NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F090793

Metagenome / Metatranscriptome Family F090793

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F090793
Family Type Metagenome / Metatranscriptome
Number of Sequences 108
Average Sequence Length 44 residues
Representative Sequence ARQHTLIVERGVSFAAFDERGRPLRTAYASNIFAPQARYLIDIR
Number of Associated Samples 103
Number of Associated Scaffolds 108

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 95.37 %
% of genes from short scaffolds (< 2000 bps) 91.67 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction Yes
3D model pTM-score0.29

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.296 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(7.407 % of family members)
Environment Ontology (ENVO) Unclassified
(31.481 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(48.148 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 5.56%    Coil/Unstructured: 94.44%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.29
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 108 Family Scaffolds
PF03548LolA 82.41
PF00275EPSP_synthase 2.78
PF00263Secretin 1.85
PF02201SWIB 0.93
PF00152tRNA-synt_2 0.93
PF13432TPR_16 0.93
PF07719TPR_2 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 108 Family Scaffolds
COG2834Outer membrane lipoprotein-sorting proteinCell wall/membrane/envelope biogenesis [M] 82.41
COG0017Aspartyl/asparaginyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.93
COG0173Aspartyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.93
COG1190Lysyl-tRNA synthetase, class IITranslation, ribosomal structure and biogenesis [J] 0.93
COG2269Elongation factor P--beta-lysine ligase (EF-P beta-lysylation pathway)Translation, ribosomal structure and biogenesis [J] 0.93
COG5531DNA-binding SWIB/MDM2 domainChromatin structure and dynamics [B] 0.93

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.30 %
UnclassifiedrootN/A3.70 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908041|P3_CLC_ConsensusfromContig21442All Organisms → cellular organisms → Bacteria → Acidobacteria934Open in IMG/M
2166559005|cont_contig51230Not Available855Open in IMG/M
3300000893|AP72_2010_repI_A001DRAFT_1084678All Organisms → cellular organisms → Bacteria → Acidobacteria501Open in IMG/M
3300000956|JGI10216J12902_124243342All Organisms → cellular organisms → Bacteria → Acidobacteria582Open in IMG/M
3300001686|C688J18823_11003147All Organisms → cellular organisms → Bacteria → Acidobacteria529Open in IMG/M
3300004153|Ga0063455_101562759All Organisms → cellular organisms → Bacteria → Acidobacteria518Open in IMG/M
3300005093|Ga0062594_103131425All Organisms → cellular organisms → Bacteria → Acidobacteria518Open in IMG/M
3300005293|Ga0065715_10371600All Organisms → cellular organisms → Bacteria → Acidobacteria920Open in IMG/M
3300005332|Ga0066388_105979447All Organisms → cellular organisms → Bacteria → Acidobacteria615Open in IMG/M
3300005339|Ga0070660_100036466All Organisms → cellular organisms → Bacteria3725Open in IMG/M
3300005367|Ga0070667_100273147All Organisms → cellular organisms → Bacteria1516Open in IMG/M
3300005434|Ga0070709_11009771All Organisms → cellular organisms → Bacteria → Acidobacteria662Open in IMG/M
