NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F091218

Metagenome Family F091218

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F091218
Family Type Metagenome
Number of Sequences 107
Average Sequence Length 58 residues
Representative Sequence MPETAKVVDYFRTVFPKIKVLYAEEGQYRIGKKPDPSKYVVPCIDERKLEKRKKK
Number of Associated Samples 79
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Viruses
% of genes with valid RBS motifs 10.19 %
% of genes near scaffold ends (potentially truncated) 29.91 %
% of genes from short scaffolds (< 2000 bps) 64.49 %
Associated GOLD sequencing projects 71
AlphaFold2 3D model prediction Yes
3D model pTM-score0.25

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (71.963 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater
(35.514 % of family members)
Environment Ontology (ENVO) Unclassified
(81.308 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(85.047 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 18.07%    β-sheet: 0.00%    Coil/Unstructured: 81.93%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.25
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF09250Prim-Pol 19.63
PF08708PriCT_1 6.54
PF13392HNH_3 6.54
PF06147DUF968 4.67
PF07102YbcO 4.67
PF04851ResIII 3.74
PF00271Helicase_C 1.87
PF12708Pectate_lyase_3 0.93
PF09374PG_binding_3 0.93



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000162|TB03JUN2009H_c005937All Organisms → Viruses → Predicted Viral2019Open in IMG/M
3300000162|TB03JUN2009H_c019540All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage775Open in IMG/M
3300000439|TBL_comb48_EPIDRAFT_1010246All Organisms → cellular organisms → Bacteria5127Open in IMG/M
3300000439|TBL_comb48_EPIDRAFT_1055355All Organisms → Viruses → Predicted Viral1366Open in IMG/M
3300001836|RCM27_1043772All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage697Open in IMG/M
3300002091|JGI24028J26656_1002553All Organisms → Viruses → Predicted Viral3306Open in IMG/M
3300002092|JGI24218J26658_1003127All Organisms → Viruses → Predicted Viral3924Open in IMG/M
3300002092|JGI24218J26658_1012493All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1337Open in IMG/M
3300002092|JGI24218J26658_1024046All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage796Open in IMG/M
3300002307|JGI24890J29729_1006307All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3612Open in IMG/M
3300002307|JGI24890J29729_1006975All Organisms → cellular organisms → Bacteria → Proteobacteria3380Open in IMG/M
3300002843|contig_10320All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage800Open in IMG/M
3300002933|G310J44882_10004243All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5207Open in IMG/M
3300002933|G310J44882_10006194All Organisms → Viruses → Predicted Viral4005Open in IMG/M
3300002933|G310J44882_10013005All Organisms → Viruses → Predicted Viral2367Open in IMG/M
3300003375|JGI26470J50227_1010609All Organisms → Viruses → Predicted Viral2300Open in IMG/M
3300003375|JGI26470J50227_1018889All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1546Open in IMG/M
3300003375|JGI26470J50227_1023805All Organisms → Viruses → Predicted Viral1301Open in IMG/M
3300003375|JGI26470J50227_1054579All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage685Open in IMG/M
3300003812|Ga0007861_1003145All Organisms → Viruses → Predicted Viral1742Open in IMG/M
3300003813|Ga0007879_1003069All Organisms → Viruses → Predicted Viral2585Open in IMG/M
3300003813|Ga0007879_1009635All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1130Open in IMG/M
3300004095|Ga0007829_10002378All Organisms → cellular organisms → Bacteria → Proteobacteria3688Open in IMG/M
3300004461|Ga0066223_1149132All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1496Open in IMG/M
3300004461|Ga0066223_1372558All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage537Open in IMG/M
3300004685|Ga0065177_1038367All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage903Open in IMG/M
