NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F090649

Metagenome Family F090649

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F090649
Family Type Metagenome
Number of Sequences 108
Average Sequence Length 41 residues
Representative Sequence MIWLFLILALSTVAVSLVGLAAYLRVRSHMKEGSSRETHGKD
Number of Associated Samples 90
Number of Associated Scaffolds 108

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 81.48 %
% of genes near scaffold ends (potentially truncated) 23.15 %
% of genes from short scaffolds (< 2000 bps) 76.85 %
Associated GOLD sequencing projects 81
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.444 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(15.741 % of family members)
Environment Ontology (ENVO) Unclassified
(27.778 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(36.111 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 66.67%    β-sheet: 0.00%    Coil/Unstructured: 33.33%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 108 Family Scaffolds
PF02632BioY 34.26
PF00557Peptidase_M24 28.70
PF02621VitK2_biosynth 13.89
PF05195AMP_N 4.63
PF13407Peripla_BP_4 3.70
PF13641Glyco_tranf_2_3 0.93
PF09335SNARE_assoc 0.93
PF04055Radical_SAM 0.93
PF02481DNA_processg_A 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 108 Family Scaffolds
COG1268Biotin transporter BioYCoenzyme transport and metabolism [H] 34.26
COG1427Chorismate dehydratase (menaquinone biosynthesis, futalosine pathway)Coenzyme transport and metabolism [H] 13.89
COG0006Xaa-Pro aminopeptidaseAmino acid transport and metabolism [E] 4.63
COG0758Predicted Rossmann fold nucleotide-binding protein DprA/Smf involved in DNA uptakeReplication, recombination and repair [L] 1.85
COG0398Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 familyFunction unknown [S] 0.93
COG0586Membrane integrity protein DedA, putative transporter, DedA/Tvp38 familyCell wall/membrane/envelope biogenesis [M] 0.93
COG1238Uncharacterized membrane protein YqaA, VTT domainFunction unknown [S] 0.93


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.44 %
UnclassifiedrootN/A5.56 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459005|F1BAP7Q02HSJVZNot Available520Open in IMG/M
3300001160|JGI12654J13325_1008165All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium711Open in IMG/M
3300002245|JGIcombinedJ26739_100007705All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis8524Open in IMG/M
3300002245|JGIcombinedJ26739_100102471All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2681Open in IMG/M
3300002245|JGIcombinedJ26739_100907612All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium763Open in IMG/M
3300002245|JGIcombinedJ26739_101297026All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium619Open in IMG/M
3300004463|Ga0063356_102615935All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium775Open in IMG/M
3300005175|Ga0066673_10180077All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1194Open in IMG/M
3300005177|Ga0066690_10218215All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1273Open in IMG/M
3300005340|Ga0070689_100662185All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium909Open in IMG/M
3300005367|Ga0070667_102052579All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium539Open in IMG/M
3300005434|Ga0070709_10034310All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3076Open in IMG/M
3300005439|Ga0070711_100075209All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2391Open in IMG/M
3300005439|Ga0070711_100301763All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1274Open in IMG/M
3300005445|Ga0070708_100005746All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae9841Open in IMG/M
3300005445|Ga0070708_101409957All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium650Open in IMG/M
3300005536|Ga0070697_102008287All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium518Open in IMG/M
3300005538|Ga0070731_10208597All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1297Open in IMG/M
3300005547|Ga0070693_100298637All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1085Open in IMG/M