3300005436|Ga0070713_102131755All Organisms → cellular organisms → Bacteria → Acidobacteria543Open in IMG/M
3300005526|Ga0073909_10180900All Organisms → cellular organisms → Bacteria → Acidobacteria900Open in IMG/M
3300005555|Ga0066692_10113684All Organisms → cellular organisms → Bacteria1623Open in IMG/M
3300005563|Ga0068855_101965157All Organisms → cellular organisms → Bacteria → Acidobacteria591Open in IMG/M
3300005569|Ga0066705_10604891All Organisms → cellular organisms → Bacteria → Acidobacteria672Open in IMG/M
3300005713|Ga0066905_100498694All Organisms → cellular organisms → Bacteria → Acidobacteria1012Open in IMG/M
3300005764|Ga0066903_100156637All Organisms → cellular organisms → Bacteria3289Open in IMG/M
3300005921|Ga0070766_10765536All Organisms → cellular organisms → Bacteria → Acidobacteria656Open in IMG/M
3300006032|Ga0066696_10124714All Organisms → cellular organisms → Bacteria1579Open in IMG/M
3300006032|Ga0066696_10211355All Organisms → cellular organisms → Bacteria1242Open in IMG/M
3300006047|Ga0075024_100511867All Organisms → cellular organisms → Bacteria → Acidobacteria631Open in IMG/M
3300006049|Ga0075417_10143688All Organisms → cellular organisms → Bacteria1107Open in IMG/M
3300006173|Ga0070716_100406839All Organisms → cellular organisms → Bacteria → Acidobacteria980Open in IMG/M
3300006237|Ga0097621_101343417All Organisms → cellular organisms → Bacteria → Acidobacteria676Open in IMG/M
3300006354|Ga0075021_10926992All Organisms → cellular organisms → Bacteria → Acidobacteria566Open in IMG/M
3300006854|Ga0075425_101055777All Organisms → cellular organisms → Bacteria → Acidobacteria926Open in IMG/M
3300006871|Ga0075434_101706394All Organisms → cellular organisms → Bacteria → Acidobacteria637Open in IMG/M
3300006881|Ga0068865_101530097All Organisms → cellular organisms → Bacteria → Acidobacteria598Open in IMG/M
3300006904|Ga0075424_100749321All Organisms → cellular organisms → Bacteria1042Open in IMG/M
3300006904|Ga0075424_101121940All Organisms → cellular organisms → Bacteria → Acidobacteria838Open in IMG/M
3300006914|Ga0075436_100342017All Organisms → cellular organisms → Bacteria1077Open in IMG/M
3300009012|Ga0066710_101450012All Organisms → cellular organisms → Bacteria → Acidobacteria1062Open in IMG/M
3300009012|Ga0066710_103863800All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium562Open in IMG/M
3300009093|Ga0105240_11587183All Organisms → cellular organisms → Bacteria → Acidobacteria685Open in IMG/M
3300009098|Ga0105245_12393301All Organisms → cellular organisms → Bacteria → Acidobacteria582Open in IMG/M
3300009101|Ga0105247_10645250All Organisms → cellular organisms → Bacteria → Acidobacteria790Open in IMG/M
3300009143|Ga0099792_11134993All Organisms → cellular organisms → Bacteria → Acidobacteria528Open in IMG/M
3300009156|Ga0111538_12439879All Organisms → cellular organisms → Bacteria → Acidobacteria656Open in IMG/M
3300009553|Ga0105249_12938538All Organisms → cellular organisms → Bacteria → Acidobacteria547Open in IMG/M
3300009553|Ga0105249_13530305All Organisms → cellular organisms → Bacteria → Acidobacteria504Open in IMG/M
3300010048|Ga0126373_11562472All Organisms → cellular organisms → Bacteria → Acidobacteria725Open in IMG/M
