Basic Information | |
---|---|
Family ID | F092146 |
Family Type | Metagenome |
Number of Sequences | 107 |
Average Sequence Length | 46 residues |
Representative Sequence | IVFSDVNNQTVELFEMLGLTRHVVLAKDEREALLNLSHFETAPTVH |
Number of Associated Samples | 89 |
Number of Associated Scaffolds | 107 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 92.52 % |
Associated GOLD sequencing projects | 78 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.35 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (100.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (12.149 % of family members) |
Environment Ontology (ENVO) | Unclassified (51.402 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (69.159 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.38% β-sheet: 2.70% Coil/Unstructured: 68.92% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 107 Family Scaffolds |
---|---|---|
PF13492 | GAF_3 | 28.97 |
PF01966 | HD | 14.95 |
PF01590 | GAF | 4.67 |
PF00498 | FHA | 1.87 |
PF13487 | HD_5 | 0.93 |
PF12401 | FhaA_N | 0.93 |
PF13549 | ATP-grasp_5 | 0.93 |
PF13174 | TPR_6 | 0.93 |
PF08239 | SH3_3 | 0.93 |
PF01425 | Amidase | 0.93 |
PF13185 | GAF_2 | 0.93 |
PF03486 | HI0933_like | 0.93 |
PF00069 | Pkinase | 0.93 |
COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.74 |
COG0493 | NADPH-dependent glutamate synthase beta chain or related oxidoreductase | Amino acid transport and metabolism [E] | 1.87 |
COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.87 |
COG0029 | Aspartate oxidase | Coenzyme transport and metabolism [H] | 0.93 |
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.93 |
COG0446 | NADPH-dependent 2,4-dienoyl-CoA reductase, sulfur reductase, or a related oxidoreductase | Lipid transport and metabolism [I] | 0.93 |
COG0492 | Thioredoxin reductase | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.93 |
COG1053 | Succinate dehydrogenase/fumarate reductase, flavoprotein subunit | Energy production and conversion [C] | 0.93 |
COG1249 | Dihydrolipoamide dehydrogenase (E3) component of pyruvate/2-oxoglutarate dehydrogenase complex or glutathione oxidoreductase | Energy production and conversion [C] | 0.93 |
COG2072 | Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcD | Inorganic ion transport and metabolism [P] | 0.93 |
COG2081 | Predicted flavoprotein YhiN | General function prediction only [R] | 0.93 |
COG2509 | FAD-dependent dehydrogenase | General function prediction only [R] | 0.93 |
COG3634 | Alkyl hydroperoxide reductase subunit AhpF | Defense mechanisms [V] | 0.93 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 100.00 % |
Unclassified | root | N/A | 0.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000033|ICChiseqgaiiDRAFT_c0252501 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_105165731 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
3300000550|F24TB_11696910 | All Organisms → cellular organisms → Bacteria | 2310 | Open in IMG/M |
3300000559|F14TC_101645678 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300000956|JGI10216J12902_104975376 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
3300001464|JGI12363J15224_100279 | All Organisms → cellular organisms → Bacteria | 9760 | Open in IMG/M |
3300004019|Ga0055439_10241666 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300004081|Ga0063454_101272732 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300004480|Ga0062592_101565278 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300004643|Ga0062591_101172964 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
3300005093|Ga0062594_100680532 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