3300005995|Ga0066790_10000271All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter18246Open in IMG/M
3300006028|Ga0070717_11576216All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium595Open in IMG/M
3300006041|Ga0075023_100222065All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300006041|Ga0075023_100590356Not Available515Open in IMG/M
3300006047|Ga0075024_100627624All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium581Open in IMG/M
3300006050|Ga0075028_100581796All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium663Open in IMG/M
3300006057|Ga0075026_100858251All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium555Open in IMG/M
3300006059|Ga0075017_100969666All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium661Open in IMG/M
3300006176|Ga0070765_100863761All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium855Open in IMG/M
3300006854|Ga0075425_100901474All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1011Open in IMG/M
3300006914|Ga0075436_100094191All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2083Open in IMG/M
3300007076|Ga0075435_101718515All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae551Open in IMG/M
3300007788|Ga0099795_10282502All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium725Open in IMG/M
3300009038|Ga0099829_10003763All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui8939Open in IMG/M
3300009038|Ga0099829_10025070All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4167Open in IMG/M
3300009088|Ga0099830_10133128All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1895Open in IMG/M
3300009092|Ga0105250_10357719All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium640Open in IMG/M
3300009098|Ga0105245_10242801All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1746Open in IMG/M
3300009551|Ga0105238_10699584All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1025Open in IMG/M
3300010371|Ga0134125_10731354All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1090Open in IMG/M
3300010403|Ga0134123_12120064All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium623Open in IMG/M
3300011270|Ga0137391_11545427Not Available508Open in IMG/M
3300012205|Ga0137362_11210251All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium640Open in IMG/M
3300012208|Ga0137376_10160304All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1938Open in IMG/M
3300012212|Ga0150985_123044596All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2198Open in IMG/M
3300012469|Ga0150984_108677176All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae935Open in IMG/M
3300012685|Ga0137397_10169938All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1618Open in IMG/M
3300012917|Ga0137395_10685441All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae741Open in IMG/M
3300012927|Ga0137416_10576762All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae977Open in IMG/M
3300012955|Ga0164298_10972972All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium624Open in IMG/M
3300012960|Ga0164301_11892959Not Available504Open in IMG/M
3300013297|Ga0157378_10346471All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1450Open in IMG/M
3300014498|Ga0182019_11286789All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium539Open in IMG/M
3300017927|Ga0187824_10299846All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium569Open in IMG/M
3300017930|Ga0187825_10026643All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1945Open in IMG/M
3300017930|Ga0187825_10047388All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1455Open in IMG/M
3300017936|Ga0187821_10376668All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium577Open in IMG/M
3300019789|Ga0137408_1187805All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3363Open in IMG/M
3300019879|Ga0193723_1033217All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1550Open in IMG/M
3300019881|Ga0193707_1004128All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5178Open in IMG/M
3300020015|Ga0193734_1004337All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2580Open in IMG/M
3300020061|Ga0193716_1003310All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis8864Open in IMG/M