3300010321|Ga0134067_10238889All Organisms → cellular organisms → Bacteria → Acidobacteria681Open in IMG/M
3300010401|Ga0134121_10538007All Organisms → cellular organisms → Bacteria → Acidobacteria1082Open in IMG/M
3300011269|Ga0137392_10431236All Organisms → cellular organisms → Bacteria → Acidobacteria1095Open in IMG/M
3300012199|Ga0137383_11124533All Organisms → cellular organisms → Bacteria → Acidobacteria568Open in IMG/M
3300012212|Ga0150985_117315650All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300012350|Ga0137372_10501576All Organisms → cellular organisms → Bacteria → Acidobacteria903Open in IMG/M
3300012358|Ga0137368_10302774All Organisms → cellular organisms → Bacteria → Acidobacteria1080Open in IMG/M
3300012908|Ga0157286_10316199Not Available577Open in IMG/M
3300012930|Ga0137407_11776539All Organisms → cellular organisms → Bacteria → Acidobacteria588Open in IMG/M
3300012955|Ga0164298_10936873All Organisms → cellular organisms → Bacteria → Acidobacteria634Open in IMG/M
3300012971|Ga0126369_10021499All Organisms → cellular organisms → Bacteria → Acidobacteria5176Open in IMG/M
3300013297|Ga0157378_10616788All Organisms → cellular organisms → Bacteria → Acidobacteria1097Open in IMG/M
3300013306|Ga0163162_10084612All Organisms → cellular organisms → Bacteria → Acidobacteria3248Open in IMG/M
3300014150|Ga0134081_10096564All Organisms → cellular organisms → Bacteria → Acidobacteria927Open in IMG/M
3300015371|Ga0132258_11971689All Organisms → cellular organisms → Bacteria → Acidobacteria1469Open in IMG/M
3300015372|Ga0132256_102482917All Organisms → cellular organisms → Bacteria → Acidobacteria620Open in IMG/M
3300015374|Ga0132255_103668266All Organisms → cellular organisms → Bacteria → Acidobacteria653Open in IMG/M
3300018028|Ga0184608_10470713All Organisms → cellular organisms → Bacteria → Acidobacteria539Open in IMG/M
3300018060|Ga0187765_11247563All Organisms → cellular organisms → Bacteria → Acidobacteria524Open in IMG/M
3300018468|Ga0066662_10900568All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes868Open in IMG/M
3300018482|Ga0066669_10156480All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1685Open in IMG/M
3300019377|Ga0190264_11724943All Organisms → cellular organisms → Bacteria → Acidobacteria559Open in IMG/M
3300024182|Ga0247669_1064298All Organisms → cellular organisms → Bacteria → Acidobacteria611Open in IMG/M
3300025167|Ga0209642_10305862All Organisms → cellular organisms → Bacteria → Acidobacteria903Open in IMG/M
3300025315|Ga0207697_10168933All Organisms → cellular organisms → Bacteria → Acidobacteria956Open in IMG/M
3300025903|Ga0207680_10125065All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis1687Open in IMG/M
3300025905|Ga0207685_10676868All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300025908|Ga0207643_11123013All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300025915|Ga0207693_10660928All Organisms → cellular organisms → Bacteria811Open in IMG/M
3300025921|Ga0207652_10473572All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis1128Open in IMG/M
3300025927|Ga0207687_10275302All Organisms → cellular organisms → Bacteria1347Open in IMG/M