3300005290|Ga0065712_10739414 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300005340|Ga0070689_100723524 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
3300005340|Ga0070689_101204697 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
3300005356|Ga0070674_101572221 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300005364|Ga0070673_100851688 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
3300005366|Ga0070659_100584762 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
3300005458|Ga0070681_11622237 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300005468|Ga0070707_101148144 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
3300005545|Ga0070695_100948478 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300005545|Ga0070695_101025712 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300005547|Ga0070693_100240373 | All Organisms → cellular organisms → Bacteria | 1196 | Open in IMG/M |
3300005549|Ga0070704_100091739 | All Organisms → cellular organisms → Bacteria | 2266 | Open in IMG/M |
3300005563|Ga0068855_100617374 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
3300005578|Ga0068854_100362571 | All Organisms → cellular organisms → Bacteria | 1189 | Open in IMG/M |
3300005614|Ga0068856_100655756 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
3300005614|Ga0068856_101602005 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
3300005615|Ga0070702_101814155 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300005617|Ga0068859_100092753 | All Organisms → cellular organisms → Bacteria | 3071 | Open in IMG/M |
3300005617|Ga0068859_101021988 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
3300005618|Ga0068864_100208432 | All Organisms → cellular organisms → Bacteria | 1799 | Open in IMG/M |
3300005618|Ga0068864_100591317 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
3300005618|Ga0068864_102481030 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300005834|Ga0068851_10766413 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300005841|Ga0068863_100193190 | All Organisms → cellular organisms → Bacteria | 1956 | Open in IMG/M |
3300005841|Ga0068863_102276121 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300005842|Ga0068858_101767574 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
3300005843|Ga0068860_100192789 | All Organisms → cellular organisms → Bacteria | 1972 | Open in IMG/M |
3300005843|Ga0068860_101712704 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
3300005873|Ga0075287_1008007 | All Organisms → cellular organisms → Bacteria | 1253 | Open in IMG/M |
3300006358|Ga0068871_100358783 | All Organisms → cellular organisms → Bacteria | 1291 | Open in IMG/M |
3300006844|Ga0075428_101237681 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
3300006847|Ga0075431_101346441 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
3300006854|Ga0075425_100324559 | All Organisms → cellular organisms → Bacteria | 1772 | Open in IMG/M |
3300006876|Ga0079217_11274160 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300006881|Ga0068865_100820633 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
3300006918|Ga0079216_10884684 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
3300006954|Ga0079219_11371397 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
3300009098|Ga0105245_10132059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2343 | Open in IMG/M |
3300009147|Ga0114129_12106705 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
3300009148|Ga0105243_10116958 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2240 | Open in IMG/M |
3300009162|Ga0075423_11160118 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