3300020199|Ga0179592_10440666All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium564Open in IMG/M
3300020579|Ga0210407_10270542All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1325Open in IMG/M
3300020579|Ga0210407_10557464All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium894Open in IMG/M
3300020579|Ga0210407_10708762All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium780Open in IMG/M
3300020580|Ga0210403_10021634All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5137Open in IMG/M
3300021088|Ga0210404_10317556All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium860Open in IMG/M
3300021170|Ga0210400_11601705Not Available514Open in IMG/M
3300021178|Ga0210408_10045494All Organisms → cellular organisms → Bacteria → Acidobacteria3438Open in IMG/M
3300021344|Ga0193719_10098762All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1269Open in IMG/M
3300021420|Ga0210394_11225796All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium643Open in IMG/M
3300021432|Ga0210384_11871755All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium506Open in IMG/M
3300021432|Ga0210384_11887958All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium503Open in IMG/M
3300021478|Ga0210402_11153352All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium702Open in IMG/M
3300024181|Ga0247693_1056918Not Available572Open in IMG/M
3300024330|Ga0137417_1141071All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium997Open in IMG/M
3300025899|Ga0207642_11040319All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium528Open in IMG/M
3300025929|Ga0207664_11603892All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium573Open in IMG/M
3300026294|Ga0209839_10001496All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae11945Open in IMG/M
3300027605|Ga0209329_1087332All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium679Open in IMG/M
3300027610|Ga0209528_1027553All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1256Open in IMG/M
3300027651|Ga0209217_1008284All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3437Open in IMG/M
3300027667|Ga0209009_1147765All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium598Open in IMG/M
3300027846|Ga0209180_10005770All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis6248Open in IMG/M
3300027846|Ga0209180_10086768All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium1772Open in IMG/M
3300027862|Ga0209701_10072678All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2175Open in IMG/M
3300027862|Ga0209701_10085884All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1979Open in IMG/M
3300027894|Ga0209068_10486314All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium711Open in IMG/M
3300027910|Ga0209583_10021480All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2049Open in IMG/M
3300027910|Ga0209583_10685492All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300027915|Ga0209069_10201447All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1015Open in IMG/M
3300027915|Ga0209069_10269332All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium893Open in IMG/M
3300027915|Ga0209069_10669037All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium606Open in IMG/M
3300028047|Ga0209526_10032080All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3693Open in IMG/M
3300028047|Ga0209526_10090217All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2158Open in IMG/M
3300028828|Ga0307312_10248326All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1151Open in IMG/M
3300031231|Ga0170824_106930684All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium939Open in IMG/M
3300031446|Ga0170820_15039002All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium578Open in IMG/M
3300031474|Ga0170818_114809136All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1222Open in IMG/M
3300031720|Ga0307469_10142078All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1780Open in IMG/M
3300031720|Ga0307469_10281140All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1359Open in IMG/M
3300031820|Ga0307473_10849761All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium655Open in IMG/M