3300025928|Ga0207700_11339905All Organisms → cellular organisms → Bacteria → Acidobacteria637Open in IMG/M
3300025935|Ga0207709_11761624All Organisms → cellular organisms → Bacteria → Acidobacteria515Open in IMG/M
3300025937|Ga0207669_10053030All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis2440Open in IMG/M
3300025939|Ga0207665_10886157All Organisms → cellular organisms → Bacteria → Acidobacteria707Open in IMG/M
3300025940|Ga0207691_10190987All Organisms → cellular organisms → Bacteria → Acidobacteria1786Open in IMG/M
3300025942|Ga0207689_11620894All Organisms → cellular organisms → Bacteria → Acidobacteria538Open in IMG/M
3300026041|Ga0207639_10851437All Organisms → cellular organisms → Bacteria → Acidobacteria851Open in IMG/M
3300026118|Ga0207675_101077389All Organisms → cellular organisms → Bacteria → Acidobacteria823Open in IMG/M
3300026550|Ga0209474_10287088All Organisms → cellular organisms → Bacteria → Acidobacteria983Open in IMG/M
3300027633|Ga0208988_1145046All Organisms → cellular organisms → Bacteria → Acidobacteria573Open in IMG/M
3300027835|Ga0209515_10060051All Organisms → cellular organisms → Bacteria → Acidobacteria2819Open in IMG/M
3300027873|Ga0209814_10465857All Organisms → cellular organisms → Bacteria → Acidobacteria558Open in IMG/M
3300027874|Ga0209465_10339139All Organisms → cellular organisms → Bacteria → Acidobacteria753Open in IMG/M
3300028379|Ga0268266_10036642All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis4176Open in IMG/M
3300028596|Ga0247821_10859249All Organisms → cellular organisms → Bacteria → Acidobacteria601Open in IMG/M
3300028784|Ga0307282_10469079All Organisms → cellular organisms → Bacteria → Acidobacteria611Open in IMG/M
3300028819|Ga0307296_10279131All Organisms → cellular organisms → Bacteria → Acidobacteria910Open in IMG/M
3300028828|Ga0307312_11070430All Organisms → cellular organisms → Bacteria → Acidobacteria534Open in IMG/M
3300028884|Ga0307308_10495621All Organisms → cellular organisms → Bacteria → Acidobacteria586Open in IMG/M
3300029636|Ga0222749_10481565All Organisms → cellular organisms → Bacteria → Acidobacteria669Open in IMG/M
3300031561|Ga0318528_10813726All Organisms → cellular organisms → Bacteria → Acidobacteria500Open in IMG/M
3300031720|Ga0307469_10468119All Organisms → cellular organisms → Bacteria → Acidobacteria1096Open in IMG/M
3300031720|Ga0307469_11442985All Organisms → cellular organisms → Bacteria → Acidobacteria657Open in IMG/M
3300031740|Ga0307468_101225868All Organisms → cellular organisms → Bacteria → Acidobacteria678Open in IMG/M
3300032003|Ga0310897_10357817All Organisms → cellular organisms → Bacteria → Acidobacteria681Open in IMG/M
3300032009|Ga0318563_10340816All Organisms → cellular organisms → Bacteria → Acidobacteria811Open in IMG/M
3300032180|Ga0307471_102066111All Organisms → cellular organisms → Bacteria → Acidobacteria716Open in IMG/M
3300032954|Ga0335083_11076238All Organisms → cellular organisms → Bacteria → Acidobacteria629Open in IMG/M
3300033480|Ga0316620_11336548All Organisms → cellular organisms → Bacteria → Acidobacteria705Open in IMG/M
3300033486|Ga0316624_10247536All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1413Open in IMG/M