3300009162|Ga0075423_11972328 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
3300009162|Ga0075423_12102245 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
3300009545|Ga0105237_11943301 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300010036|Ga0126305_11200546 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300010039|Ga0126309_10272180 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
3300010045|Ga0126311_10661910 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
3300010359|Ga0126376_10231436 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1557 | Open in IMG/M |
3300010375|Ga0105239_12021302 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
3300010396|Ga0134126_12628779 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300010397|Ga0134124_10869235 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
3300010397|Ga0134124_11388602 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
3300010399|Ga0134127_11467516 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
3300010400|Ga0134122_11492511 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
3300010400|Ga0134122_12190974 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300010400|Ga0134122_13307393 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300010403|Ga0134123_12816332 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300011119|Ga0105246_10658497 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
3300013102|Ga0157371_11036092 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300013297|Ga0157378_12935291 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300013307|Ga0157372_12701486 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300014325|Ga0163163_10466784 | All Organisms → cellular organisms → Bacteria | 1323 | Open in IMG/M |
3300015262|Ga0182007_10109306 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
3300015371|Ga0132258_13454436 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
3300015374|Ga0132255_101323269 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
3300015374|Ga0132255_104246207 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300018422|Ga0190265_12641397 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300018476|Ga0190274_10767086 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
3300021082|Ga0210380_10282353 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
3300025901|Ga0207688_10705418 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
3300025901|Ga0207688_10971207 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 537 | Open in IMG/M |
3300025918|Ga0207662_10837717 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
3300025922|Ga0207646_10979077 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
3300025927|Ga0207687_10070693 | All Organisms → cellular organisms → Bacteria | 2492 | Open in IMG/M |
3300025932|Ga0207690_10222467 | All Organisms → cellular organisms → Bacteria | 1445 | Open in IMG/M |
3300025934|Ga0207686_10139896 | All Organisms → cellular organisms → Bacteria | 1671 | Open in IMG/M |
3300025935|Ga0207709_11055478 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
3300025937|Ga0207669_10799747 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
3300025938|Ga0207704_11076446 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300025938|Ga0207704_11694163 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300025940|Ga0207691_10900308 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
3300025942|Ga0207689_10276034 | All Organisms → cellular organisms → Bacteria | 1392 | Open in IMG/M |
3300025981|Ga0207640_10345389 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