3300031962|Ga0307479_10056155All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3792Open in IMG/M
3300032180|Ga0307471_102501663All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium653Open in IMG/M
3300032770|Ga0335085_10011596All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis13063Open in IMG/M
3300032828|Ga0335080_11634137All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae634Open in IMG/M
3300032829|Ga0335070_10766736All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium899Open in IMG/M
3300034195|Ga0370501_0020207All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1939Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil15.74%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds11.11%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.11%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil10.19%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.41%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.41%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.63%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.70%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.78%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.78%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.78%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.85%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil1.85%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.93%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.93%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.93%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.93%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.93%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.93%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.93%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.93%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.93%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459005Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
3300001160Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005995Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300017927Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300019881Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2EnvironmentalOpen in IMG/M
3300020015Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1EnvironmentalOpen in IMG/M
3300020061Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300024181Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34EnvironmentalOpen in IMG/M
3300024330Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026294Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes)EnvironmentalOpen in IMG/M
3300027605Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027610Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027651Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027667Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027910Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300034195Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
E41_083611402170459005Grass SoilMIWLFLILALSTVAVALVGLAAYLRVRGHMKEGSPKETHEKD
JGI12654J13325_100816513300001160Forest SoilMIWLFLILALSTVAVFLVGLAAYLRVRRHMKEAASREGPGKE*
JGIcombinedJ26739_10000770583300002245Forest SoilMIWLFLILALSTIAVSLVGLAAYLRVRSHMKEGSSRETHGKD*
JGIcombinedJ26739_10010247143300002245Forest SoilMIWLFLILALSTVAVLLVGIAAYLRVRRHAKEASGEAHSKD*
JGIcombinedJ26739_10090761213300002245Forest SoilMIWLFLILALSTVAVSLVGLAAYLRVRQHMKGAAPRETPGKE*
JGIcombinedJ26739_10129702623300002245Forest SoilMIWLFLILALSTVAVLLVGIAAYLRVRRHVKEASGEAHGKD*
Ga0063356_10261593523300004463Arabidopsis Thaliana RhizosphereMIWLFLILALSTVAVALVGLAAYLRVRSHMKESSSRETHGKE*
Ga0066673_1018007713300005175SoilMILWFLVLALSGVAVLLVGIAAYLRVRGHMKEASSSEAGSKN*
Ga0066690_1021821513300005177SoilMIWWFLVLALSGVAVLLVGIAAYLRVRGHMKEASSSEARSKN*
Ga0070689_10066218523300005340Switchgrass RhizosphereMIWLFLILALSTVAVGLVGLAAYLRVRSHMKESSSRETHGKE*
Ga0070667_10205257923300005367Switchgrass RhizosphereMIWLFLILALSTVAVGLVGLAAYLRVRGHMKEGSPKETHEKD*
Ga0070709_1003431023300005434Corn, Switchgrass And Miscanthus RhizosphereMIWLFLILALSTVAVSLVGLAAYLRVRSHMKDGSSRETHGKD*