3300034257|Ga0370495_0301018All Organisms → cellular organisms → Bacteria → Acidobacteria532Open in IMG/M
3300034820|Ga0373959_0006982All Organisms → cellular organisms → Bacteria → Acidobacteria1890Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.41%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere7.41%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.48%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.56%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.70%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.70%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.70%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.78%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.85%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.85%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.85%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.85%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.85%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.85%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.85%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.93%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.93%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.93%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.93%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.93%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.93%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.93%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.93%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.93%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.93%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.93%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.93%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.93%
SimulatedEngineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908041Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3EnvironmentalOpen in IMG/M
2166559005Simulated microbial communities from Lyon, FranceEngineeredOpen in IMG/M
3300000893Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001EnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012906Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300024182Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10EnvironmentalOpen in IMG/M
3300025167Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300027633Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027835Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW60B uncontaminated upgradient, 5.4 m (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028596Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033480Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_BEnvironmentalOpen in IMG/M
3300033486Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_AEnvironmentalOpen in IMG/M
3300034257Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_17EnvironmentalOpen in IMG/M
3300034820Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
P3_CLC_010946402124908041SoilRSHTLIVERGVSFAAFDGDGRPLRAGYAANLFAPQPRYLVRP
cont_0230.000037902166559005SimulatedHTLIVERGVSFAAFDDHGTALLTAYASNIYGPQARYLIDSRYR
AP72_2010_repI_A001DRAFT_108467823300000893Forest SoilGHVVANRRHTLIVERGVSFVAFDAGGAPIHTAYRANIFAPQPRFLCYR*