3300026035|Ga0207703_11841659 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300026041|Ga0207639_11821033 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300026078|Ga0207702_10610682 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
3300026078|Ga0207702_12010530 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300026089|Ga0207648_12212774 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300026095|Ga0207676_10562856 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
3300026095|Ga0207676_11513687 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300027909|Ga0209382_11326034 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
3300031716|Ga0310813_12165459 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300031852|Ga0307410_10025472 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 3713 | Open in IMG/M |
3300031908|Ga0310900_11882731 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300032002|Ga0307416_101380707 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
3300032004|Ga0307414_11874943 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 12.15% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 8.41% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 7.48% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.48% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.54% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 5.61% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.80% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.80% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.80% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.80% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.80% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.80% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.80% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.80% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.80% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.80% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.87% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.87% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.87% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.87% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.93% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.93% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.93% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.93% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.93% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.93% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.93% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.93% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.93% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001464 | Forest soil microbial communities from Browns Valley, California, USA, that are Nitrogen fertilized - NN91 | Environmental | Open in IMG/M |
3300004019 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005873 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301 | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
ICChiseqgaiiDRAFT_02525011 | 3300000033 | Soil | EVNNQTVQLFEMLGLTRHVALAENENEALLTLSGFETTPIVH* |
INPhiseqgaiiFebDRAFT_1051657311 | 3300000364 | Soil | EKNGARIVFSDVNIQTIQLFEMLGLTRHVVLAKDEQEALSNLSGFDAKKVAH* |
F24TB_116969101 | 3300000550 | Soil | PVALFDMLGLTRHVVLAKDENEALSGLSILSAPPTVH* |
F14TC_1016456781 | 3300000559 | Soil | EKNGAQVVFSEVNLQTVALFDMLGLTRHVALAKDEREALLSLSDFDTTPLSH* |
JGI10216J12902_1049753762 | 3300000956 | Soil | IVFSEVNNQTVQLFEMLGLTRHVALAENENEALLTLSDFETTPIIH* |
JGI12363J15224_10027911 | 3300001464 | Soil | TVQLFEMLGLTRHVALAKDEREALLNLSHFETTTPVVH* |
Ga0055439_102416661 | 3300004019 | Natural And Restored Wetlands | KNDAQVVFSDVNSQTIQLFDMLGLTRHVLLAKDEQEAISNLSDFLTSPIVQQ* |