3300004686|Ga0065173_1043501All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage817Open in IMG/M
3300004694|Ga0065170_1012703All Organisms → cellular organisms → Bacteria1131Open in IMG/M
3300004771|Ga0007797_1112536All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage703Open in IMG/M
3300004772|Ga0007791_10000038All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage28718Open in IMG/M
3300004806|Ga0007854_10133935All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1101Open in IMG/M
3300006071|Ga0007876_1037474All Organisms → Viruses → Predicted Viral1332Open in IMG/M
3300006071|Ga0007876_1044154All Organisms → Viruses → Predicted Viral1215Open in IMG/M
3300006114|Ga0007815_1057621All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage802Open in IMG/M
3300006115|Ga0007816_1127579All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage551Open in IMG/M
3300006118|Ga0007859_1009858All Organisms → cellular organisms → Bacteria → Proteobacteria2206Open in IMG/M
3300006118|Ga0007859_1029618All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1177Open in IMG/M
3300006120|Ga0007867_1137194All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage526Open in IMG/M
3300006121|Ga0007824_1075086All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage640Open in IMG/M
3300006121|Ga0007824_1076091All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage636Open in IMG/M
3300006122|Ga0007837_1014786All Organisms → Viruses → Predicted Viral1316Open in IMG/M
3300009159|Ga0114978_10185890All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1320Open in IMG/M
3300009175|Ga0073936_10013899All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage9415Open in IMG/M
3300009175|Ga0073936_10031365All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5402Open in IMG/M
3300009175|Ga0073936_10782887All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage519Open in IMG/M
3300009184|Ga0114976_10017164All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4443Open in IMG/M
3300009502|Ga0114951_10336066All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage767Open in IMG/M
3300010230|Ga0136236_1009128All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1116Open in IMG/M
3300010885|Ga0133913_10500518All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3202Open in IMG/M
3300012664|Ga0157497_1001678All Organisms → Viruses → Predicted Viral4013Open in IMG/M
3300012664|Ga0157497_1006995All Organisms → Viruses → Predicted Viral1716Open in IMG/M
3300013006|Ga0164294_10068266All Organisms → cellular organisms → Bacteria2701Open in IMG/M
3300013093|Ga0164296_1005702All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage10825Open in IMG/M
3300013093|Ga0164296_1155463All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage908Open in IMG/M
3300013094|Ga0164297_10261839All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage662Open in IMG/M
3300013285|Ga0136642_1029755All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1559Open in IMG/M
3300020164|Ga0194037_1099858All Organisms → Viruses → Predicted Viral1011Open in IMG/M
3300020686|Ga0214194_108723All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage917Open in IMG/M
3300020709|Ga0214233_1000353All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage16465Open in IMG/M
3300020711|Ga0214237_1034778All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage560Open in IMG/M
3300020729|Ga0214251_1021931All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1120Open in IMG/M
3300020731|Ga0214170_1023830All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1025Open in IMG/M
3300021115|Ga0214174_104095All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1285Open in IMG/M
3300021126|Ga0214187_1004929All Organisms → Viruses → Predicted Viral1891Open in IMG/M
3300021133|Ga0214175_1030151All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage675Open in IMG/M
3300021134|Ga0214171_1037608All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage647Open in IMG/M
