NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F091936

Metagenome Family F091936

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F091936
Family Type Metagenome
Number of Sequences 107
Average Sequence Length 48 residues
Representative Sequence MNDGLDRSMRLKLVIEEMLKDIDMSGEEWNDRDKDGVAYWEKWNKND
Number of Associated Samples 89
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Viruses
% of genes with valid RBS motifs 46.67 %
% of genes near scaffold ends (potentially truncated) 41.12 %
% of genes from short scaffolds (< 2000 bps) 68.22 %
Associated GOLD sequencing projects 78
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (67.290 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine
(20.561 % of family members)
Environment Ontology (ENVO) Unclassified
(42.991 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(45.794 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 38.30%    β-sheet: 0.00%    Coil/Unstructured: 61.70%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF04973NMN_transporter 20.56
PF00166Cpn10 10.28
PF02675AdoMet_dc 8.41
PF136402OG-FeII_Oxy_3 3.74
PF00085Thioredoxin 3.74
PF09834DUF2061 1.87
PF08241Methyltransf_11 0.93
PF08007JmjC_2 0.93
PF07739TipAS 0.93
PF14579HHH_6 0.93
PF00082Peptidase_S8 0.93
PF01844HNH 0.93
PF06067DUF932 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG3201Nicotinamide riboside transporter PnuCCoenzyme transport and metabolism [H] 20.56
COG0234Co-chaperonin GroES (HSP10)Posttranslational modification, protein turnover, chaperones [O] 10.28
COG1586S-adenosylmethionine decarboxylaseAmino acid transport and metabolism [E] 8.41
COG2850Ribosomal protein L16 Arg81 hydroxylase, contains JmjC domainTranslation, ribosomal structure and biogenesis [J] 0.93


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms77.57 %
UnclassifiedrootN/A22.43 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000736|JGI12547J11936_1010779All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2365Open in IMG/M
3300000736|JGI12547J11936_1043283All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage943Open in IMG/M
3300000756|JGI12421J11937_10017199All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2706Open in IMG/M
3300000756|JGI12421J11937_10022208All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2329Open in IMG/M
3300000756|JGI12421J11937_10042023All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1546Open in IMG/M
3300000756|JGI12421J11937_10061531All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1164Open in IMG/M
3300002835|B570J40625_100059272All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5275Open in IMG/M
3300003490|JGI25926J51410_1038296All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage866Open in IMG/M
3300003499|JGI25930J51415_1021988Not Available1193Open in IMG/M
3300004054|Ga0063232_10222298All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage566Open in IMG/M
3300004112|Ga0065166_10015057All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2176Open in IMG/M
3300005517|Ga0070374_10087816All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1621Open in IMG/M
3300005527|Ga0068876_10651501Not Available566Open in IMG/M
3300005662|Ga0078894_10006587All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage9005Open in IMG/M
3300005941|Ga0070743_10072702All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1162Open in IMG/M
3300005941|Ga0070743_10137765All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage813Open in IMG/M
3300006639|Ga0079301_1087472All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage966Open in IMG/M
3300006917|Ga0075472_10156859All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1118Open in IMG/M
3300007545|Ga0102873_1000193Not Available22969Open in IMG/M
3300007546|Ga0102874_1282323Not Available500Open in IMG/M
3300007547|Ga0102875_1148894All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage735Open in IMG/M
3300007547|Ga0102875_1232437Not Available566Open in IMG/M
3300007551|Ga0102881_1043152All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1266Open in IMG/M
3300007557|Ga0102821_1000167All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes27894Open in IMG/M
3300007559|Ga0102828_1039203All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1081Open in IMG/M
3300007606|Ga0102923_1253615All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage543Open in IMG/M
3300007629|Ga0102895_1139665All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage628Open in IMG/M
3300007634|Ga0102901_1226905All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage524Open in IMG/M
3300007658|Ga0102898_1006835All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2565Open in IMG/M
3300007658|Ga0102898_1010689All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2027Open in IMG/M
3300007992|Ga0105748_10267638All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage720Open in IMG/M
3300008055|Ga0108970_10588879All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage738Open in IMG/M
3300008108|Ga0114341_10221060All Organisms → Viruses → Predicted Viral1649Open in IMG/M
3300008116|Ga0114350_1111937All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage839Open in IMG/M
3300008117|Ga0114351_1426466Not Available548Open in IMG/M
3300008120|Ga0114355_1095056All Organisms → Viruses → Predicted Viral1187Open in IMG/M
3300008120|Ga0114355_1098605All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1155Open in IMG/M
3300008120|Ga0114355_1107622All Organisms → Viruses → Predicted Viral1080Open in IMG/M
3300008262|Ga0114337_1251072All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage676Open in IMG/M
3300008266|Ga0114363_1002210All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage11066Open in IMG/M
3300008964|Ga0102889_1014008All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2585Open in IMG/M
3300008964|Ga0102889_1246211All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage517Open in IMG/M
3300008996|Ga0102831_1046631All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1455Open in IMG/M
3300009024|Ga0102811_1146326All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage884Open in IMG/M
3300009419|Ga0114982_1229293All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage577Open in IMG/M
3300010309|Ga0102890_1048083Not Available842Open in IMG/M
3300010354|Ga0129333_10858468All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage770Open in IMG/M
3300011268|Ga0151620_1032480All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1773Open in IMG/M
3300012666|Ga0157498_1006015All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1983Open in IMG/M
3300013004|Ga0164293_10021809All Organisms → cellular organisms → Bacteria → Proteobacteria5347Open in IMG/M
(restricted) 3300013132|Ga0172372_10055489All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3755Open in IMG/M
3300013372|Ga0177922_11274766All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1880Open in IMG/M
3300014050|Ga0119952_1047225Not Available1190Open in IMG/M
3300017761|Ga0181356_1013851All Organisms → Viruses → Predicted Viral3032Open in IMG/M
3300017788|Ga0169931_10028580All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6707Open in IMG/M
3300019784|Ga0181359_1004933All Organisms → Viruses → Predicted Viral4289Open in IMG/M
3300020074|Ga0194113_10218037All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1510Open in IMG/M
3300020109|Ga0194112_10985071Not Available535Open in IMG/M
3300020197|Ga0194128_10146217Not Available1356Open in IMG/M
3300020511|Ga0208593_1037104All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage550Open in IMG/M
3300020533|Ga0208364_1001571All Organisms → Viruses → Predicted Viral4569Open in IMG/M
3300020548|Ga0208856_1011137All Organisms → Viruses → Predicted Viral1467Open in IMG/M
3300021962|Ga0222713_10009969Not Available8605Open in IMG/M
3300021962|Ga0222713_10127308All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1789Open in IMG/M
3300021963|Ga0222712_10023207All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5093Open in IMG/M
3300024343|Ga0244777_10063475All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2369Open in IMG/M
3300024346|Ga0244775_10551799All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage938Open in IMG/M
3300024346|Ga0244775_10821521Not Available742Open in IMG/M
3300027114|Ga0208009_1001183Not Available7418Open in IMG/M
3300027121|Ga0255074_1039877All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage583Open in IMG/M
3300027131|Ga0255066_1017645All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1047Open in IMG/M
3300027131|Ga0255066_1026529All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage826Open in IMG/M
3300027247|Ga0208679_1084613Not Available554Open in IMG/M
3300027278|Ga0208439_1025302All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1209Open in IMG/M
3300027281|Ga0208440_1077292All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage694Open in IMG/M
3300027571|Ga0208897_1089827All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage787Open in IMG/M
3300027581|Ga0209651_1086973All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage892Open in IMG/M
3300027644|Ga0209356_1130440All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage714Open in IMG/M
3300027697|Ga0209033_1086221All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales1051Open in IMG/M
3300027720|Ga0209617_10064274All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1521Open in IMG/M
3300027753|Ga0208305_10101828All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1075Open in IMG/M
3300027797|Ga0209107_10002736All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium9783Open in IMG/M
3300027797|Ga0209107_10034401All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2899Open in IMG/M
3300027804|Ga0209358_10037883All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2921Open in IMG/M
3300027804|Ga0209358_10319049Not Available757Open in IMG/M
3300031857|Ga0315909_10345710Not Available1089Open in IMG/M
3300031857|Ga0315909_10530666All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage804Open in IMG/M
3300031951|Ga0315904_11010080Not Available658Open in IMG/M
3300032050|Ga0315906_10580113All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage928Open in IMG/M
3300032116|Ga0315903_11126165All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage536Open in IMG/M
3300033978|Ga0334977_0405110All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage636Open in IMG/M
3300033981|Ga0334982_0368663All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage659Open in IMG/M
3300033992|Ga0334992_0000229Not Available48211Open in IMG/M
3300033992|Ga0334992_0032927All Organisms → Viruses → Predicted Viral3076Open in IMG/M
3300034013|Ga0334991_0067594All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1803Open in IMG/M
3300034013|Ga0334991_0168416All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage980Open in IMG/M
3300034020|Ga0335002_0080771Not Available2259Open in IMG/M
3300034060|Ga0334983_0581743Not Available614Open in IMG/M
3300034068|Ga0334990_0002101Not Available11475Open in IMG/M
3300034082|Ga0335020_0435254All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage628Open in IMG/M
3300034093|Ga0335012_0579556Not Available521Open in IMG/M
3300034102|Ga0335029_0041793All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3404Open in IMG/M
3300034166|Ga0335016_0046610All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3408Open in IMG/M
3300034168|Ga0335061_0001160All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes13295Open in IMG/M
3300034200|Ga0335065_0641396All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage615Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine20.56%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater16.82%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake14.95%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton7.48%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment5.61%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater4.67%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine4.67%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater2.80%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment2.80%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.80%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater2.80%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water2.80%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface2.80%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.87%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.93%
Freshwater, Surface IceEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice0.93%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.93%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous0.93%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.93%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.93%
EstuaryHost-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary0.93%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000736Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011EnvironmentalOpen in IMG/M
3300000756Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011EnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003490Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SNEnvironmentalOpen in IMG/M
3300003499Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DNEnvironmentalOpen in IMG/M
3300004054Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2)EnvironmentalOpen in IMG/M
3300004096Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2)EnvironmentalOpen in IMG/M
3300004112Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2)EnvironmentalOpen in IMG/M
3300005517Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4)EnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300006639Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11EnvironmentalOpen in IMG/M
3300006917Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300007545Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3EnvironmentalOpen in IMG/M
3300007546Estuarine microbial communities from the Columbia River estuary - metaG 1547A-02EnvironmentalOpen in IMG/M
3300007547Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02EnvironmentalOpen in IMG/M
3300007551Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3EnvironmentalOpen in IMG/M
3300007557Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715EnvironmentalOpen in IMG/M
3300007559Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541EnvironmentalOpen in IMG/M
3300007606Estuarine microbial communities from the Columbia River estuary - metaG 1569-02EnvironmentalOpen in IMG/M
3300007629Estuarine microbial communities from the Columbia River estuary - metaG 1554B-3EnvironmentalOpen in IMG/M
3300007634Estuarine microbial communities from the Columbia River estuary - metaG 1555A-02EnvironmentalOpen in IMG/M
3300007658Estuarine microbial communities from the Columbia River estuary - metaG 1555A-3EnvironmentalOpen in IMG/M
3300007992Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2umEnvironmentalOpen in IMG/M
3300008055Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393Host-AssociatedOpen in IMG/M
3300008108Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NAEnvironmentalOpen in IMG/M
3300008116Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NAEnvironmentalOpen in IMG/M
3300008117Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008120Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NAEnvironmentalOpen in IMG/M
3300008262Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NAEnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008964Estuarine microbial communities from the Columbia River estuary - metaG 1551A-02EnvironmentalOpen in IMG/M
3300008996Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747EnvironmentalOpen in IMG/M
3300009024Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705EnvironmentalOpen in IMG/M
3300009419Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FTEnvironmentalOpen in IMG/M
3300010309Estuarine microbial communities from the Columbia River estuary - metaG 1552A-3EnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300011268Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555EnvironmentalOpen in IMG/M
3300012666Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2EnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013132 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5mEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300014050Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007BEnvironmentalOpen in IMG/M
3300017761Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017788Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20LEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020074Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200mEnvironmentalOpen in IMG/M
3300020109Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400mEnvironmentalOpen in IMG/M
3300020197Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65mEnvironmentalOpen in IMG/M
3300020511Freshwater microbial communities from Lake Mendota, WI - 15JUL2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020533Freshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020548Freshwater microbial communities from Lake Mendota, WI - 13JUL2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300027114Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes)EnvironmentalOpen in IMG/M
3300027121Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8hEnvironmentalOpen in IMG/M
3300027131Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8hEnvironmentalOpen in IMG/M
3300027247Estuarine microbial communities from the Columbia River estuary - metaG 1555A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027278Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 (SPAdes)EnvironmentalOpen in IMG/M
3300027281Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027571Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 (SPAdes)EnvironmentalOpen in IMG/M
3300027581Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027644Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027697Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027720Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027753Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 (SPAdes)EnvironmentalOpen in IMG/M
3300027797Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027804Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027892Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300033978Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002EnvironmentalOpen in IMG/M
3300033981Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011EnvironmentalOpen in IMG/M
3300033992Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035EnvironmentalOpen in IMG/M
3300034013Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034EnvironmentalOpen in IMG/M
3300034020Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055EnvironmentalOpen in IMG/M
3300034060Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016EnvironmentalOpen in IMG/M
3300034068Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031EnvironmentalOpen in IMG/M
3300034082Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088EnvironmentalOpen in IMG/M
3300034093Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072EnvironmentalOpen in IMG/M
3300034102Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112EnvironmentalOpen in IMG/M
3300034166Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079EnvironmentalOpen in IMG/M
3300034168Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183EnvironmentalOpen in IMG/M
3300034200Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI12547J11936_101077923300000736Freshwater And SedimentMNDGLDRSMRLKLVIEEMLKDIDMSGEEWNDRDKDGVAYWEKWNKND*
JGI12547J11936_104328323300000736Freshwater And SedimentMSEMNDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNKND*
JGI12421J11937_10017199113300000756Freshwater And SedimentMNDGLDRSMRLKLVIEEMLKDIDLSGEEWNDRDKDGVAYWEKWNKND*
JGI12421J11937_1002220813300000756Freshwater And SedimentDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNKND*
JGI12421J11937_1004202343300000756Freshwater And SedimentMTNPDRDRSMRLKRVIEEMXKDIDMSGEEWNDRDKDGVAYWEKWHKADDR*
JGI12421J11937_1006153133300000756Freshwater And SedimentMTEMTSLGDDFDRSMRLKLVIEEMLKDIDMSGEEWNDRDKDGIPYWEKWHKADD*
B570J40625_100059272103300002835FreshwaterMTNPDRNRSMRLKLVIEEMLKDIDMSGEEWNDRDKDGIPYWEKWHKADD*
JGI25926J51410_103829633300003490Freshwater LakeMSEMNDGLDRSMRLKLVIEEMLKDIDMSGEEWNDRDKDGVAYWEKWNKND*
JGI25930J51415_102198833300003499Freshwater LakeMTSDRNRSMRLKLAIEEMLKDIDMSGEEWNDRDKDGVAYWEKWDKADDR*
Ga0063232_1022229813300004054Freshwater LakeMSEMNDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEK
Ga0066177_1052286623300004096Freshwater LakeMTNPDRDRSMRLKLAIEDMLKDIDMSGEEWNDRDKNGIAYWEKYSEEGTN*
Ga0065166_1001505743300004112Freshwater LakeMTNLDRDRSMRLKLAIEELLKDVDMSGEEWDDYDKDGVPYWEKWDK*
Ga0070374_1008781643300005517Freshwater LakeMTEMTSVGDDFDRSMRLKRVIEEMLKDIDMSGEEWNDRDKDGVAYWEKWNKND*
Ga0068876_1065150123300005527Freshwater LakeVTNPDRDRSMRLKLAIEEMLKDIDMSGEEWNDRDKDDVAYWEKWDK*
Ga0078894_10006587103300005662Freshwater LakeMSKMNDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNKND*
Ga0070743_1007270233300005941EstuarineMSKMNEDFDRSMRLKLVIEDMLKDIDMSSEEWNDRDKDGVAYWEKWNKND*
Ga0070743_1013776513300005941EstuarineQMSKMNDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNNND*
Ga0079301_108747243300006639Deep SubsurfaceMRLKLVIEEMLKDIDMSGEEWNDRDKDGIPYWEKWHKADD*
Ga0075472_1015685953300006917AqueousMNDRDRSMRLKLAIEELLKDVDMSGEEWDDYDKDGVPYWEKWDK*
Ga0102873_1000193433300007545EstuarineMNDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNKND*
Ga0102874_128232323300007546EstuarineIKTESLHGKRIQMSKMNDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNNND*
Ga0102875_114889443300007547EstuarineEDFDRSMRLKLVIEDMLKDIDMSSEEWNDRDKDGVAYWEKWNKND*
Ga0102875_123243713300007547EstuarineLHGKRIQMSKMNDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNNND*
Ga0102881_104315243300007551EstuarineIKMESLHGKRIQMSKMNEDFDRSMRLKLVIEDMLKDIDMSSEEWNDRDKDGVAYWEKWNKND*
Ga0102821_100016713300007557EstuarineDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNKND*
Ga0102828_103920343300007559EstuarineMESLHGKRIQMSKMNDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNKND
Ga0102923_125361513300007606EstuarineEMTSVGDDFDRSMRLKRVIEEMLKDIDMSGEEWNDRDKDGVAYWEKWNKND*
Ga0102895_113966523300007629EstuarineMNDGLDRSMRLKLVIEDMLKDIDMSGVEWNDRDKDGVAYWEKWNNND*
Ga0102901_122690533300007634EstuarineLKRVIEEMLKDIDMSGEEWNDRDKDGVAYWEKWNKND*
Ga0102898_100683513300007658EstuarineSKMNDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNKND*
Ga0102898_101068913300007658EstuarineMESLHGKRIQMTEMTSVGDDFDRSMRLKRVIEEMLKDIDMSGEEWNDRDKDGVAYWEKWNKN
Ga0105748_1026763813300007992Estuary WaterMRLKRVIEEMLKDIDMSGEEWNDRDKDGVAYWEKWNKND*
Ga0108970_1058887923300008055EstuaryMENLHGKRIQMSKMNDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNKND
Ga0114341_1022106043300008108Freshwater, PlanktonMRLKLAIEEMLKDIDMSGEEWNDRDKDGVAYWEKWDK*
Ga0114350_111193723300008116Freshwater, PlanktonMRLKLVIEDMLKDIDMSGEEWNDRDKDGIPYWEKWHKADD*
Ga0114351_142646623300008117Freshwater, PlanktonMCLKLVIEEMLKDIDMSGEERNDRDKDGIPYWEKWHKADD*
Ga0114355_109505623300008120Freshwater, PlanktonMRLKLAIEEMLKDIDMSGEEWNDRDKDGVAYWEKWDKADDR*
Ga0114355_109860513300008120Freshwater, PlanktonMTEMTSVGDDRDRSMRLKLAIEEMLKDIDMSGEEWNDHDKDGKPYWEKY
Ga0114355_110762213300008120Freshwater, PlanktonMRLKLAIEEMLKDIDMSGEEWNDHDKDGKPYWEKY
Ga0114337_125107233300008262Freshwater, PlanktonMRLKIVIEEMLKDIDMSGEEWNDRDKNGVAYWEKWDKNG*
Ga0114363_1002210253300008266Freshwater, PlanktonMTNLDQNRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGIPYWEKWHKADD*
Ga0102889_101400813300008964EstuarineGKRIQMSKMNDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNKND*
Ga0102889_124621123300008964EstuarineMNDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNNND*
Ga0102831_104663123300008996EstuarineMNEDFDRSMRLKLVIEDMLKDIDMSSEEWNDRDKDGVAYWEKWNKND*
Ga0102811_114632633300009024EstuarineMNDGLDRSMRLKLVIEDMLKDIYMSGEEWNDRDKDGVAYWEKWNNND*
Ga0114982_122929333300009419Deep SubsurfaceSIKMESLHGKRIQMSKMNDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKNGVAYWEKWDKND*
Ga0102890_104808343300010309EstuarineSLHGKRIQMSKMNDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNKND*
Ga0129333_1085846813300010354Freshwater To Marine Saline GradientDRNRSMRLKLAIEEMLKDIDMSGEEWNDRDKDGVAYWEKWDKGGRSESDAR*
Ga0151620_103248013300011268FreshwaterMNDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNKNDLIG*
Ga0157498_100601553300012666Freshwater, Surface IceMTSVGDDFDRSMRLKRVIEEMLKDIDMSGEEWNDRDKDGVAYWEKWNKND*
Ga0164293_1002180983300013004FreshwaterMRLKLAIEDMLKDIDMSGEEWNDRDKNGIAYWEKYSEEETN*
(restricted) Ga0172372_1005548933300013132FreshwaterMMDRSERLKMVIEELLKDIDMSGEEWNDYDKEGIPYWEKWDKND*
Ga0177922_1127476613300013372FreshwaterMESLHGKRIQMTEMTSVGDDFDRSMRLKRVIEEMLKDIDMSGEEWNDRDKDGV
Ga0119952_104722533300014050FreshwaterMRLKLAIEELLKDIDMSGEEWNDYDKDGVPYWEKWDK*
Ga0181356_101385113300017761Freshwater LakeIGLSIKMESLHGKRIQMTEMTSVGDDFDRSMRLKRVIEEMLKDIDMSGEEWNDRDKDGVAYWEKWNKND
Ga0169931_10028580113300017788FreshwaterMMDRSERLKMVIEELLKDIDMSGEEWNDYDKEGIPYWEKWDKND
Ga0181359_100493373300019784Freshwater LakeMTEMTSVGDDFDRSMRLKRVIEEMLKDIDMSGEEWNDRDKDGVAYWEKWNKND
Ga0194113_1021803723300020074Freshwater LakeMMDRSERLKMVIEELLKDIDMSGEEWNDYDKDGIPYWEKWDKND
Ga0194112_1098507123300020109Freshwater LakeMDRSERLKMVIEELLKDIDMSGEEWNDYDKDGIPYWEKWDKND
Ga0194128_1014621713300020197Freshwater LakeMMDRSERLKMVIEELLKDIDMSGEEWNDYDKDGIPYWEKWD
Ga0208593_103710413300020511FreshwaterMSKMNDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNNND
Ga0208364_1001571153300020533FreshwaterMTNPDRDRSMRLKLAIEEMLKDIDMSGEEWNDRDKDGIPYWEKWHKAD
Ga0208856_101113763300020548FreshwaterMRLKLVIEEMLKDIDMSGEEWNDRDKDGIPYWEKWHKADD
Ga0222713_10009969113300021962Estuarine WaterMSEMNDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKNGVAYWEKWDKND
Ga0222713_1012730873300021962Estuarine WaterQMSKMNDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNKND
Ga0222712_1002320713300021963Estuarine WaterDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKNGVAYWEKWDKND
Ga0244777_1006347583300024343EstuarineMSKMNEDFDRSMRLKLVIEDMLKDIDMSSEEWNDRDKDGVAYWEKWNKND
Ga0244775_1055179913300024346EstuarineVIEEMLKDIDMSGEEWNDRDKDGVAYWEKWHKADDR
Ga0244775_1082152123300024346EstuarineLKIVIEELLKDIDMSGEEWNDRDKDGVAYWEKWDK
Ga0208009_1001183193300027114Deep SubsurfaceMTNPDRDRSMRLKLAIEDMLKDIDMSGEEWNDRDKNGIAYWEKYSEEGTN
Ga0255074_103987713300027121FreshwaterMSNMNDGLDRSMRLKLVIEEMLKDIDMSGEEWNDRDKDGVAYWEKWNKND
Ga0255066_101764533300027131FreshwaterSIKMESLHGKRIQMSKMNDGLDRSMRLKLVIEEMLKDIDMSGEEWNDRDKDGVAYWEKWNKND
Ga0255066_102652913300027131FreshwaterLHGKRIQMSKMNDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNNND
Ga0208679_108461333300027247EstuarineAIGLSIKMESLHGKRIQMTEMTSVGDDFDRSMRLKRVIEEMLKDIDMSGEEWNDRDKDGVAYWEKWNKND
Ga0208439_102530233300027278EstuarineMSKMNEDFDRSMRLKRVIEEMLKDIDMSGEEWNDRDKDGVAYWEKWNKND
Ga0208440_107729213300027281EstuarineEDFDRSMRLKLVIEDMLKDIDMSSEEWNDRDKDGVAYWEKWNKND
Ga0208897_108982733300027571EstuarineDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNNND
Ga0209651_108697313300027581Freshwater LakeMSEMNDGLDRSMRLKLVIEEMLKDIDMSGEEWNDRDKDGVAYWEKWNKND
Ga0209356_113044033300027644Freshwater LakeMSEMNDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNKND
Ga0209033_108622113300027697Freshwater LakeRLKLAIEEMLKDIDMSGEEWNDRDKDGVAYWEKWDKADDR
Ga0209617_1006427443300027720Freshwater And SedimentMTEMTSVGDDFDRSMRLKRVIEEMLKDIDMSGEEWNDRDKDGVAYWEKWHKADDR
Ga0208305_1010182853300027753EstuarineRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNNND
Ga0209107_1000273633300027797Freshwater And SedimentMTEMTSLGDDFDRSMRLKLVIEEMLKDIDMSGEEWNDRDKDGIPYWEKWHKADD
Ga0209107_1003440113300027797Freshwater And SedimentMSEMNDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVA
Ga0209358_1003788313300027804Freshwater LakeMRLKLAIEEMLKDIDMSGEEWNDRDKDGVAYWEKWDKADDR
Ga0209358_1031904913300027804Freshwater LakeVTNPDRDRSMRLKLAIEEMLKDIDMSGEEWNDRDKDDVAYWEKWDK
Ga0209550_1070852013300027892Freshwater LakePDRSMRLKLVIEEMLKDIDMSGEEWNDRDKNGIPYWEKGGEA
Ga0315909_1034571013300031857FreshwaterMTNPDRNRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGIPYWEKWHKADD
Ga0315909_1053066613300031857FreshwaterKIVIEEMLKDIDMSGEEWNDRDKNGVAYWEKWDKNG
Ga0315904_1101008023300031951FreshwaterMTNLDQNRSMRLKLVIEEMLKDIDMSGEEWNDRDKDGIPYWEKWHKADDR
Ga0315906_1058011333300032050FreshwaterMTNPDRNRSMRLKLVIEEMLKDIDMSGEEWNDRDKDGIPYWEKWHKADD
Ga0315903_1112616533300032116FreshwaterMNDRDRSMRLKLAIEEMLKDIDMSGEEWNDYDKDGVPYWKKWHTNGRSESDSK
Ga0334977_0405110_1_1653300033978FreshwaterMESLHGKRIQMSKMNDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEK
Ga0334982_0368663_448_5733300033981FreshwaterMRLKLAIEDMLKDIDMSGEEWNDRDKNGIAYWEKYSEEETN
Ga0334992_0000229_46135_462783300033992FreshwaterMSDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNKND
Ga0334992_0032927_1743_19253300033992FreshwaterMESLHGKRIQMSKMNDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWDKND
Ga0334991_0067594_1_1203300034013FreshwaterMSDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYW
Ga0334991_0168416_23_1423300034013FreshwaterMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWDKND
Ga0335002_0080771_207_3893300034020FreshwaterMENLRGKRIQMSKMNDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNKND
Ga0334983_0581743_483_6023300034060FreshwaterMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNKND
Ga0334990_0002101_7940_81223300034068FreshwaterMESLHGKRIQMSKMNDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNNND
Ga0335020_0435254_227_3703300034082FreshwaterMNDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNKND
Ga0335012_0579556_1_1173300034093FreshwaterMRLKLAIEDMLKDIDMSGEEWNDRDKNGIAYWEKYSEEE
Ga0335029_0041793_1400_15823300034102FreshwaterMESLHGKRIQMSKINDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNKND
Ga0335016_0046610_3294_34073300034166FreshwaterKLVIEEMLKDIDMSGEEWNDRDKDGIPYWEKWHKADD
Ga0335061_0001160_13154_132733300034168FreshwaterMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNNND
Ga0335065_0641396_131_2503300034200FreshwaterMRLKLVIEEMLKDIDMSGEKWNDRDKNGIPYWEKERGDK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.