphere	NDSEVNARWQADMGVLIDPLTDPATGFHRQLDEVFHLE*
Ga0180083_10180931	3300014875	Soil	RTIMDAAPVNARWQAEMTSLIDPCTDPATGFHRRLEEVFRLD*
Ga0173483_100214613	3300015077	Soil	FTAAMAESEANAHWQAEMAALIDPLTDPATGFHRRLDEVFHLE*
Ga0173480_102477933	3300015200	Soil	DFERFRTYMAASEVNSRWQAEMGDGLIDPLTDPATGFHQRLDEVFHLD*
Ga0173478_107261342	3300015201	Soil	DDFARSREYMAAQAVNDRWQSEMAELIDPLTDPATGFHQRLEEIFHLD*
Ga0180121_101392721	3300017695	Polar Desert Sand	MAASPVNERWQADMASLIDARTDPTTGFHERLVEVFHLD
Ga0187850_104345252	3300017941	Peatland	DAAPVNARWQADMAALIDPCVDPATGFHRRLDEVFRLD
Ga0187870_11156961	3300017998	Peatland	DDFARFRSMMDGAPVNARWQAEMTSLIDPCIDPATGFHRRIDEVFRLD
Ga0184608_102944202	3300018028	Groundwater Sediment	ASPVNARWQSEMAALIDPLTDPATGFHERLAEVFHLD
Ga0184616_103952612	3300018055	Groundwater Sediment	FEVDDFDRFRTMMDAAPVNARWQAEMTSLIDPCTDPATGFHRRLEEVFRLD
Ga0184618_103664982	3300018071	Groundwater Sediment	EVNDRWQAEMASLIDPLTDPATGFHQRLEEIFHLD
Ga0184633_103489701	3300018077	Groundwater Sediment	AASPVNARWQAEMGHLIDPLTNPSTGFHQRLEEIFHLD
Ga0184629_105385581	3300018084	Groundwater Sediment	DFAAFRATVAASPVNDRWQGEMAVLIDPLTDPATGFHQRLEEIFHLD
Ga0180115_12320791	3300019257	Groundwater Sediment	MAAAPVNARWQAEMATLIDPCTDPATGFHRRLDEVFRLD
Ga0247802_10807831	3300023077	Soil	EVNARWQSDMGILIDPLTDPATGFHRQLDEVFHLE
Ga0256681_109661591	3300023311	Freshwater	FGVLEVDDFERFRKMMDEAPINGPWQAEMTALIDPCIDPSTGFHRRLDEVFRLD
Ga0209744_10481372	3300025692	Arctic Peat Soil	VLDFDRFRAMMDASPVNARWQADMASLIDPCTDPATGFHRRLEEVFRLD
Ga0207696_11658592	3300025711	Switchgrass Rhizosphere	AATEVIDRWQAEMAALIDPLTDPATGFHRQLEEIFHLE
Ga0209746_10614653	3300025716	Arctic Peat Soil	APINAPWQAEIASLIDPCTDPATGFHRRLDEVFRLD
Ga0209538_13507032	3300025846	Arctic Peat Soil	DRFRAMMDASSVNARWQADMASLIDPCTDPATGFHRRLEEVFRLD
Ga0207653_103406451	3300025885	Corn, Switchgrass And Miscanthus Rhizosphere	TAMAATEVNDRWQADMAALIDPQTDPATGFHRRLDEVFHLE
Ga0209540_106546402	3300025888	Arctic Peat Soil	EVNARWQADMASLIDPCTDPATGFHRRLDEVFRLD
Ga0207643_110021991	3300025908	Miscanthus Rhizosphere	ADSEANARWQEEMAALIDPLTDPATGFHRRLDEVFHLG
Ga0207709_101891142	3300025935	Miscanthus Rhizosphere	EAMATSEANARWQEQMAALIDPLTDPATGFHRRLDEVFHLE
Ga0207661_115834082	3300025944	Corn Rhizosphere	HMNDSAVNARWQADMGVLIDPLTDPETGFHRQLDEVFHLE
Ga0210137_10627792	3300025980	Natural And Restored Wetlands	RAHMAAQPVNDRWQAEMTRLIDPCTDPATGFHRRLEEVFRLD
Ga0207674_109778881	3300026116	Corn Rhizosphere	FTSQMAGSDANARWQAEMAELIDPLTDPATGFHTRISEVFHLD
Ga0207698_115125462	3300026142	Corn Rhizosphere	TEINDRWQAEMAELIDPLTDPATGFHQRLEEIFHLD
Ga0207698_120199062	3300026142	Corn Rhizosphere	FQRHMNESEVNARWQADMGVLIDPLTDPATGFHRQLDEVFHLD
Ga0207698_122421342	3300026142	Corn Rhizosphere	MSEANARWQEQMAALIDPLTDPATGFHRRLDEVFHLE