JGI10216J12902_12424334223300000956SoilFGHVIAARQHTLIVERGVSFVTFDERGKPISTVYVSNIFAPQRRFLLR*
C688J18823_1100314713300001686SoilVERGISFAAFDQYGGTIRSAYRSNIYAPQARYLIDISPLR*
Ga0063455_10156275913300004153SoilAHRHTLIVERGISFVAFDDHGQPLRTVYLANIFAPEPRYIASIRQ*
Ga0062594_10313142513300005093SoilVAGRHHALIVERGISFAALDRTGRAIRTAYAANIFSAQPRYLIRTGR*
Ga0065715_1037160023300005293Miscanthus RhizosphereVAARQHTLIVERGVSFVAFDASGRPLRSAYASNIFAPQPRYLVRLAE*
Ga0066388_10597944713300005332Tropical Forest SoilIVERGVSFAAFDAVGRPMQTVYASNIFAPQPRYLVSIAE*
Ga0070660_10003646613300005339Corn RhizosphereRQHTLIVERGLSFAAFDDRGRALRVAYAANLFAPQPRYLIHER*
Ga0070667_10027314713300005367Switchgrass RhizosphereNRRHTLIVERGISFAAFDDRGAALRTEYASNIYAPQPRYLIDSRSR*
Ga0070709_1100977123300005434Corn, Switchgrass And Miscanthus RhizosphereFGQVVADRRHALIVERGISLVVLDSNGRALRTVYASNIFAPQPRYLVR*
Ga0070713_10213175523300005436Corn, Switchgrass And Miscanthus RhizosphereGHVVANRQHTLIVERGISFAAFDDRGAVLRTEYASNIYAPQPRYLIDSRYR*
Ga0073909_1018090013300005526Surface SoilERGVSFAALDRTGRAIRTAYAANIFSAQPRYLIRTGR*
Ga0066692_1011368433300005555SoilERGVSFAAFDATGRDLRVGYSASVFAPQPRYLVR*
Ga0068855_10196515723300005563Corn RhizosphereIVERGLSFAAFDDRGRPIRTAYAANLFAPQPRFLVRAP*
Ga0066705_1060489113300005569SoilHRHTLIVERGISFVAFDDQGRAILTAYRSNIFAPQRRYLIEPQR*
Ga0066905_10049869413300005713Tropical Forest SoilVIAARQHTLIVERGISFAAFDDRGQPIRTAYAANIFAPQARFRVAHR*
Ga0066903_10015663713300005764Tropical Forest SoilAARRHTLIVERGLSFAAFDERGRALTTAYVGNIFAPEPRYLVRALQSPADAR*
Ga0070766_1076553613300005921SoilLIVERGISFVAFDASGVPIRTAYAAGIFAPLPRYIVERR*
Ga0066696_1012471433300006032SoilHHTLIVERGVSFAAFDDHGVAVTTAYASNIFAPQPRYLVRFAAP*
Ga0066696_1021135533300006032SoilLIVERGVSFAAFDAAGRPLRTAYASNIFAPQPRYLVSTNVAVQ*
Ga0075024_10051186723300006047WatershedsGISFAAFDDLGTAVRTAYASNIFAPQARYLIDMAARRP*
Ga0075417_1014368833300006049Populus RhizosphereVERGVSFVAFDRSGLALRTAYAANIFAPQPRYLIRVGNVKVER*
Ga0070716_10040683913300006173Corn, Switchgrass And Miscanthus RhizosphereHTLIVERGVSFAAFDAGGRPVRTAYASNIFAPQPRYLVSAAAAPR*
Ga0097621_10134341713300006237Miscanthus RhizosphereVVAARQHTLIVERGASFVAFDGWGRALRTAYEGNIFAAQPRYLIKIARGIVDP*
Ga0075021_1092699223300006354WatershedsAHQHTLIVERGVSFASFDERGAAIRTAYASNIYAPQARYLIANRDR*
Ga0075425_10105577713300006854Populus RhizosphereQHTLIVERGISFAAFDDRGAALRTEYASNIYAPQPRYLIDSRSR*
Ga0075434_10170639423300006871Populus RhizosphereIVERGVSFAALDHTGRAMRTAYAANIFSPQPRYLIRTGNVKVE*
Ga0068865_10153009713300006881Miscanthus RhizosphereAHHHTLIVERGVSFVAFDSSGRAIRMAYASNIFAPQARYLIRSR*
Ga0075424_10074932113300006904Populus RhizosphereVADRTHTLIVERGVSFAAFNDHGQPIRTAYAANIFAPQPRYLCYR*
Ga0075424_10112194013300006904Populus RhizosphereTLIVERGVSFAAFDRGGQPLRTAYASNIFAPQPRYLVSTRVESQ*
Ga0075436_10034201713300006914Populus RhizosphereVIAARQHTLIVERGVSFVAFDDRGRPLRTAYFANLFAPERRYLIRAF*
Ga0066710_10145001213300009012Grasslands SoilARRRHTLIVERGVSFTAFDRAGRSIRTAYAANIFAPQPRYLIREPAKP
Ga0066710_10386380023300009012Grasslands SoilVVAGRRHTLIVERGVSFAAFDESGKTQRTAYASNIFAPQPRYLVDIRR
Ga0105240_1158718313300009093Corn RhizosphereERGISFAAFDDRGAALRTEYASNIYAPQPRYLIDSRYR*
Ga0105245_1239330123300009098Miscanthus RhizosphereGHVIAAHQHTLIVERGVSFAAFDDGGRPLRTAYASNIFAPQARYLIDIR*
Ga0105247_1064525013300009101Switchgrass RhizosphereIVERGISFAAFDDRGAALRTEYASNIYAPQPRYLIDSRSR*
Ga0099792_1113499313300009143Vadose Zone SoilSFVAFGESGQALTTAYASNIFAPQARYLVSIARP*
Ga0111538_1243987913300009156Populus RhizosphereHTLILERGISFVAFDAAGSPLNTAYAANLFAPETRYLIKLTHPGP*
Ga0105249_1293853823300009553Switchgrass RhizosphereGHVIAARQHALIVERGVSFVAFDDRGTATRTAYASNIFAPQARYLIDIARQ*
Ga0105249_1353030513300009553Switchgrass RhizosphereTLIMERGVSLVAFDQSGRSIETGYASGIFAPQPRYLCYR*
Ga0126373_1156247213300010048Tropical Forest SoilIVERGVSFVAFDAQGRAIRTAYDANVFAAQTRYVLAPG*
Ga0134067_1023888913300010321Grasslands SoilISFVAFDDQGRAILTAYRSNIFAPQRRYLIEPQR*
Ga0134121_1053800713300010401Terrestrial SoilVGRRHALIVERGVSFVAFDRTGQPLRTVYQANIFAPEPRYLVRGR*
Ga0137392_1043123633300011269Vadose Zone SoilAARQHTLIVERGVSFAAFDAGGHALTTAYASNIFAPQARYLVSIAPP*
Ga0137383_1112453313300012199Vadose Zone SoilIVERGVSFVAFDANGQPSRTAYRSNIFAPQPRYLIRRTDGAP*
Ga0150985_11731565023300012212Avena Fatua RhizosphereAHRHTLIVERGISFVAFDAHGVPIRTAYRSNIFAPQSRYLIDTGQ*
Ga0137372_1050157613300012350Vadose Zone SoilMGFGHVIAGRQHTLIVDRGVSFVAFDDRGKPICSAYASYIFAPQRRFIVLR*
Ga0137368_1030277433300012358Vadose Zone SoilIAGRQHTLIVERGVSFVAFDERGKPIRTAYSSNIFAPQRRFLLR*
Ga0157295_1027561513300012906SoilHVIAARHHALIVERGVSLVAFDQSGRSIESGYAAGIFAPQPRYLCYR*
Ga0157286_1031619913300012908SoilQHTLIIERGVSFVAFDAAGQPMRTAYAANIFAPQARYVIR*
Ga0137407_1177653913300012930Vadose Zone SoilVSFASFDDHGSAIRTAYASNIYAPQARYLIDNRDR*
Ga0164298_1093687313300012955SoilHVIAAHQHTLIIERGISFAAFDQRGGTIQSAYRSNIYAPQARYLIDIAAVR*
Ga0126369_1002149953300012971Tropical Forest SoilLIVERGLSLAAFDERGRAQTTAYAGNIFAPEPRYLVRLAR*
Ga0157378_1061678813300013297Miscanthus RhizosphereTLIVERGVSFVAFDASGRPLRSGYVAGIFAPQPRYLIKMERGIVDP*
Ga0163162_1008461243300013306Switchgrass RhizosphereIVERGISFAALDDRGAALRTEYASNIYAPQPRYLIDSRSR*
Ga0134081_1009656413300014150Grasslands SoilHVVAAHRHTLIVERGISFVAFDDQGRAILTAYRSNIFAPQRRYLIEPQR*
Ga0132258_1197168913300015371Arabidopsis RhizosphereTLIVERGVSFATFDATGEPLTRAYFAGIFARQARYLVGAAW*
Ga0132256_10248291723300015372Arabidopsis RhizosphereHTLIVERGVSFAAFDDRGQPIRTAYAANIFAPQPRFVVRR*
Ga0132255_10366826623300015374Arabidopsis RhizosphereERGVSFVGFDDRGQPIRTAYAANLFSPQPRYVVGR*
Ga0184608_1047071313300018028Groundwater SedimentRGVSFAAFDSSGRAVRMAYASNIFAPQARYLIRARP
Ga0187765_1124756323300018060Tropical PeatlandVERGVSFVAFEASGLAIHTTYRSNIFAPQPRFLCYR
Ga0066662_1090056813300018468Grasslands SoilTLIVERGVSFATFDRDGRPTRTTYVANIFARQPRFLVRR
Ga0066669_1015648023300018482Grasslands SoilLIVERGVSFAAFDESGKTQRTAYASNIFAPQPRYLVDIRR
Ga0190264_1172494313300019377SoilRHHALIVERGVSFVAIDSSGRAVHTAYAAGIFAPEPRYLVQLRP
Ga0247669_106429823300024182SoilQHTLIVERGVSFVAFDAAGRPLRTTYASNIFAPQPRYLVRIAE
Ga0209642_1030586213300025167SoilVIAGRRHTLIVERGVSFVAFDDQGHSIRTAYASNIFAPQPRFLVQPR
Ga0207697_1016893333300025315Corn, Switchgrass And Miscanthus RhizosphereAHRHTLIVERGVSFAAFDEAGVPLRTAYASNIFAPQARYLIDIAP
Ga0207688_1036270513300025901Corn, Switchgrass And Miscanthus RhizosphereGHVIAARRHTLIVERGVSFAAFDERGAPLHTAYTANIFAPQPRYLIDIASGIRHDP
Ga0207680_1012506533300025903Switchgrass RhizosphereGHVGANRQHTLIVERGISFAAFDDRGAALRTEYASNIYAPQPRYLIDSRYR
Ga0207685_1067686823300025905Corn, Switchgrass And Miscanthus RhizosphereLAAHHHTLIVERGVSFAAFDAAGRPLRTAYASSIFAPQPRYLVSTRIESQ
Ga0207643_1112301313300025908Miscanthus RhizosphereERGVSFAALDSAGRAIRTAYASNIFAPQARYLIRTRQ
Ga0207693_1066092823300025915Corn, Switchgrass And Miscanthus RhizosphereMDAVSIQDIVERGVSFVAFDRTGQPLRTVYQANIFAPEPRYLVRGR
Ga0207652_1047357233300025921Corn RhizosphereRQHTLIVERGLSFAAFDDRGRPIRTAYAANLFAPQPRFLVRAP
Ga0207687_1027530213300025927Miscanthus RhizosphereVIVARQHTLIVERGVSFAAFDEHGAAIKTAYASSIYAPQARYLIDSGR
Ga0207700_1133990523300025928Corn, Switchgrass And Miscanthus RhizosphereGHVVANRQHTLIVERGISFAAFDDRGAVLRTEYASNIYAPQPRYLIDSRYR
Ga0207709_1176162413300025935Miscanthus RhizosphereGHVVAARQHTLIVERGASFVAFDGSGRPLRTGYDGNIFAAQPRYLIKIARGIVDP
Ga0207669_1005303013300025937Miscanthus RhizosphereLIVERGVSFAAFDERGVPLRTAYASNIFAPQARYLIDIR
Ga0207665_1088615713300025939Corn, Switchgrass And Miscanthus RhizosphereARRHTLIVERGVSFAAFDAGGRPVRTAYASNIFAPQPRYLVSAAAAPR
Ga0207691_1019098733300025940Miscanthus RhizosphereRHTLIVERGVSFAAFDERGTPLRTAYAANIFAPQPRYLIDIASGIRHDP
Ga0207689_1162089413300025942Miscanthus RhizosphereRGVSFAAFDDGGRPLRTAYASNIFAPQARYLIDIR
Ga0207639_1085143713300026041Corn RhizosphereTLIVERSISFAAFDDRGAALRTEYASNIYAPQPRYLIDSRSR
Ga0207675_10107738913300026118Switchgrass RhizosphereIVERGVSFAAFDSSGRAIRTAYASNIFAPQARHLIRTRH
Ga0209474_1028708813300026550SoilRHHTLIVERGVSFAAFDAAGRPLRTAYASNIFAPQPRYLVSTNVAVQ
Ga0208988_114504613300027633Forest SoilHRHTLIVERGVSFAAFDSSGRAVRMAYASNIFAPQPRYLIRARQ
Ga0209515_1006005113300027835GroundwaterRHHTLIVERGVSFVAFDDSGRARRTGYAANIFAPQPRYLVRTAGGSG
Ga0209814_1046585713300027873Populus RhizosphereIVERGVSFVAFDRSGLALRTAYAANIFAPQPRYLIRVGNVKVER
Ga0209465_1033913923300027874Tropical Forest SoilQHTLIVERGISFAAFDDRGTALRTDYASNIYAPQPRYLIDSRHW
Ga0268266_1003664253300028379Switchgrass RhizosphereHTLIVERGISFAAFDDRGAALRTEYASNIYAPQPRYLIDSRSR
Ga0247821_1085924913300028596SoilHTLIVERGVSFAAFDERGAPLHTAYTANIFAPQPRYLIDIASGIRHDP
Ga0307282_1046907923300028784SoilAHHHTLIVERGVSFAAFDSSGRAVRMAYASNIFAPQPRYLIRTRQ
Ga0307296_1027913123300028819SoilAAHRHTLIVERGVSFAAFDSSGRAVRTAYASNIFAPQPRYLIRARQ
Ga0307312_1107043013300028828SoilQVVAGRRHTLIVERGVSFAAFDRTGRPIRMAYAANIFAPQPRYLIREPAPP
Ga0307308_1049562123300028884SoilAHHHALIVERGVSFAAFDADGRAVRLAYSAGLFAPQPRYLIRR
Ga0222749_1048156513300029636SoilLIVERGVSFASFAGDGRALTTAYASSIFAPLERYLIDSRP
Ga0318528_1081372623300031561SoilLIVERGISFVAFDDRGAALRTEYASNIYAPQARYLIDSRYR
Ga0307469_1046811913300031720Hardwood Forest SoilRGVSFVALDNGGRAILTAYESNIFAPQPRYLIDIRP
Ga0307469_1144298513300031720Hardwood Forest SoilARQHTLIVERGVSFAAFDAAGRPLRTAYASSIFAPQPRYLVSTRIESQ
Ga0307468_10122586823300031740Hardwood Forest SoilGRRHTLIVERGVSFAAFDEQGRPLRTAYAANIFAPQPRYLIDIAR
Ga0310897_1035781713300032003SoilIERGVSFVAFDAGGQPIRTAYAANIFAPQPRYLIR
Ga0318563_1034081613300032009SoilGISFVAFDDRGAALRTQYASNIYAPQARYLIDSRYR
Ga0307471_10206611113300032180Hardwood Forest SoilARRHTLIVERGISFAAFDDHGMALRTAYASNIYAPQARYLIGSRYR
Ga0335083_1107623813300032954SoilIVERGVSFVAFDANGTAIHTAYRSNIFAPQPRFLCYR
Ga0316620_1133654823300033480SoilHHHALIVERGVSFAAFDASGRPLRTAYAASLFAPERRYLVSEGRP
Ga0316624_1024753633300033486SoilAHHHALIVERGVSFAAFDASGRPLRTAYAASIFAPERRYLVSEGRP
Ga0370495_0301018_397_5313300034257Untreated Peat SoilARQHTLIVERGVSFAAFDERGRPLRTAYASNIFAPQARYLIDIR
Ga0373959_0006982_1750_18903300034820Rhizosphere SoilAARQHTLIVERGVSFVAFDPSGRPLRTAYRSNIFAPQPRYLVRLAE

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.