Ga0070711_10007520933300005439Corn, Switchgrass And Miscanthus RhizosphereMIWLFLILALSTVAVALVGLAAYLRVRGHMKEGSPKETHEKD*
Ga0070711_10030176323300005439Corn, Switchgrass And Miscanthus RhizosphereMIWLFLILALSTVAVSLVGLAAYLRVRSHMKEGSSRETHGKD*
Ga0070708_10000574653300005445Corn, Switchgrass And Miscanthus RhizosphereMIWLFLILALSAVSVSLVGLATYLRVRRHMKEASSRETHGKD*
Ga0070708_10140995713300005445Corn, Switchgrass And Miscanthus RhizosphereMIWLFLILALSTVAVSLVGLAAYLRVRSHMKDGSSREPHGKD*
Ga0070697_10200828723300005536Corn, Switchgrass And Miscanthus RhizosphereWWFLILALSAVSVSLVGLATYLRIRRHMKEASSRETHGKD*
Ga0070731_1020859713300005538Surface SoilMIWLFLILALSTVAVSLVGLAAYLRVRSHMKDGSSRETHGKE*
Ga0070693_10029863723300005547Corn, Switchgrass And Miscanthus RhizosphereMIWLFLILALSAVSVSLVGLATYLRIRRHLKEASSRETHGKD*
Ga0066790_1000027143300005995SoilMIWLFLILALSTVAVSLVGLAAYLRVRSHMKDGSSRETHGRD*
Ga0070717_1157621623300006028Corn, Switchgrass And Miscanthus RhizosphereQVIVRMIWLFLILALSTVSVSLVGLAAYLRVRRHMKDGASRETHGKE*
Ga0075023_10022206523300006041WatershedsMIWLFLILALSTVAVFLVGLAAYLRVRRHMKEAASKNGPGGE*
Ga0075023_10059035613300006041WatershedsMIWLFLILGLSTVAVFLVGIAAYLRVRRHMKEASSREGHGKE*
Ga0075024_10062762413300006047WatershedsMIWMFLILALSTVAVSLVGLAAYLRVRQHMKDAASRESPGKD*
Ga0075028_10058179623300006050WatershedsMIWLFLILALSTVAVSLVGLAAYLRVRSHMKDSSSRENHGKD*
Ga0075026_10085825123300006057WatershedsMIWLFLILALSTVAVSLVGLAAYLRVRGHMKDGASKETHEKD*
Ga0075017_10096966623300006059WatershedsFLILALSTVAVSLVGLAAYLRVRGHMKDGTRKDTHEKD*
Ga0070765_10086376113300006176SoilLILALSTVAVSLVGLAAYLRVRSHMKEGSSRETHGKD*
Ga0075425_10090147423300006854Populus RhizosphereMIWLFLILALSAVSVSLVGLATYLRIRRQMKEASSRETHGKD*
Ga0075436_10009419113300006914Populus RhizosphereMIWLFLILALSAVSVSLVGLATYLRVRRHMKEASPRETHGK
Ga0075435_10171851523300007076Populus RhizosphereMIWLFLILALSTVAVSLVGLAAYLRVRRHMKEASAREGHGRD*
Ga0099795_1028250223300007788Vadose Zone SoilMIWLFLILALSTVAVSLVGLAAYLRVRSHMKDSSSREPHGKD*
Ga0099829_1000376383300009038Vadose Zone SoilMFLILALSTVAVSLVGLAAYLRVRQHMKDAASRETPGKD*
Ga0099829_1002507023300009038Vadose Zone SoilMIWLFLILALSAVSVSLVGLATYLRVRRHMKESSSRETHGKD*
Ga0099830_1013312823300009088Vadose Zone SoilMIWMFLILALSTVAVSLVGLAAYLRVRQHMKDAASRETPGKD*
Ga0105250_1035771923300009092Switchgrass RhizosphereALSTVAVALVGLAAYLRVRSHMKESSSRETHGKE*
Ga0105245_1024280123300009098Miscanthus RhizosphereMIWLFLILALSTVAVGLLGLAAYLRVRSHMKESSSRETHGKE*
Ga0105238_1069958423300009551Corn RhizosphereMIWLFLILALSTVAVGLVGLAAYLRVRSHMKESSSRETHGK
Ga0134125_1073135423300010371Terrestrial SoilMIWLFLILALSTVAVSLVGLAAYLRVRVHMKESSSKEPHSKD*
Ga0134123_1212006423300010403Terrestrial SoilMIWLFLILALSTVAVSLVGLAAYLRVRSHMKDGSSRESHGKD*
Ga0137391_1154542713300011270Vadose Zone SoilMIWLFLILALSTVAVSLVGLAAYLRVRSHLKEGSSRETHGKD*
Ga0137362_1121025123300012205Vadose Zone SoilMIWLFLILALSTVSVSLVGLAAYLRVRRHIKEEAASRETHGKE*
Ga0137376_1016030433300012208Vadose Zone SoilMIWLFLILALSAVSVSLVGLATYLRIRRHMKQASSRETHGKD*
Ga0150985_12304459653300012212Avena Fatua RhizosphereVRMIWLFLILALSTVAVALVGLAGYLRVRGHMKDGGSKETHEKD*
Ga0150984_10867717613300012469Avena Fatua RhizosphereIWLFLILALSTVAVALVGLAGYLRVRGHMKDGGSKETHEKD*
Ga0137397_1016993833300012685Vadose Zone SoilMIWLFLILALSTVAVSLVGLAAYLRVRSHMKYGTSREPHGKD*
Ga0137395_1068544123300012917Vadose Zone SoilMIWLFLILALSTVAVFLVGLAAYLRVRRHMKEASAREIHMKD*
Ga0137416_1057676223300012927Vadose Zone SoilMIWLFLILALSTVAVFLVGLAAYLRVRRHMKEASAREAHGKD*
Ga0164298_1097297223300012955SoilMIWLFLILALSTVAVALVGLAAYLRVRSHMKESSS
Ga0164301_1189295923300012960SoilMIWLFLILALSTVAVSLVGLAAYLRVRSHMKEGSSRETHGKE*
Ga0157378_1034647133300013297Miscanthus RhizosphereMIWLFLILALSAVSVAAVSLKTKLRIRRHLKEASSRETHGKD*
Ga0182019_1128678913300014498FenMIWLFLILALSTVAVSLVGLAAYLRVRGHMKDGTPKDTHDKD*
Ga0187824_1029984623300017927Freshwater SedimentMIWLFLILALSTVAVSLVGLAAYLRVRQHMKDAAARESPGKE
Ga0187825_1002664313300017930Freshwater SedimentMIWLFLILALSTVAVSLVGLAAYLRVRSHMKDASR
Ga0187825_1004738833300017930Freshwater SedimentMIWLFLILALSTVAVSLVGLAAYLRVRQHMKDAAARESAGKE
Ga0187821_1037666813300017936Freshwater SedimentFLILALSTVAVSLVGLAAYLRVRQHMKDAAARESPGKE
Ga0137408_118780523300019789Vadose Zone SoilMIWLFLILALSAVSVSLVGLATYLRVRRHMKEASSRETHGKD
Ga0193723_103321713300019879SoilMIWLFLILALSTVAVSLVGLAAYLRVRSHMRDGSSREPHGKD
Ga0193707_100412843300019881SoilMIWLFLILALSTVSVTLVGLAAYLRVRRHMKETSSRETHGKD
Ga0193734_100433723300020015SoilMIWLFLILALSAVSVSLVGLATYLRVRRHMKEASPRETHGKD
Ga0193716_100331053300020061SoilMIWLFLILALSTVAVSLVGLAAYLRVRGHMKDGAPKETHDKD
Ga0179592_1044066623300020199Vadose Zone SoilMIWLFLILALSTVAVSLVGLAAYLRVRSHMKDGSSREPHGKD
Ga0210407_1027054223300020579SoilMIWMFLILALSTVAVSLVGLAAYLRVRQHMKDAASRETPGKD
Ga0210407_1055746423300020579SoilMIWLFLILALSTVAVSLVGLAAYLRVRQHMKGAAPREPPGKE
Ga0210407_1070876223300020579SoilMIWLFLILALSTVAVSLVGLAAYLRVRSHMKDGSSRETHGKD
Ga0210403_1002163413300020580SoilWLFLILALSTVAVSLVGLAAYLRVRQHMKGAAPREPPGKE
Ga0210404_1031755613300021088SoilMIWLFLILALSTVAVSLVGLAAYLRVRSHMKDGSSRETHG
Ga0210400_1160170523300021170SoilMIWLFLILALSTVAVSLVGLAAYLRVRSHMKEGSSGETHGKD
Ga0210408_1004549443300021178SoilLALSTVAVSLVGLAAYLRVRSHMKEGSSRETHGKD
Ga0193719_1009876223300021344SoilMIWLFLILALSTVAVGLVGLAAYLRVRSHMKVSSSRETHGKE
Ga0210394_1122579623300021420SoilMIWLFLILALSTVAVSLVGLAAYLRVRQHMKGAAPRETPGKE
Ga0210384_1187175513300021432SoilMIWMFLILALSTVAVSLVGLAAYLRVRQHMKDAASRET
Ga0210384_1188795823300021432SoilMIWLFLILALSTVAVLLVGLAAYLRVRRHMKEAASKDGPGGE
Ga0210402_1115335213300021478SoilMIWLFLILALSTVAVSLVGLAAYLRVRSHMKESSSREIHGNGNSKD
Ga0247693_105691823300024181SoilMIWLFLILALSTVAVALVGLAAYLRVRSHMKESSSRETHGKE
Ga0137417_114107113300024330Vadose Zone SoilMIWLFLILALSAVSVSLVGLATYLRVRRHMKEASSRETH
Ga0207642_1104031923300025899Miscanthus RhizosphereMIWLFLILALSTVAVGLVGLAAYLRVRSHMKESSSRETHGKE
Ga0207664_1160389213300025929Agricultural SoilMIWLFLILALSTVSVSLVALAAYLRVRRHMKETPSRETH
Ga0209839_10001496103300026294SoilMIWLFLILALSTVAVSLVGLAAYLRVRSHMKDGSSRETHGRD
Ga0209329_108733213300027605Forest SoilMIWLFLILALSTVAVSLVGLAAYLRVRSHMKDGSS
Ga0209528_102755333300027610Forest SoilMIWLFLILALSTIAVSLVGLAAYLRVRSHMKEGSSRETHGKD
Ga0209217_100828443300027651Forest SoilMIWLFLILALSTVAVFLVGLAAYLRVRRHMKEAASREGPGKE
Ga0209009_114776513300027667Forest SoilMIWLFLILALSTVAVSLVGLAAYLRVRSHMKDGSSRETH
Ga0209180_1000577013300027846Vadose Zone SoilMIWLFLILALSAVSVSLVGLATYLRVRRHMKEASSRETHK
Ga0209180_1008676833300027846Vadose Zone SoilIVRMIWLFLILALSAVSVSLVGLATYLRVRRHMKEASSRETHGKD
Ga0209701_1007267833300027862Vadose Zone SoilMIWLFLILALSAVSVSLVGLATYLRVRRHMKESSSRETHGKD
Ga0209701_1008588423300027862Vadose Zone SoilMIWLFLILALSTVAVSLVGLAAYLRVRSHMKGSSRETHGKD
Ga0209068_1048631413300027894WatershedsMIWLFLILGLSTVAVFLVGIAAYLRVRRHMKEASSREGHGKE
Ga0209583_1002148023300027910WatershedsMIWLFLILALSTVAVSLVGLAAYLRVRGHMKDGTRKDTHEKD
Ga0209583_1068549223300027910WatershedsMIWLFLILALSTVAVFLVGLAAYLRVRRHMKEAASKNGPGGE
Ga0209069_1020144723300027915WatershedsMVRMIWLFLILALSTVAVFLVGLAAYLRVRRHMKEAASKNGPGGE
Ga0209069_1026933213300027915WatershedsMIWLFLILALSTVAVSLVGLAAYLRVRGHMKDGASKETHEKD
Ga0209069_1066903723300027915WatershedsMIWMFLILALSTVAVSLVGLAAYLRVRQHMKDAASRESPGKD
Ga0209526_1003208033300028047Forest SoilMIWLFLILALSTVAVLLVGIAAYLRVRRHAKEASGEAHSKD
Ga0209526_1009021723300028047Forest SoilMIWLFLILALSTVAVLLVGIAAYLRVRRHVKEASGEAHGKD
Ga0307312_1024832633300028828SoilMIWLFLILALSAVSVSLVGLATYLRIRRHMKEASSRETHGKD
Ga0170824_10693068423300031231Forest SoilMIWLFLILALSTVSVSLVALAAYLRVRRHMKETPSRETHD
Ga0170820_1503900223300031446Forest SoilMIWLFLILALSTIAVALVGLAAYLRVRGHMKDGTPKETHEKD
Ga0170818_11480913623300031474Forest SoilMIWLFLILALSTVAVSLVGLAAYLRVRGHMKDGTPKETHEKD
Ga0307469_1014207813300031720Hardwood Forest SoilMIWLFLILALSTVAVSLVGLAAYLRVRSHLKDGSSREPHGKD
Ga0307469_1028114013300031720Hardwood Forest SoilMIWLFLILALSTVAVSLVGLAAYLRVRSHMKEGSSKETHGKD
Ga0307473_1084976123300031820Hardwood Forest SoilMIWLFLILALSTVAVFLVGLAAYLRVRRHMKEAASRESPGKE
Ga0307479_1005615543300031962Hardwood Forest SoilMFLILALSTVAVSLVGLAAYLRVRQHMKDAASRETPGKD
Ga0307471_10250166313300032180Hardwood Forest SoilMIWLFLILALSTVAVLLVGIAAYLRVRRHVKEAASGEAHGKD
Ga0335085_1001159643300032770SoilMIWLFLILALSTVAVSLVGLAAYLRVRSHMKESSSRETHSKE
Ga0335080_1163413723300032828SoilMIWLFLILALSTVAVSLVGLAAYLRVRSHMKESASRETHGKE
Ga0335070_1076673613300032829SoilMIWLFLILALSTVAVSLVGLAAYLRVRSHMKDGSPRDPHGKD
Ga0370501_0020207_222_3503300034195Untreated Peat SoilMIWLFLILALSTVAVSLVGLAAYLRVRSHLKDGSSRETHGKD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.