3300021142|Ga0214192_1006171All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5385Open in IMG/M
3300021142|Ga0214192_1130889All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage656Open in IMG/M
3300021142|Ga0214192_1144450All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage611Open in IMG/M
3300022555|Ga0212088_10007917All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage18030Open in IMG/M
3300022555|Ga0212088_10030280All Organisms → cellular organisms → Bacteria6604Open in IMG/M
3300022555|Ga0212088_10774749All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage557Open in IMG/M
3300022591|Ga0236341_1022726All Organisms → Viruses → Predicted Viral1882Open in IMG/M
3300022602|Ga0248169_100419All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage68322Open in IMG/M
3300025162|Ga0209083_1019691All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3424Open in IMG/M
3300025328|Ga0208384_100104All Organisms → Viruses → Predicted Viral3147Open in IMG/M
3300025369|Ga0208382_1044486All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage513Open in IMG/M
3300025381|Ga0208871_1002355All Organisms → Viruses → Predicted Viral4238Open in IMG/M
3300025381|Ga0208871_1030557All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage769Open in IMG/M
3300025392|Ga0208380_1038235All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage729Open in IMG/M
3300025398|Ga0208251_1046257All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage709Open in IMG/M
3300025400|Ga0208387_1001743All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5380Open in IMG/M
3300025400|Ga0208387_1070867All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage517Open in IMG/M
3300025401|Ga0207955_1053389All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage647Open in IMG/M
3300025421|Ga0207958_1007147All Organisms → Viruses → Predicted Viral2137Open in IMG/M
3300025429|Ga0208500_1006234All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2005Open in IMG/M
3300025435|Ga0208618_1030767All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage986Open in IMG/M
3300025450|Ga0208744_1063115All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage730Open in IMG/M
3300025578|Ga0208864_1004236All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4696Open in IMG/M
3300025782|Ga0208867_1001032All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6439Open in IMG/M
3300025789|Ga0208499_1011087All Organisms → Viruses → Predicted Viral1838Open in IMG/M
3300027782|Ga0209500_10063098All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1932Open in IMG/M
3300027896|Ga0209777_10329277All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1170Open in IMG/M
3300029798|Ga0239581_1050901All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage933Open in IMG/M
3300031759|Ga0316219_1145237All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage880Open in IMG/M
3300031813|Ga0316217_10014807All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6090Open in IMG/M
3300031813|Ga0316217_10037980All Organisms → cellular organisms → Bacteria2785Open in IMG/M
3300031813|Ga0316217_10241872All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage721Open in IMG/M
3300031884|Ga0316220_1170917All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage770Open in IMG/M
3300032117|Ga0316218_1253604All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage609Open in IMG/M
3300032560|Ga0316223_1007805All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6469Open in IMG/M
3300032560|Ga0316223_1007813All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6467Open in IMG/M
3300032561|Ga0316222_1244849All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage611Open in IMG/M
3300032562|Ga0316226_1351335All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage550Open in IMG/M
3300032605|Ga0316232_1318432All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage576Open in IMG/M
3300032675|Ga0316225_1134105All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage809Open in IMG/M
3300032677|Ga0316227_1120659All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage992Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater35.51%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater19.63%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater10.28%
LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic5.61%
Freshwater Lake HypolimnionEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion5.61%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater4.67%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake4.67%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater3.74%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater1.87%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater1.87%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.87%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.93%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater0.93%
Marine PlanktonEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton0.93%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.93%
Stormwater Retention PondEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Stormwater Retention Pond0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000162Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 hypolimnionEnvironmentalOpen in IMG/M
3300000439Trout Bog Lake June 7 2007 Epilimnion (Trout Bog Lake Combined Assembly 48 Epilimnion Samples, Aug 2012 Assem)EnvironmentalOpen in IMG/M
3300001836Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM27, ROCA_DNA191_0.2um_MCP-N_C_3aEnvironmentalOpen in IMG/M
3300002091Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-F8 metagenomeEnvironmentalOpen in IMG/M
3300002092Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenomeEnvironmentalOpen in IMG/M
3300002307Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-C2 co-culture F-D7EnvironmentalOpen in IMG/M
3300002843Stormwater retention pond microbial communities from Williamsburg, VA - Sample from GreenspringsEnvironmentalOpen in IMG/M
3300002933Combined Assembly of freshwater hypolimnion microbial communities from Trout Bog Lake, Wisconsin, USAEnvironmentalOpen in IMG/M
3300003375Freshwater actinobacteria microbial communities from Trout Bog Lake, Wisconsin, USA - enrichment TB-E6EnvironmentalOpen in IMG/M
3300003812Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22Jun08EnvironmentalOpen in IMG/M
3300003813Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH15Jun09EnvironmentalOpen in IMG/M
3300004095Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09EnvironmentalOpen in IMG/M
3300004461Marine viral communities from Newfoundland, Canada BC-2EnvironmentalOpen in IMG/M
3300004685Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Jul08 (version 2)EnvironmentalOpen in IMG/M
3300004686Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Oct08 (version 2)EnvironmentalOpen in IMG/M
3300004694Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE17Sep08 (version 2)EnvironmentalOpen in IMG/M
3300004771Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA2.5MEnvironmentalOpen in IMG/M
3300004772Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0.5MEnvironmentalOpen in IMG/M
3300004806Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug08EnvironmentalOpen in IMG/M
3300006071Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09EnvironmentalOpen in IMG/M
3300006114Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug09EnvironmentalOpen in IMG/M
3300006115Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09EnvironmentalOpen in IMG/M
3300006118Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul07EnvironmentalOpen in IMG/M
3300006120Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH25Aug08EnvironmentalOpen in IMG/M
3300006121Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE05Oct08EnvironmentalOpen in IMG/M
3300006122Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE31Jul07EnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009175Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaGEnvironmentalOpen in IMG/M
3300009184Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaGEnvironmentalOpen in IMG/M
3300009502Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaGEnvironmentalOpen in IMG/M
3300010230Filterable freshwater microbial communities from Conwy River, North Wales, UK. Not filtered control. After WGAEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300012664Freshwater microbial communities from Zephyr Creek, Ontario, Canada - S17EnvironmentalOpen in IMG/M
3300013006Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaGEnvironmentalOpen in IMG/M
3300013093Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaGEnvironmentalOpen in IMG/M
3300013094Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES058 metaGEnvironmentalOpen in IMG/M
3300013285Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31YEnvironmentalOpen in IMG/M
3300020164Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L304-6mEnvironmentalOpen in IMG/M
3300020686Freshwater microbial communities from Trout Bog Lake, WI - 12AUG2008 epilimnionEnvironmentalOpen in IMG/M
3300020709Freshwater microbial communities from Trout Bog Lake, WI - 01JUL2008 hypolimnionEnvironmentalOpen in IMG/M
3300020711Freshwater microbial communities from Trout Bog Lake, WI - 29JUL2008 hypolimnionEnvironmentalOpen in IMG/M
3300020729Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 hypolimnionEnvironmentalOpen in IMG/M
3300020731Freshwater microbial communities from Trout Bog Lake, WI - 27JUN2007 epilimnionEnvironmentalOpen in IMG/M
3300021115Freshwater microbial communities from Trout Bog Lake, WI - 31JUL2007 epilimnionEnvironmentalOpen in IMG/M
3300021126Freshwater microbial communities from Trout Bog Lake, WI - 24JUN2008 epilimnionEnvironmentalOpen in IMG/M
3300021133Freshwater microbial communities from Trout Bog Lake, WI - 09AUG2007 epilimnionEnvironmentalOpen in IMG/M
3300021134Freshwater microbial communities from Trout Bog Lake, WI - 02JUL2007 epilimnionEnvironmentalOpen in IMG/M
3300021142Freshwater microbial communities from Trout Bog Lake, WI - 29JUL2008 epilimnionEnvironmentalOpen in IMG/M
3300022555Alinen_combined assemblyEnvironmentalOpen in IMG/M
3300022591Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S2EnvironmentalOpen in IMG/M
3300022602Freshwater microbial communities from Trout Bog Lake, Vilas County, Wisconsin, United States - 30JULY2014 epilimnionEnvironmentalOpen in IMG/M
3300025162Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025328Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul07 (SPAdes)EnvironmentalOpen in IMG/M
3300025369Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08 (SPAdes)EnvironmentalOpen in IMG/M
3300025381Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE19Jun07 (SPAdes)EnvironmentalOpen in IMG/M
3300025392Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (SPAdes)EnvironmentalOpen in IMG/M
3300025398Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE15Jun09 (SPAdes)EnvironmentalOpen in IMG/M
3300025400Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul09 (SPAdes)EnvironmentalOpen in IMG/M
3300025401Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Jun09 (SPAdes)EnvironmentalOpen in IMG/M
3300025421Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul07 (SPAdes)EnvironmentalOpen in IMG/M
3300025429Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE17Sep08 (SPAdes)EnvironmentalOpen in IMG/M
3300025435Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Jul08 (SPAdes)EnvironmentalOpen in IMG/M
3300025450Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 (SPAdes)EnvironmentalOpen in IMG/M
3300025578Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0.5M (SPAdes)EnvironmentalOpen in IMG/M
3300025782Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE05Oct08 (SPAdes)EnvironmentalOpen in IMG/M
3300025789Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE07Jul09 (SPAdes)EnvironmentalOpen in IMG/M
3300027782Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027896Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes)EnvironmentalOpen in IMG/M
3300029798Freshwater lake microbial communities from Alinen Mustajarvi, Finland - AM11EnvironmentalOpen in IMG/M
3300031759Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003PEnvironmentalOpen in IMG/M
3300031813Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - 1anoAEnvironmentalOpen in IMG/M
3300031884Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18005EnvironmentalOpen in IMG/M
3300032117Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003EnvironmentalOpen in IMG/M
3300032560Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18009EnvironmentalOpen in IMG/M
3300032561Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18011EnvironmentalOpen in IMG/M
3300032562Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18017EnvironmentalOpen in IMG/M
3300032605Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025_13EnvironmentalOpen in IMG/M
3300032675Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18015EnvironmentalOpen in IMG/M
3300032677Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18019EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
TB03JUN2009H_00593733300000162FreshwaterMPETAKVVDSFRTVFPKIKVLYAEEGDYRIGKKPDTSKYVVPCIDERKLEKRKKK*
TB03JUN2009H_01954033300000162FreshwaterMPKTAKVVDYFRTVFPKIKVIYAEEGQYRIGKKPDPSKYVVPCIDERKLEKRKKK*
TBL_comb48_EPIDRAFT_101024613300000439FreshwaterMDSKSKNRLLMPETAKVVDYFRTVFPKIKVIYAEEGQYRIGKKPDPSKYVVPCIDERKLEKRKKK*
TBL_comb48_EPIDRAFT_105535543300000439FreshwaterMPETAKVVDHFRTVFPRIKVLFAEEGPYRIGKKPDRSKYVVPCIDERKLEKKGKKK*
RCM27_104377223300001836Marine PlanktonMPQIAKIVDELRMVFPKIKVLYAEEGDYRLGKKPDPSKYVVPNIAYLNDKPTEKKGKKK*
JGI24028J26656_100255313300002091LenticMPETAKVVDYFRTVFPKIKVIYAEEGDYRIGKKPDPSKYVVPCFSEPVKPKKGKKK*
JGI24218J26658_100312743300002092LenticMPETAKVVDHFRTVFPKIKVLYAEEGQYRIGKKPDPSKYVVPCISEPKVEKKGKKK*
JGI24218J26658_101249313300002092LenticLDMDSKSKNRQLMPETAKVVDYFRTVFPKIKVIYAEEGDYRIGKKPDSSKYVVPCFSEPVKPKKGKKK*
JGI24218J26658_102404613300002092LenticETAKVVDYFRTVFPKIKVIYAEEGDYRIGKKPDESKRVVPNIAYLNDKPVGKRKK*
JGI24890J29729_100630783300002307LenticMPETAKVVDYFRTVFPKIKVIYAEEGDYRIGKKPDSSKYVVPCFSEPVKPKKGKKK*
JGI24890J29729_100697523300002307LenticMPETAKVVDHFRTVFPKIKVIYAEEGQYRIGKKPDASKYVVPCISEPIVKKGKRK*
contig_1032023300002843Stormwater Retention PondMPETAKIVDSFRTVFPKIKVLYAEEGPYRVGKKPDPSKYVVPNIGYLSDKPTEKKGRKK*
G310J44882_10004243153300002933FreshwaterTAKVVDYFRTVFPKIKVIYAEEGQYRIGKKPDPSKYVVPCIDERKLEKRKKK*
G310J44882_1000619463300002933FreshwaterMPKTAKVVDWMRTEFPGIKVLYAEEGQYRIGKKPDPSKYVVPCINEPIVKKGKRK*
G310J44882_1001300563300002933FreshwaterLLMPKTAKVVDYFRTVFPKIKVIYAEEGQYRIGKKPDPSKYVVPCIDERKLEKRKKK*
JGI26470J50227_101060943300003375FreshwaterMPETAKVVDYFRTVFPKIKVIYAEEGDYRIGKKPDMSKLVTPNLDYLNDKPKEKRKKK*
JGI26470J50227_101888933300003375FreshwaterMPETAKVVDIFREVFPKIKVLYAEEGDYRIGKKPDMSKLVAPNLDYLNDKPKEKRKKK*
JGI26470J50227_102380533300003375FreshwaterMPETAKVVDTFRTVFPKIKVLYAEEGQYRIGKKPDMSKLVTPNLDYLNDKPKEKRKKK*
JGI26470J50227_105457923300003375FreshwaterMPETAKVVDYFRTVFPKIKVIYAEEDDYRIGKKPDMSKLVTPNLDYLNDKPKEKRKKK*
Ga0007861_100314523300003812FreshwaterMPETAKVVDYFRTVFPKIKVIYAEEGDYRIGKKPDMSKLVAPNLDYLNDRPKEKRKKK*
Ga0007879_100306963300003813FreshwaterMDSKTKNRHLMPKTAKVVDWMRTEFPGIKVLYAEEGQYRIGKKPDPSKYVVPCINEPIVKKGKRK*
Ga0007879_100963523300003813FreshwaterMPETAKVVDYFRTVFPKIKVLYAEEGQYRIGKKPDPSKYVVPCIDERKLEKRKKK*
Ga0007829_1000237893300004095FreshwaterMDSKTKNRHLMPETAKVVDYFRTVFPKIKVLYAEEGQYRIGKKPDPSKYVVPCIDERKLEKRKKK*
Ga0066223_114913213300004461MarineMPETAKVVDSFRMVFPKIKVLYAEEGQYRVGKKPDPSKYVVPYTAYLNDKPTVKKGKKK*
Ga0066223_137255823300004461MarineMPEVSQIVDWMRTEFPGIKVLYAEEGQYRVGVKPDASKYVVPCIREPKLEKKGKKK*
Ga0065177_103836723300004685FreshwaterMPEVSRIVDWMRTEFPGTKVLYAEEGDYRIGKKPDPSKYVVPCIDERKLEKRKKK*
Ga0065173_104350133300004686FreshwaterMPETAKVVDYFRTVFPKIKVIYAEEGQYRIGKKPDPSKYVVPCIDERKLEKRKKK*
Ga0065170_101270333300004694FreshwaterMPETAKVVDQFRTVFPKIKVLYAEEGQYRIGKKPDPSKYVVPCIDERKLEKRKKK*
Ga0007797_111253633300004771FreshwaterMPETAKVVDLFRTVFPKIKVLYAEEGQYRIGKKPDESKRVVPNTAYLDDKPTKKGNKK*
Ga0007791_10000038353300004772FreshwaterVDLFRTVFPKIKVLYAEEGQYRIGKKPDESKRVVPNTAYLDDKPTKKGNKK*
Ga0007854_1013393533300004806FreshwaterRLLMPETAKVVDYFRTVFPKIKVIYAEEGQYRIGKKPDPSKYVVPCIDERKLEKRKKK*
Ga0007876_103747433300006071FreshwaterMRTEFPGIKVLYAEEGDYRVGKKPDPSKYVVPCIDERKLEKKGKKK*
Ga0007876_104415423300006071FreshwaterMPETAKVVDYFRTVFPKIKVLYAEEGDYRIGKKPDPSKYVVPCIDERKLEKRKKK*
Ga0007815_105762113300006114FreshwaterQLMPETAKVVDYFRTVFPKIKVIYAEEGDYRIGKKPDMSMLVTPNLDYLNDKPKEKRKKK
Ga0007816_112757933300006115FreshwaterMDSKSKNRQLMPETAKVVDYFRTVFPKIKVIYAEEGDYRIGKKPDPSKYVVPCIDESKLEKKGRKK*
Ga0007859_100985833300006118FreshwaterMPETAKVVDQFRTVFPKIKVLYAEEGQYRIGKKPDPSKYAIPCIDERKLEKRKKK*
Ga0007859_102961833300006118FreshwaterMPETAKVVDYFRTVFPKIKVIYAEEGDYRIGKKPDMSKLVTPNLDYLKDKPKEKRKKK*
Ga0007867_113719423300006120FreshwaterMPETAKVVDYFRTVFPKIKVIYAEEGDYRIGKKPVMSKLVTPNLDYLNDKPKEKRKRK*
Ga0007824_107508613300006121FreshwaterLRLDMDSKSKNRQLMPETAKVVDYFRTVFPKIKVIYAEEGDYRIGKKPDFSKYVVPCIDERKLEKKGRKK*
Ga0007824_107609113300006121FreshwaterVVDYFRTVFPKIKVIYAEEGQYRIGKKPDPSKYVVPCIDERKLEKRKKK*
Ga0007837_101478613300006122FreshwaterVVDYFRTVFPKIKVIYAEEGDYRIGKKPDMSKLVAPNLDYLNDRPKEKRKKK*
Ga0114978_1018589043300009159Freshwater LakeFRMVFPKIKVLYAEEGQYRVGKKPDPSKYVVPYTAYLNDKLTEKKGKKK*
Ga0073936_1001389933300009175Freshwater Lake HypolimnionMDSKSKNRHLMPETAKVVDHFRTVFPKIKVLYAEEGQYRIGKKPDPSKYVVPCFSEPVKPKKGKKK*
Ga0073936_10031365113300009175Freshwater Lake HypolimnionMDSKSKNRQLMPETAKVVDYFRTVFPKIKVIYAEEGDYRIGKKPDESKRVVPNIAYLNDKPVGKRKK*
Ga0073936_1078288713300009175Freshwater Lake HypolimnionMDNKTKNRQLMPETAKVVDYFRTVFPKIKVLYAEEGQYRIGKKPDPSKYVVPCIDERKLEKRKKK*
Ga0114976_1001716443300009184Freshwater LakeMPETAKIVDSFRMVFPKIKVLYAEEGQYRVGKKPDPSKYVVPYTAYLNDKPTVKKGKKK*
Ga0114951_1033606613300009502FreshwaterSKNRQLMPETAKVVDYFRTVFPKIKVIYAEEGDYRIGKKPDESKRVVPNIAYLNDKPVGKRKK*
Ga0136236_100912823300010230FreshwaterMDSKSKNRQLMPETAKVVDYFRTVFPKIKVIYAEEGDYRIGKKPNPSKYVVPCFSEPVKPKKGKKK*
Ga0133913_1050051833300010885Freshwater LakeMPETAKIVDSFRMVFPKIKVLYAEEGQYRVGKKPDPSKYVVPYTAYLNDKLTEKKGKKK*
Ga0157497_100167843300012664FreshwaterMPKVSRIVDWMRTEFPGTKVLYAEEGQYRVGKKPDPSKYATPNIAYLSDKPTVKKGKKNE
Ga0157497_100699533300012664FreshwaterMPETAKVVDSFRMVFPKIKVLYAEEGQYRVGKKPDPSKYVVPNIAYLNDKPTVKKGKKK*
Ga0164294_1006826653300013006FreshwaterMPETAKIVDSFRMVFPKIKVLYAEEGQYRVGKKPDQSKYVTPNLAYLNDTLTVKKGKKK*
Ga0164296_100570233300013093FreshwaterMDSKSKNRLLMPETAKVVDYFRTVFPKIKVIYAEENDYRIGKKPDPSKYVVPCIDERKLEKRKKK*
Ga0164296_115546333300013093FreshwaterKSKNRQLMPETAKVVDYFRTVFPKIKVLYAEEGDYRIGKKPDPSKYVVPCIDERKLEKRKKK*
Ga0164297_1026183923300013094FreshwaterMDNKSKNRLLMPETAKVVDTFRAVFPKIKVLYAEEGDYRIGKKPDPSKYVVPCIDERKLEKRKKK*
Ga0136642_102975523300013285FreshwaterMDKTTKNRLLMPETAKVIDHFRTVFPKIKVLYAEEGQYRVGVKPDPSKYVVPCIDERKLEKKGKKK*
Ga0194037_109985833300020164Anoxic Zone FreshwaterMPKTAKVVDWMRTEFPGIKVLYAEEGQYRIGKKPDPSKYVVPCINEPIVKKGKRK
Ga0214194_10872333300020686FreshwaterMPKTAKVVDYFRTVFPKIKVIYAEEGQYRIGKKPDPSKYVVPCIDERKLEKRKKK
Ga0214233_1000353163300020709FreshwaterMLMPETAKVVDSFRTVFPKIKVLYAEEGDYRIGKKPDTSKYVVPCIDERKLEKRKKK
Ga0214237_103477833300020711FreshwaterMPETAKVVDYFRTVFPKIKVIYAEEGDYRIGKKPDMSKLVTPNLDYLNDKSKEKRKKK
Ga0214251_102193133300020729FreshwaterMDSKTKNRHLMPKTAKVVDWMRTEFPGIKVLYAEEGQYRIGKKPDPSKYVVPCINEPIIKKGKRK
Ga0214170_102383013300020731FreshwaterDYFRTVFPKIKVIYAEEGQYRIGKKPDPSKYVVPCIDERKLEKRKKK
Ga0214174_10409533300021115FreshwaterMPETAKVVDSFRTVFPKIKVLYAEEGQYRIGKKPDPSKYVVPCIDERKL
Ga0214187_100492933300021126FreshwaterMPKTAKVVDWMRTEFPSIKVLYAEEGQYRIGKKPDPSKYVVPCINEPIVKKGKRK
Ga0214175_103015123300021133FreshwaterMPETAKVVDYFRTVFPKIKVIYAEEGDYRIGKKPDPSKYVVPCIDERKLEKKGRKK
Ga0214171_103760813300021134FreshwaterGLGMDNKTKNRMLMPETAKVVDSFRTVFPKIKVLYAEEGQYRIGKKPDPSKYVVPCIDERKL
Ga0214192_100617113300021142FreshwaterTKNRHLMPKTAKVVDWMRTEFPGIKVLYAEEGQYRIGKKPDPSKYVVPCINEPIVKKGKR
Ga0214192_113088933300021142FreshwaterLLMPETAKVVDYFRTVFPKIKVIYAEEGQYRIGKKPDPSKYVVPCIDERKLEKRKKK
Ga0214192_114445033300021142FreshwaterMPETAKAVDYFRTVFPKIKVLYAEEGDYRIGKKPDPSKYVVPCIDERKLEKRKKK
Ga0212088_10007917293300022555Freshwater Lake HypolimnionMPETAKVVDHFRTVFPKIKVLYAEEGQYRIGKKPDPSKYVVPCFSEPVKPKKGKKK
Ga0212088_10030280103300022555Freshwater Lake HypolimnionMPETAKVVDYFRTVFPKIKVIYAEEGDYRIGKKPDESKRVVPNIAYLNDKPVGKRKK
Ga0212088_1077474923300022555Freshwater Lake HypolimnionMPKTAKVVDWMRTEFPGIKVLYAEEGQYRIGKKPDPSKYVVPCFSEPVKPKKGKKK
Ga0236341_102272643300022591FreshwaterMPEVSRIVDWMRTEFPGIKVIYAEEGQYRIGKKPDPSKYVVPCIDERKLVKRKKK
Ga0248169_100419703300022602FreshwaterMPETAKVVDYFRTVFPKIKVIYAEENDYRIGKKPDPSKYVVPCIDERKLEKRKKK
Ga0209083_1019691103300025162FreshwaterKSKNRQLMPETAKVVDYFRTVFPKIKVIYAEEGDYRIGKKPDESKRVVPNIAYLNDKPVGKRKK
Ga0208384_10010433300025328FreshwaterMPETAKVVDTFRTVFPKIKVLYAEEGQYRIGKKPDMSKLVTPNLDYLNDKPKEKRKKK
Ga0208382_104448623300025369FreshwaterMPETAKVVDYFRTVFPKIKVIYAEEGQYRIGKKPDPSKYVVPCIDERKLEKRKKK
Ga0208871_100235543300025381FreshwaterMPETAKVVDYFRTVFPKIKVLYAEEGQYRIGKKPDPSKYVVPCIDERKLEKRKKK
Ga0208871_103055723300025381FreshwaterMPETAKVVDYFRTVFPKIKVIYAEEGDYRIGKKPDMSKLVTPNLDYLNDKPKEKRKKK
Ga0208380_103823513300025392FreshwaterLLRLDMDSKSKNRQLMPETAKVVDYFRTVFPKIKVIYAEEGDYRIGKKPDMSKLVTPNLDYLNDKPKEKRKKK
Ga0208251_104625733300025398FreshwaterMPETAKVVDYFRTVFPKIKVIYAEEGDYRIGKKPDMSKLVTPNLDYLN
Ga0208387_100174313300025400FreshwaterPKTAKVVDWMRTEFPGIKVLYAEEGQYRIGKKPDPSKYVVPCINEPIVKKGKRK
Ga0208387_107086723300025400FreshwaterMDSKTKNRHLMPETAKVVDYFRTVFPKIKVLYAEEGQYRIGKKPDPSKYVVPCIDERKLEKRKKK
Ga0207955_105338913300025401FreshwaterMPKTAKVVDWMRTEFPGIKVLYAEEGQYRIGKKPDPSKYVVPCINEP
Ga0207958_100714733300025421FreshwaterMPETAKVVDQFRTVFPKIKVLYAEEGQYRIGKKPDPSKYAIPCIDERKLEKRKKK
Ga0208500_100623433300025429FreshwaterMPETAKVVDQFRTVFPKIKVLYAEEGQYRIGKRPDPSKYVVPCIDERKLEKRKKK
Ga0208618_103076733300025435FreshwaterMPEVSRIVDWMRTEFPGTKVLYAEEGDYRIGKKPDPSKYVVPCIDERKLEKRKKK
Ga0208744_106311523300025450FreshwaterMPEVSRIVDWMRTEFPGIKVLYAEEGDYRVGKKPDPSKYVVPCIDERKLEKKGKKK
Ga0208864_100423693300025578FreshwaterMPETAKVVDLFRTVFPKIKVLYAEEGQYRIGKKPDESKRVVPNTAYLDDKPTKNMLVGKWNSIKSK
Ga0208867_1001032173300025782FreshwaterETAKVVDYFRTVFPKIKVIYAEEGDYRIGKKPDMSKLVTPNLDYLNDKPKEKRKKK
Ga0208499_101108743300025789FreshwaterMPETAKVVDYFRTVFPKIKVLYAEEGDYRIGKKPDPSKYVVPCIDERKLEKRKKK
Ga0209500_1006309843300027782Freshwater LakeMPETAKIVDSFRMVFPKIKVLYAEEGQYRVGKKPDPSKYVVPYTAYLNDKLTEKKGKKK
Ga0209777_1032927733300027896Freshwater Lake SedimentMPETAKVVDYFRTVFPKIKVLYAEEGDYRIGKKPDPSKYVVPCISEPKLEKRKKK
Ga0239581_105090133300029798Freshwater LakeMPETAKVVDYFRTVFPKIKVIYAEEGDYRIGKKPDPSKYVVPCFSEPVKPKKGKKK
Ga0316219_114523713300031759FreshwaterMDSKSKNRLLMPETAKVVDYFRTVFPKIKVIYAEEGQYRIGKKPDPSKYVVPCIDERKLEKRKKK
Ga0316217_1001480783300031813FreshwaterMPETAKVVDTFRAVFPKIKVLYAEEGDYRIGKKPDPSKYVVPCIDERKLEKRKKK
Ga0316217_1003798093300031813FreshwaterLLRLDMDSKSKNRQLMPETAKVVDYFRTVFPKIKVIYAEEGDYRIGKKPDMSKLVTPNLDYLNDKPTKKARKK
Ga0316217_1024187213300031813FreshwaterNRLLMPETAKVVDYFRTVFPKIKVIYAEEGQYRIGKKPDPSKYVVPCIDERKLEKRKKK
Ga0316220_117091733300031884FreshwaterSKNRLLMPETAKVVDYFRTVFPKIKVIYAEEGQYRIGKKPDPSKYVVPCIDERKLEKRKK
Ga0316218_125360413300032117FreshwaterMPETAKVVDYFRTVFPKIKVLYAEEGDYRIGKKPDMSKLVAPNLGYLNDKPTKKARKK
Ga0316223_100780533300032560FreshwaterMPETAKVVDYFRTVFPKIKVIYAEEGDYRIGKKPDMSKLVTPNLDYLNDKPTKKARKK
Ga0316223_100781323300032560FreshwaterMDNKSKNRQLMPETAKVVDYFRTVFPKIKVIYAEEGDYRIGKKPDMSKLVTPNLDYLNDKPKEKRKKK
Ga0316222_124484913300032561FreshwaterMPETAKVVDIFREVFPKIKVLYAEEGDYRIGKKPDMSKLVAPNLGYLNDKPTKKARKK
Ga0316226_135133533300032562FreshwaterKVVDYFRTVFPKIKVIYAEEGDYRIGKKPDMSKLVTPNLDYLNDKPKEKRKKK
Ga0316232_131843233300032605FreshwaterFRTVFPKIKVIYAEEGQYRIGKKPDPSKYVVPCIDERKLEKRKKK
Ga0316225_113410533300032675FreshwaterMPETAKVVDHFRTVFPRIKVLFAEEGPYRIGKKPDRSKYVVPCIDERKLEKKGKKK
Ga0316227_112065933300032677FreshwaterAKVVDTFRAVFPKIKVLYAEEGDYRIGKKPDPSKYVVPCIDERKLEKRKKK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.