Ga0209470_10422602	3300026324	Soil	MSSQEVNDRWQAGMTALIDPLTDPETGFHRRLEEVFHLE
Ga0209262_102168361	3300027841	Freshwater	FEVEDFDRFRRLMDAAPINARWQAEMAALIDPCTDPATGFHRRLEEVFRLE
Ga0208980_106231502	3300027887	Wetland	RLMDGSPVNARWQAEMAALIDPCTDPATGFHRRLEEVFRLE
Ga0209777_102876501	3300027896	Freshwater Lake Sediment	MMDASPVNASWQADMASLIDPCTDPATGFHRRLEEVFRLD
Ga0265337_11589031	3300028556	Rhizosphere	PINAPWQADMAALIDPCTDPATGFHRRLEEIFHLD
Ga0265318_100736791	3300028577	Rhizosphere	AMAASPVDARWQTEMTALINPLIDPATGFHRRLEEIFHLE
Ga0265322_100330942	3300028654	Rhizosphere	RALMDAAPVNARWQAEMALLIDQCTDPETGFHRRLDEVFRLD
Ga0307287_101760532	3300028796	Soil	FREHMAATEVNDRWQAEMATLIDPLTDPATGFHQRLEEIFHLD
Ga0307503_100741561	3300028802	Soil	ASMAAAPVNDRWQADMASLIDPLTDPTTGFHQRLEEIFHLD
Ga0307302_106943842	3300028814	Soil	PVNALWQADMAELIDPLIDPSTGFHQRLDEVFRLG
Ga0307312_108051152	3300028828	Soil	AAPVNDRWQAEMAALIDPLTDPATGFHQRLEEIFHLE
Ga0302257_10062211	3300028855	Fen	MMDEAPINAPWQAEMAALIDPCIDPATGFHRRLDEVFRLD
Ga0307304_103229581	3300028885	Soil	REQMAATEINDRWQAEMAELIDPLTDPATGFHQRLEEIFHLD
Ga0311336_101145021	3300029990	Fen	HFRALMDASEVNARWQADMASLIDPCTDPATGFHRRLEEVFRLD
Ga0311350_105928541	3300030002	Fen	FDVEDFDRFRAHMAAQGVNDRWQADMARLIDPCTDPATGFHRRLDEVFRLD
Ga0311333_108079532	3300030114	Fen	LVVDDFDRFRKMMDEAPINAPWQAEMAALIDPCIDPATGFHGRLDEVFHLD
Ga0311349_121415351	3300030294	Fen	SPVNDRWQADMAGLIDPCTDPATGFHRRLDEVFRLD
Ga0311360_109369961	3300030339	Bog	AVNTRWQAEMGSSLIDPLTDPATGFHRQLDEVFHLA
Ga0265330_101167932	3300031235	Rhizosphere	SPVDARWQTEMTALINPLIDPATGFHRRLEEIFHLE
Ga0302321_1015313941	3300031726	Fen	AALEVNDRWQADMARLIDPCTDPDTGFHRRLDEVFRLD
Ga0310917_104591041	3300031833	Soil	RFQAYLAASDVNARWQASMGVLIDPMTDPATGFHHQLDEVFHLD
Ga0310904_103898122	3300031854	Soil	DRFTQHMAGSAANARWQTEMAELIDPLTDPDTGFHRRIPEVFHLE
Ga0315297_108345461	3300031873	Sediment	ASPVNARWQAEMAALIDPCTDPATGFHRRLEEVFRLD
Ga0302322_1030447341	3300031902	Fen	NRFRTLMDAAPVNARWQAEMASLIDPCTDPATGFHRRLEEVFRLD
Ga0315278_116042571	3300031997	Sediment	PINARWQAEMAALIDPCTDPATGFHRRLEEVFRLD
Ga0318562_103637763	3300032008	Soil	FRATMDASPVNARWQADMGRLIDPLTDASTGFHQRLDEVFHLD
Ga0315287_114379761	3300032397	Sediment	PVNARWQAEMAALIDPCTDPATGFHRRLEEVFRLD
Ga0370479_0263372_354_500	3300034123	Untreated Peat Soil	EDFDAFRAHMAAQPVNTRWQADMERLIDPCTDPATGFHRRLDEVFRFD
Ga0370501_0367033_395_514	3300034195	Untreated Peat Soil	MAASQVDARWQAEMAGLIDPLTDPNTGFHERLDEVFHLD
Ga0370495_0031055_281_418	3300034257	Untreated Peat Soil	MERVAHMAAQPVNDRWQADMARLIDPCTDPATGFHRRLEEVFRLD

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.45
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.45
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F090348

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign