NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F090941

Metagenome Family F090941

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F090941
Family Type Metagenome
Number of Sequences 108
Average Sequence Length 48 residues
Representative Sequence MSSVVSPASADEALEMLTAAMGYLAAADATAMTAEEQARCLRVLE
Number of Associated Samples 93
Number of Associated Scaffolds 108

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 99.06 %
% of genes near scaffold ends (potentially truncated) 94.44 %
% of genes from short scaffolds (< 2000 bps) 96.30 %
Associated GOLD sequencing projects 85
AlphaFold2 3D model prediction Yes
3D model pTM-score0.51

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (60.185 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere
(17.593 % of family members)
Environment Ontology (ENVO) Unclassified
(38.889 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(62.963 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 52.05%    β-sheet: 0.00%    Coil/Unstructured: 47.95%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.51
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 108 Family Scaffolds
PF01070FMN_dh 15.74
PF06772LtrA 15.74
PF00196GerE 2.78
PF00248Aldo_ket_red 1.85
PF13191AAA_16 0.93
PF04954SIP 0.93
PF02492cobW 0.93
PF00266Aminotran_5 0.93
PF12680SnoaL_2 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 108 Family Scaffolds
COG0069Glutamate synthase domain 2Amino acid transport and metabolism [E] 15.74
COG1304FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomeraseEnergy production and conversion [C] 15.74
COG4292Low temperature requirement protein LtrA (function unknown)Function unknown [S] 15.74
COG2375NADPH-dependent ferric siderophore reductase, contains FAD-binding and SIP domainsInorganic ion transport and metabolism [P] 0.93

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms60.19 %
UnclassifiedrootN/A39.81 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459010|GIO7OMY01A0PQIAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. ITM-2016-00317512Open in IMG/M
3300004479|Ga0062595_101059188All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia704Open in IMG/M
3300005177|Ga0066690_10514762All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300005177|Ga0066690_11062301Not Available505Open in IMG/M
3300005334|Ga0068869_100158488All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium talmoniae1760Open in IMG/M
3300005434|Ga0070709_10887087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kibdelosporangium → Kibdelosporangium aridum704Open in IMG/M
3300005435|Ga0070714_101747306Not Available607Open in IMG/M
3300005436|Ga0070713_100802355All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia902Open in IMG/M
3300005436|Ga0070713_101301002Not Available704Open in IMG/M
3300005436|Ga0070713_101809442Not Available593Open in IMG/M
3300005437|Ga0070710_10802340Not Available672Open in IMG/M
3300005456|Ga0070678_100981559All Organisms → cellular organisms → Bacteria776Open in IMG/M
3300005471|Ga0070698_101242340Not Available695Open in IMG/M
3300005518|Ga0070699_100002234All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia17495Open in IMG/M
3300005578|Ga0068854_102227019Not Available507Open in IMG/M
3300005614|Ga0068856_101222455Not Available767Open in IMG/M
3300005615|Ga0070702_101823002Not Available509Open in IMG/M
3300005840|Ga0068870_10935980All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales614Open in IMG/M
3300005843|Ga0068860_100312345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium talmoniae1541Open in IMG/M
3300006028|Ga0070717_10883804All Organisms → cellular organisms → Bacteria813Open in IMG/M
3300006028|Ga0070717_11533283Not Available604Open in IMG/M
3300006163|Ga0070715_10117199All Organisms → cellular organisms → Bacteria → Terrabacteria group1264Open in IMG/M
3300006163|Ga0070715_10436784All Organisms → cellular organisms → Bacteria736Open in IMG/M
3300006175|Ga0070712_100671742Not Available881Open in IMG/M
3300006237|Ga0097621_101718422Not Available598Open in IMG/M
3300006755|Ga0079222_10089347All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1582Open in IMG/M
3300006755|Ga0079222_11834826Not Available588Open in IMG/M
3300006854|Ga0075425_102208454Not Available613Open in IMG/M
3300006904|Ga0075424_100321941All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium talmoniae1646Open in IMG/M
3300006954|Ga0079219_10776207All Organisms → cellular organisms → Bacteria → Terrabacteria group747Open in IMG/M
3300009098|Ga0105245_12825718Not Available538Open in IMG/M
3300009101|Ga0105247_10944020Not Available669Open in IMG/M
3300009143|Ga0099792_10373514Not Available866Open in IMG/M
3300009551|Ga0105238_11710819All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300009551|Ga0105238_11955716Not Available620Open in IMG/M
3300010333|Ga0134080_10355140Not Available669Open in IMG/M
3300010358|Ga0126370_11537598Not Available634Open in IMG/M
3300010360|Ga0126372_11160160All Organisms → cellular organisms → Bacteria → Terrabacteria group795Open in IMG/M
3300010366|Ga0126379_13746930Not Available509Open in IMG/M
3300010371|Ga0134125_11297297All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300010396|Ga0134126_11455374All Organisms → cellular organisms → Bacteria756Open in IMG/M
3300010396|Ga0134126_13043733Not Available506Open in IMG/M
3300010397|Ga0134124_11433377All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces717Open in IMG/M
3300010399|Ga0134127_11962884All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300010403|Ga0134123_13228720Not Available525Open in IMG/M
3300012198|Ga0137364_10705404All Organisms → cellular organisms → Bacteria762Open in IMG/M
3300012199|Ga0137383_10421433All Organisms → cellular organisms → Bacteria978Open in IMG/M
3300012200|Ga0137382_10788695All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia683Open in IMG/M
3300012285|Ga0137370_11013027All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300012357|Ga0137384_11357004All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300012359|Ga0137385_10048442All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales3801Open in IMG/M
3300012359|Ga0137385_10170827All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1907Open in IMG/M
3300012361|Ga0137360_11608157All Organisms → cellular organisms → Bacteria → Terrabacteria group555Open in IMG/M
3300012493|Ga0157355_1041305Not Available517Open in IMG/M
3300012515|Ga0157338_1055342Not Available581Open in IMG/M
3300012685|Ga0137397_10163930All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium talmoniae1649Open in IMG/M
3300012925|Ga0137419_11605240Not Available553Open in IMG/M
3300012985|Ga0164308_10967693All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia754Open in IMG/M
3300013100|Ga0157373_11529549Not Available510Open in IMG/M
3300013104|Ga0157370_10731041All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jatrophihabitantales → Jatrophihabitantaceae → Jatrophihabitans → unclassified Jatrophihabitans → Jatrophihabitans sp.902Open in IMG/M
3300013296|Ga0157374_11430865Not Available714Open in IMG/M
3300013306|Ga0163162_12108513All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia647Open in IMG/M
3300013307|Ga0157372_10651011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1227Open in IMG/M
3300013307|Ga0157372_12283837Not Available621Open in IMG/M
3300013307|Ga0157372_12804347All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300013308|Ga0157375_12523983All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300014968|Ga0157379_11091110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia764Open in IMG/M
3300015242|Ga0137412_10159890All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium1814Open in IMG/M
3300015371|Ga0132258_12978326All Organisms → cellular organisms → Bacteria1175Open in IMG/M
3300015374|Ga0132255_102317036All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura819Open in IMG/M
3300016270|Ga0182036_11818807Not Available516Open in IMG/M
3300016294|Ga0182041_10545104All Organisms → cellular organisms → Bacteria → Terrabacteria group1012Open in IMG/M
3300020580|Ga0210403_10466539All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1028Open in IMG/M
3300020582|Ga0210395_10539991Not Available877Open in IMG/M
3300021478|Ga0210402_11355937Not Available638Open in IMG/M
3300021559|Ga0210409_10547827All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1023Open in IMG/M
3300025898|Ga0207692_10145695All Organisms → cellular organisms → Bacteria → Terrabacteria group1351Open in IMG/M
3300025900|Ga0207710_10236938All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia910Open in IMG/M
3300025905|Ga0207685_10822625All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7513Open in IMG/M
3300025912|Ga0207707_11418640Not Available553Open in IMG/M
3300025915|Ga0207693_10998852All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300025916|Ga0207663_10950156All Organisms → cellular organisms → Bacteria688Open in IMG/M
3300025917|Ga0207660_11243457All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300025917|Ga0207660_11304370All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300025926|Ga0207659_11113641All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. ITM-2016-00317679Open in IMG/M
3300025927|Ga0207687_11718772Not Available538Open in IMG/M
3300025928|Ga0207700_11382413Not Available626Open in IMG/M
3300025929|Ga0207664_11532885Not Available588Open in IMG/M
3300025949|Ga0207667_11388206All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia676Open in IMG/M
3300026023|Ga0207677_10955180Not Available775Open in IMG/M
3300026075|Ga0207708_10328264All Organisms → cellular organisms → Bacteria1250Open in IMG/M
3300028380|Ga0268265_12724571Not Available500Open in IMG/M
3300028799|Ga0307284_10492590Not Available503Open in IMG/M
3300030659|Ga0316363_10302522All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300031764|Ga0318535_10240059All Organisms → cellular organisms → Bacteria → Terrabacteria group811Open in IMG/M
3300031794|Ga0318503_10200185All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jatrophihabitantales → Jatrophihabitantaceae → Jatrophihabitans → unclassified Jatrophihabitans → Jatrophihabitans sp.647Open in IMG/M
3300031859|Ga0318527_10330340All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jatrophihabitantales → Jatrophihabitantaceae → Jatrophihabitans → unclassified Jatrophihabitans → Jatrophihabitans sp.650Open in IMG/M
3300031946|Ga0310910_10874346All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jatrophihabitantales → Jatrophihabitantaceae → Jatrophihabitans → unclassified Jatrophihabitans → Jatrophihabitans sp.706Open in IMG/M
3300032025|Ga0318507_10273570All Organisms → cellular organisms → Bacteria → Terrabacteria group734Open in IMG/M
3300032043|Ga0318556_10428612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jatrophihabitantales → Jatrophihabitantaceae → Jatrophihabitans → unclassified Jatrophihabitans → Jatrophihabitans sp.692Open in IMG/M
3300032060|Ga0318505_10198207All Organisms → cellular organisms → Bacteria → Terrabacteria group939Open in IMG/M
3300032770|Ga0335085_11870613Not Available613Open in IMG/M
3300032954|Ga0335083_11322481Not Available554Open in IMG/M
3300032955|Ga0335076_11183460All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300033290|Ga0318519_10266062All Organisms → cellular organisms → Bacteria → Terrabacteria group996Open in IMG/M
3300033290|Ga0318519_10404852All Organisms → cellular organisms → Bacteria → Terrabacteria group813Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere17.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil13.89%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil11.11%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil5.56%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere4.63%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.78%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.78%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.78%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.78%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.85%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.85%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.85%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.85%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.85%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.93%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.93%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.93%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.93%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459010Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!)EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012493Unplanted soil (control) microbial communities from North Carolina - M.Soil.10.yng.090610EnvironmentalOpen in IMG/M
3300012515Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610Host-AssociatedOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300030659Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F62_052138802170459010Grass SoilMSDVMSPTSVREALGMLTSAMGYLASADATAMAAEEQARCLRVLERVTAIGTAARTSVLSAFTS
Ga0062595_10105918823300004479SoilMSSVMPPASADEALEMLTAAMGYLAAADATAMTAAEQARCLRVLERANS
Ga0066690_1051476213300005177SoilMEVSITMNSSVVPPASANQALEMLQSAVRYLAAADPTTMTADEQARCLRVLE
Ga0066690_1106230123300005177SoilMSSVLSPGSADEALEMLTSAMGYLAAADATAMTAEEQARCLRVLER
Ga0068869_10015848823300005334Miscanthus RhizosphereMSGVISPVSTDQALEMLTAALGYLAAADATEMTAEEQARCLKVLERATAIGAAARTSTLSAFTS
Ga0070709_1088708713300005434Corn, Switchgrass And Miscanthus RhizosphereMSSVMSPASADEALEMLTAAMGYLAAADATAMTAEEQARCLRVLERATSVGTA
Ga0070714_10174730623300005435Agricultural SoilMSSVVSPGSADEALEMLTAAMGYLAAADATAMTAEEQARCLRVLERANS
Ga0070713_10080235533300005436Corn, Switchgrass And Miscanthus RhizosphereMSSVMSPASADEALEMLMAAMGYLAAADATAMTAEEQARCLRVLERATSVGTAARTS
Ga0070713_10130100213300005436Corn, Switchgrass And Miscanthus RhizosphereMEVSITMNSRVVPPASAGQALEMLQSAMGYLAAADPAAMTAEEQARCL
Ga0070713_10180944213300005436Corn, Switchgrass And Miscanthus RhizosphereMSSVVSPASTDQALAMLTSAIRYLAAADPAAMTAEEQARCLRVLE
Ga0070710_1080234013300005437Corn, Switchgrass And Miscanthus RhizosphereMSSVMSPASADEALEMLTAAMGYLAAADATAMTAEEQARCLRVLER
Ga0070678_10098155933300005456Miscanthus RhizosphereMSDVMSPTSVDQALEMLTATLGYLAAADATEMTAEEQARCLRVLERAT
Ga0070698_10124234013300005471Corn, Switchgrass And Miscanthus RhizosphereMSSVVSPASTGQALEMLTSAMGYLAAADATAMTAEEQARCLRVLE
Ga0070699_100002234183300005518Corn, Switchgrass And Miscanthus RhizosphereMSSVVSPASTGQALAMLTSAIRYLAAADPAAMTAEEQARCLRVLE
Ga0068854_10222701913300005578Corn RhizosphereMMSTRVVPPASAGQALEMLQSAMGYLAAADPAAMTAEEQARCLRVL
Ga0068856_10122245513300005614Corn RhizosphereMSSVVSPASADEALEMLTAAMGYLAAADATAMTAEEQARCLRVLE
Ga0070702_10182300213300005615Corn, Switchgrass And Miscanthus RhizosphereMSSVVSPGSADEALEMLTAALGYLAAADATAMTAEEQARCLRVLERANS
Ga0068870_1093598013300005840Miscanthus RhizosphereMSSVVSPASADEALEMLTAAMGYLAAADATAMTAEEQARCLRV
Ga0068860_10031234523300005843Switchgrass RhizosphereMSDVMSPVSTDQALEMLTAALGYLAAADATEMTAEEQARCLKVLERATAIGAAARTST
Ga0070717_1088380423300006028Corn, Switchgrass And Miscanthus RhizosphereMSSVVSPASADEALEMLTAAMGYLAAADATAMTAEEQARCLRVLERAT
Ga0070717_1153328313300006028Corn, Switchgrass And Miscanthus RhizosphereMSSVVSPGSADEALEMLTAALGYLAAADATAMTAEEQARCLRVLERAN
Ga0070715_1011719923300006163Corn, Switchgrass And Miscanthus RhizosphereMSSVVSPASADEALEMLTAAMGYLAAADATAMTAEEQARCL
Ga0070715_1043678423300006163Corn, Switchgrass And Miscanthus RhizosphereMSDVMSPASTDQALEMLTAALGYLAAADATAMTAEEQ
Ga0070712_10067174213300006175Corn, Switchgrass And Miscanthus RhizosphereMSSVVSPSSADEALEMLTAAMGYLAAADATAMTAEEQARCLRVLERATSVGTVAR
Ga0097621_10171842213300006237Miscanthus RhizosphereMSSVVSPASADEALEMLRSAMGYLAAADATAMTAEEQARCLQVLEHVTSTGTAARTSVLGAFAHGQ
Ga0079222_1008934733300006755Agricultural SoilMSSVVPPASTDQALAMLTSAIRYLAAADAAAMTAEEQARCLR
Ga0079222_1183482613300006755Agricultural SoilMSSVVSPASADEALEMLTAAMGYLAAADATAMTAEEQARCLRVLERATSVGTA
Ga0075425_10220845413300006854Populus RhizosphereMEVSITMNSSVMPPASADQALEMLQSAVRYLAAADPTTMTADEQARCLRVL
Ga0075424_10032194123300006904Populus RhizosphereMSDVMSPASTDQALEMLTAALGYLAAADATAMTAEE
Ga0079219_1077620723300006954Agricultural SoilMSSVMSPASADEALEMLTAAMGHLAAADATAMTAEEQARCLRVLERATPSTRPTAAR
Ga0105245_1282571813300009098Miscanthus RhizosphereMSDVMSPTSTDQALEMLTAALGYLAAADATEMSAEEQARCLKVLERATAIGAAARTSMLGAFTSGKG
Ga0105247_1094402013300009101Switchgrass RhizosphereMSSVVSPGSADEALEMLTAAMGYLAAADATAITAE
Ga0099792_1037351413300009143Vadose Zone SoilMSSVVPPGSADEALEMLRSAMGYLAAADATAMTAEEQARCLRVLEQATATGTAARTSVLGAFTAGRGY
Ga0105238_1171081923300009551Corn RhizosphereMSDVMSPTSTDQALEMLTAALGYLAAADATEMTAEEQARCLKVLERATAVAAAART
Ga0105238_1195571623300009551Corn RhizosphereMSSVMSPASADEALEMLTAAMGYLAAADATAMTAEEQARCLRV
Ga0134080_1035514023300010333Grasslands SoilMSDVMSPTSTDQALEMLTAALGYLAAADATAMTAEEQARCLKVLERATAIGAAART*
Ga0126370_1153759813300010358Tropical Forest SoilMSDVMSPTSTDQALEMLTAALGYLAAADATAMTAEEQAR
Ga0126372_1116016023300010360Tropical Forest SoilMSSVMSPASADEALEMLTVAMGYLAAADATALTAEEQARCLRVLERTNSVGTAART
Ga0126379_1374693013300010366Tropical Forest SoilMSAVMSPSSTAEALEMLRSAMRYLAAADTTAMAAEEQARCLQ
Ga0134125_1129729723300010371Terrestrial SoilMSDVISPVSTDQALEMLTAALGYLAAADATEMTAEEQARCLKVLERATAIGAAARTSTLS
Ga0134126_1145537413300010396Terrestrial SoilMSSVVSPASADEALEMLTAAMGYLAAADATAMTAEEQARC
Ga0134126_1304373313300010396Terrestrial SoilMSSVMPPGSADEALEMLTTALGYLAAADATAMTAEEQARCLRVLERANS
Ga0134124_1143337713300010397Terrestrial SoilMSSVMSPASADEALEMLMAAMGYLAAADATAMTAEEQARCLRVLERA
Ga0134127_1196288423300010399Terrestrial SoilMSDVMSPTSTDQALEMLTAALGYLAAADAAEMTAEEQ
Ga0134123_1322872013300010403Terrestrial SoilMSSVVSPGSADEALEMLTAALGYLAAADATAMTAEEQARCLRVLERANSVGTAARQV*
Ga0137364_1070540423300012198Vadose Zone SoilMEVSITMNSSVVPPGSAGEALEMLQSAVRYLAAADPTAMTAEEQARCLRV
Ga0137383_1042143313300012199Vadose Zone SoilMSSVLPPGSADEALEMLTSAMGYLAATDATAMTAAEQARCLRVLEQANSTGTAARTSVLGAF
Ga0137382_1078869523300012200Vadose Zone SoilMSSVMSPASADEALEMLTAALGYLAAADATAMTAA
Ga0137370_1101302723300012285Vadose Zone SoilMSDVMSPTSTDQALEMLTAAMGYLAAADATALTAEE
Ga0137384_1135700413300012357Vadose Zone SoilMSDVTSPTSAGEALGMLTSAMGYLASADATAMAAGEQARCLRVLE
Ga0137385_1004844213300012359Vadose Zone SoilMSSVMPPASADEALEMLTAALGYLAAADATAMTAAEQARCLRVLER
Ga0137385_1017082733300012359Vadose Zone SoilMSSVMSPASADEALEMLTAALGYLAAADATAMTAAEQARCLRVLER
Ga0137360_1160815713300012361Vadose Zone SoilMNSTVVPPASADKTLEMLQSAMGYLAAADPSSMTAEEQARCLRVLERATPSRTACFFAGSTTRS*
Ga0157355_104130523300012493Unplanted SoilMSDVMSPTSVDQALEMLTATLGYLAAADATEMTAEEQ
Ga0157338_105534213300012515Arabidopsis RhizosphereMSDVMSPTSVDQALEMLTATLGYLAAADATEMTAEEQARCLR
Ga0137397_1016393013300012685Vadose Zone SoilMSSVVPSGSADEALEMLRSAMGYLAAADATAMTAEEQARCLRVLEQATATGTAAR
Ga0137419_1160524023300012925Vadose Zone SoilMSDVMSPTSTDQALEMLTAALGYLAAADATEMTAEEQARCLKVL
Ga0164308_1096769313300012985SoilMSSVVSPSSADEALEMLTAAMGYLAAADATAMTAEEQARCL
Ga0157373_1152954923300013100Corn RhizosphereMSDVMSPTSTDQALEMLTAALCFLAAAAATEMSAE
Ga0157370_1073104113300013104Corn RhizosphereMSSVMSPASADEALEMLTAAMGYLAAADATAMTAEEQARCLRVLERATSVGT
Ga0157374_1143086523300013296Miscanthus RhizosphereMSSVVSPASADEALEMLTAAMGYLAAADATAMTAEEQ
Ga0163162_1210851323300013306Switchgrass RhizosphereMSSVVSPASADEALEMLTAAMGYLAAADATAMTAEEQARCLR
Ga0157372_1065101133300013307Corn RhizosphereMSSVMSPASADEALEMLTAAMGYLAAADATAMTAEEQARCLRVL
Ga0157372_1228383723300013307Corn RhizosphereMSDVMSPASTDQALEMLMVALGYLAAADATEMTAEEQARCLKVLERATAIGAAARTSALSAF
Ga0157372_1280434723300013307Corn RhizosphereMSDVMSPASTDQALEMLTAALGYLAAADATEMTAEEQARCLKVLERATAVAAA
Ga0157375_1252398323300013308Miscanthus RhizosphereMSDVMSPASTDQALEMLTAALGYLAAADATEMSAEEQARCLKVLERATAI
Ga0157379_1109111013300014968Switchgrass RhizosphereMSSVVSPASADEALEMLTAAMGYLAAADATAMTAEEQARCLRVLEHVTSTGTAARTSVLGAF
Ga0137412_1015989013300015242Vadose Zone SoilMSSVVPPGSADEALEMLRSAMGYLAAADATAMTAE
Ga0132258_1297832623300015371Arabidopsis RhizosphereMSSVVSPGSADEALEMLRSAMGYLAAADATAMTAEEQARCLRVLERATSVGTAART
Ga0132255_10231703613300015374Arabidopsis RhizosphereMSSVVSPGSADEALEMLTAAMGYLAAADATAMTVE
Ga0182036_1181880713300016270SoilMSSVVPPASADQALEMLTVALGYLAEADATAMTAEEQARCLR
Ga0182041_1054510413300016294SoilMSSVVPPASADQALEMLTVALGYLAEADATAMTAEEQARCLRVLERAN
Ga0210403_1046653913300020580SoilMNEMVSPGSADEALDMLRSAIRYLAAADATAMTAQEQARCLRVLEQVNSAGTAARTSVLSAFAS
Ga0210395_1053999113300020582SoilMNEVVSPGSADEALTMLRSAIRYLAAADPTAMTAEEQTRCLQVLEQANSAGTAVAACSEPRS
Ga0210402_1056104113300021478SoilMEVSITMSSSVVPPASAGQALEMLQSAVRYLAAADPTA
Ga0210402_1135593713300021478SoilMNEMVSPGSAGEALDMLRSAIRYLAAADATAMTAQEQARCLRV
Ga0210409_1007973843300021559SoilMEVSITMNSSVVPPASADQALEMLQSAMGYLAAADPTAMTA
Ga0210409_1054782733300021559SoilMNEVVSPDSADEALEMLTSAMGYLAAADATAMTAGEQARCLRVLERVNSAG
Ga0207692_1014569523300025898Corn, Switchgrass And Miscanthus RhizosphereMSSVVSPASADEALEMLTAAMGYLAVADATAMTAEEQARCLRVLERAT
Ga0207710_1023693813300025900Switchgrass RhizosphereMSSVMSPASADEALEMLTAAMGYLAAADATAMTAEEQ
Ga0207685_1082262523300025905Corn, Switchgrass And Miscanthus RhizosphereMEVSITMNSRVVPPASADQALEMLTSAMGYLAAADPAAMTAEEQARCLRVL
Ga0207707_1141864013300025912Corn RhizosphereMSSVVSPGSADEALEMLTAAMGYLAAADATAMTAEEQARCLRVLERANSV
Ga0207693_1099885223300025915Corn, Switchgrass And Miscanthus RhizosphereMSSVVSPSSADEALEMLTAAMGYLAAADATAMTAEQQARCL
Ga0207663_1095015623300025916Corn, Switchgrass And Miscanthus RhizosphereMSDVMSPASTDQALEMLMVALGYLAAADATEMTAEEQARCLKVLERATAIGAAARTSTL
Ga0207660_1124345723300025917Corn RhizosphereMSGVVSPSSAAEALEMLRSAMAYLAAADATAMTAEEQAR
Ga0207660_1130437023300025917Corn RhizosphereMSDVMSPTSVDQALEMLTATLGYLAAADATEMTAEEQARCLRVL
Ga0207659_1111364113300025926Miscanthus RhizosphereMSDVMSPASTDQALEMLMVALGYLAAADATEMTAEEQARCLRVLERATAISAAARTSTLS
Ga0207687_1171877223300025927Miscanthus RhizosphereMSDVMSPTSTDQALEMLTAALGYLAAADATEMSAEEQARCLKVLER
Ga0207700_1138241313300025928Corn, Switchgrass And Miscanthus RhizosphereMSSVVSPASADEALEMLRSAMGYLAAADATAMTAEEQARCLRVLEHVTSTGTAARTSVLGAFAHGQG
Ga0207664_1153288513300025929Agricultural SoilMSSVVSPGSADEALEMLTAAMGYLAAADATAMTAEEQARCLRVLERA
Ga0207667_1138820613300025949Corn RhizosphereMSSVVSPASADEALEMLTAAMGYLAAADATAMTAEEQARCLRVLERATS
Ga0207677_1095518013300026023Miscanthus RhizosphereMSSVVSPASADEALEMLTAAMGYLAVADATAMTAEEQARCLRVLERATSVGTAARTSVLG
Ga0207708_1032826413300026075Corn, Switchgrass And Miscanthus RhizosphereMNEVVPPASAGEALDMLTAAIRYLAAADPTAMTAEEQARCLRVLEQ
Ga0268265_1272457123300028380Switchgrass RhizosphereMSSVMSPASADEALEMLTAALGYLAAADATEMTAEEQARCLKVLERATAIGAA
Ga0307284_1049259013300028799SoilMSDVMSPASTDQALEMLTVALGYLAATDATAMTAEEQARCLKVLERATAIGAAART
Ga0316363_1030252223300030659Peatlands SoilMSSAEPPSSAKEALGMLKAAMGYLAAVDATAMAAETQAL
Ga0318535_1024005923300031764SoilMSSVVPPASADQALEMLTVALGYLAEADATAMTAEEQARCLRVLE
Ga0318503_1020018513300031794SoilMSSVVPPASADQALEMLTVALGYLAEADATAMTAE
Ga0318527_1033034023300031859SoilMSSVVPPASADQALEMLTVALGYLAEADATAMTAEE
Ga0310910_1087434623300031946SoilMSSVVPPASADQALEMLTVALGYLAEADATAMTAEEQ
Ga0318507_1027357023300032025SoilMSSVMSPGSADEALEMLQSAMGYLAAADATAMTAEEQARCLRVMEKANS
Ga0318556_1042861223300032043SoilMSSVVSPGSADEALQMLRSALAYLAEADATAMTADAQARCLRVMEQANSVG
Ga0318505_1019820713300032060SoilMSSVVPPASADQALEMLTVALGYLAEADATAMTAEEQARCLRVL
Ga0335085_1187061313300032770SoilMNSHVMPPASAGEALEMLQSAMGYLAKADPAAMTAEEQAWCLRVLERATSA
Ga0335083_1132248113300032954SoilMSTTMSPGSVSEALEMLECAMGYLAAADATAMTAEAQARCLKGLERVT
Ga0335076_1118346023300032955SoilMSDVMSPTSTDQALEMLTAALGYLAAADATEMTPEEQAHCLKVLERAAAIGAA
Ga0318519_1026606223300033290SoilMVSSVVPPGSADEALEMLMAAMGYLAAADATQMAAGEQARCLRVFEQATA
Ga0318519_1040485223300033290SoilMSPVVSPASAAEALEMLRSAMAYLAAADATAMATE

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.