Ga0063454_1012727322 | 3300004081 | Soil | KCGAQLIFSDVNHQTIQLFDVLGLTRHVALVSDEHEALTRLSQSSAA* |
Ga0062592_1015652782 | 3300004480 | Soil | SGAKIAFSEVNSQTVQLFEMLGLTQHVVLAKDEHEALLTLSEFETTPIVH* |
Ga0062591_1011729642 | 3300004643 | Soil | VFSEVNNQTVELFEMLGLTRHVALAKDEHEALLNLSNYETMPVVH* |
Ga0062594_1006805321 | 3300005093 | Soil | GARIAFSEVNNETVQLFEMLGLTRHVVLAKDEREALMNLSPYETTPIVH* |
Ga0065712_107394141 | 3300005290 | Miscanthus Rhizosphere | GARIIFAEVNNQTVQLFEMLGLTRHVLLAKDEHEALLNLAGYETTPTVH* |
Ga0070689_1007235241 | 3300005340 | Switchgrass Rhizosphere | EVNNQTVQLFEMLGLTRHVVLAKDEREALINLSLFETTTPVVH* |
Ga0070689_1012046971 | 3300005340 | Switchgrass Rhizosphere | AEKSGAQIVFSDVNNQTVELFDMLGLTRHVALAKDEQEALSNISQLDPTPTLH* |
Ga0070674_1015722212 | 3300005356 | Miscanthus Rhizosphere | FADVNNQTVELFDMLGLTRHVALAKDEQEALLTLSTTVSGFDSTPTVH* |
Ga0070673_1008516881 | 3300005364 | Switchgrass Rhizosphere | QIVFSDVNNQTVELFDMLGLTRHVVLAKDEQEALINLSGFETTPVVH* |
Ga0070659_1005847622 | 3300005366 | Corn Rhizosphere | FSDVNIQTIQLFEMLGLTRHVVLAKDEQEALSNLSGFDAKKVAH* |
Ga0070681_116222372 | 3300005458 | Corn Rhizosphere | DVNNQTVELFDMLGLTRHVALAKDEQEALLTLSTTVSGFDSTPTVH* |
Ga0070707_1011481442 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | IVFSDVNNQTVELFEMLGLTRHVVLAKDEREALLNLSHFETAPTVH* |
Ga0070695_1009484782 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | IAEKSDARVVFSDVNNQTVQLFEMLGLTRHVILAKNEQEALTSLTGYGAQSTTPTGH* |
Ga0070695_1010257122 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | RIVFSEVNHPTIQLFEMLGLTRHVALAKDEREALNSLSTFETTPLVN* |
Ga0070693_1002403731 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | FSDVNNQTIQLFDMLGLTRHVALARNEQEALSTLSGFNSTPTVH* |
Ga0070704_1000917391 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | KNGARIVFSEVNLPTVELFEMLGLTRHVVLAKDESEALMNLSRLETTTPVVH* |
Ga0068855_1006173742 | 3300005563 | Corn Rhizosphere | QIVFSEVNNPTIELFEMLGLTRHVVLAKDESEALMNLSRLETTPPVVH* |
Ga0068854_1003625711 | 3300005578 | Corn Rhizosphere | VVFSDVNNQTVELFQMLGLTRHVALAKNEQEALSDLSTLSSSPTLHLN* |
Ga0068856_1006557561 | 3300005614 | Corn Rhizosphere | TVQLFEMLGLTRHVVLAKDEREALMNLSPYETTPIVH* |
Ga0068856_1016020052 | 3300005614 | Corn Rhizosphere | GAKIAFSEVNSQTVQLFEMLGLTRHVVLAKNESEALLTLSDFKTTSISPLI* |
Ga0070702_1018141551 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | KNGARIIFAEVNNQTVQLFEMLGLTRHVLLAKDEHEALLNLAGYETTPTVH* |
Ga0068859_1000927531 | 3300005617 | Switchgrass Rhizosphere | EVNNQTVELFEMLGLTRHVVLAKDEREALNNLSHCEATPVVH* |
Ga0068859_1010219881 | 3300005617 | Switchgrass Rhizosphere | KNGAKVIFADVNNQTVELFQMLGLTRHVALAKNEQEALSDLTHPDATPTIH* |
Ga0068864_1002084321 | 3300005618 | Switchgrass Rhizosphere | QIVFSDVNNQTIELFEMLGLTRHVLLAKDEREALLNLSRFETTTPVVH* |
Ga0068864_1005913171 | 3300005618 | Switchgrass Rhizosphere | RVIFADVNNQTIELFQMLGLTRHVALAKNQEEALSDLSRPDPTPTLH* |
Ga0068864_1024810302 | 3300005618 | Switchgrass Rhizosphere | EVNNQTVELFEMLGLTRHVVLAKDEREAVNNLSHCEATPIVH* |
Ga0068851_107664132 | 3300005834 | Corn Rhizosphere | QTIQLFEMLGLTRHVLLAKDEREAILNLSQFETTPVVH* |
Ga0068863_1001931903 | 3300005841 | Switchgrass Rhizosphere | LFEMLGLTRHVVLAKDEREALINLSLFETTTPVVH* |
Ga0068863_1022761211 | 3300005841 | Switchgrass Rhizosphere | LFEMLGLTRHVVLAKDEREALTNLSVFETTTPVVH* |
Ga0068858_1017675741 | 3300005842 | Switchgrass Rhizosphere | LFEMLGLTRHVVLAKDEREALMNLSHYETTPIVH* |
Ga0068860_1001927893 | 3300005843 | Switchgrass Rhizosphere | SGAQIVFSDVNNQTVELFEMLGLTRHVALAKDEREALLNLSHFETTTPVVH* |
Ga0068860_1017127041 | 3300005843 | Switchgrass Rhizosphere | AQIVFSDVNNQTVELFDMLGLTRHVVLAKDEQEALINLSGFETTPVVH* |
Ga0075287_10080072 | 3300005873 | Rice Paddy Soil | AQIVFSDVNNQTVELFDMLGLTRHVVLAKDEREALLNLSRFETTPVVH* |
Ga0068871_1003587832 | 3300006358 | Miscanthus Rhizosphere | SDVNNQTVELFDMLGLTRHVALAKNEQEALSTISRLDPTPTLH* |
Ga0075428_1012376812 | 3300006844 | Populus Rhizosphere | EVNRQTVELFEMLGLTRHVVLAKDEREALLNLSNYEASHIVH* |
Ga0075431_1013464411 | 3300006847 | Populus Rhizosphere | FSDVNHQTVALFDMLGLTRHVVLAKDETEALSGLSILSAPPTVH* |
Ga0075425_1003245593 | 3300006854 | Populus Rhizosphere | KNHARVVFSDLNSQTVQLFEMLGLTRHVVLARDEEEALSTLSEFALPSAAISH* |
Ga0079217_112741601 | 3300006876 | Agricultural Soil | TIELFEMLGLTRHVVLAKDEREALLNLSDYETTPIVH* |
Ga0068865_1008206331 | 3300006881 | Miscanthus Rhizosphere | NNQTVELFDMLGLTRHVALAKDEQEALSNISQLDPTPTLH* |
Ga0079216_108846842 | 3300006918 | Agricultural Soil | VFSEVNSQTEQLFEMLGLTRHVALAKDEREALLNISRYETTPLVN* |
Ga0079219_113713971 | 3300006954 | Agricultural Soil | RIAFSEVNHETVQLFEMLGLTRHVVLAKDEHEALLNLSRYETAPIVH* |
Ga0105245_101320591 | 3300009098 | Miscanthus Rhizosphere | IVFSDVNNQTVQLFEMLGLTRHVALAKDEREALLNLSHFETTTPVVH* |
Ga0114129_121067051 | 3300009147 | Populus Rhizosphere | VNTQTEQLFEMLGLTRHVLLAKDEREALLNISRCETTPIVH* |
Ga0105243_101169583 | 3300009148 | Miscanthus Rhizosphere | VAEKSGAQIVFSDVNNQTVELFEMLGLTRHVALAKDEREALLNLSHFETTTPVVH* |
Ga0075423_111601181 | 3300009162 | Populus Rhizosphere | QTVELFEMLGLTRHVVLAKDEREALINLSLFETTTPVVH* |
Ga0075423_119723281 | 3300009162 | Populus Rhizosphere | IELFEMLGLTRHVVLAKNEHEALLNLSGLATIPIAP* |
Ga0075423_121022452 | 3300009162 | Populus Rhizosphere | SDVNNQTIQLFDMLGLTRHVALARNEQEALSTLSGFNSTPTLH* |
Ga0105237_119433011 | 3300009545 | Corn Rhizosphere | SGAQIVFSDVNNQTVELFEMLGLTRHVLLAKDEREALLNLSRFEATTPVVH* |
Ga0126305_112005462 | 3300010036 | Serpentine Soil | VFAGVNNETIQLFQLLGLTLHVVLAKDENEALMNLSDFETTPIIH* |
Ga0126309_102721801 | 3300010039 | Serpentine Soil | EVNHQTVELFEMLGLTRHVVLAKDEREALINLSGLETTPVVH* |
Ga0126311_106619102 | 3300010045 | Serpentine Soil | SEVNNETVKLFEMLGLTRHVVLAKDEREAILNLSLFETTPLVH* |
Ga0126376_102314361 | 3300010359 | Tropical Forest Soil | IELFTMLGLTRHVALAKNEQEALSTLSGFNSTPTLH* |
Ga0105239_120213022 | 3300010375 | Corn Rhizosphere | AQIVFSDVNHQTIELFEMLGLTRHVVLAKDEREALMSLSGFETTPIVH* |
Ga0134126_126287791 | 3300010396 | Terrestrial Soil | VNNQTVELFEMLGLTRHVVLAKDEQEAILNLSQFETSPVVH* |
Ga0134124_108692351 | 3300010397 | Terrestrial Soil | NNQTVELFEMLGLTRHVVLAKDEREALLNLSNYETTQIVH* |
Ga0134124_113886022 | 3300010397 | Terrestrial Soil | FSEVNNETVQLFEMLGLTRHVLLAKDEHEALLNLSAYETTPTVH* |
Ga0134127_114675162 | 3300010399 | Terrestrial Soil | GAQIVFSEVNNPTIELFEMLGLTRHVVLAKDESEALMNLSRLETTPPVVH* |
Ga0134122_114925111 | 3300010400 | Terrestrial Soil | TVQLFEMLGLTQHVVLAKDEHEALLTLSEFETTPIVH* |
Ga0134122_121909741 | 3300010400 | Terrestrial Soil | QIVFSDVNNQTVQLFEMLGLTRHVVLAKDEREALLNLSHFETTTPAVH* |
Ga0134122_133073933 | 3300010400 | Terrestrial Soil | GAQIVFSEVNSQTLQLFEVLGLTRHVVLAKDEEEAILNLSRYETTPVVH* |
Ga0134123_128163322 | 3300010403 | Terrestrial Soil | RIVFSEVNNQTVQLFEMLGLTRHVVLAKDEREALINLSLFETTPIVH* |
Ga0105246_106584971 | 3300011119 | Miscanthus Rhizosphere | SGAKIVFSEVSTETVQLFEMLGLTRHVGLAKDEREALLTLSSFETTPIVH* |
Ga0157371_110360921 | 3300013102 | Corn Rhizosphere | NQTVELFDMLGLTRHVALAKDEQEALLTLSTTVSGFDSTPTVH* |
Ga0157378_129352911 | 3300013297 | Miscanthus Rhizosphere | KSGAKIVFSEVSTETVQLFEMLGLTRHVVLAKDEREALLTLSGFETTPIVH* |
Ga0157372_127014861 | 3300013307 | Corn Rhizosphere | KSGAQVVFSDVNNQTIQLFDMLGLTRHVALAKNEQEALSTLSGFNPMPTLH* |
Ga0163163_104667841 | 3300014325 | Switchgrass Rhizosphere | EKNGARVIFADVNNQTIELFQMLGLTRHVALAKNQEEALSDLSRPDPTPTLH* |
Ga0182007_101093061 | 3300015262 | Rhizosphere | EKSGAQIVFADVNNQTVELFQMLGLTRHVVLAKDEQEAILNLAQFETTPVVH* |
Ga0132258_134544362 | 3300015371 | Arabidopsis Rhizosphere | SEVNNQTVELFEMLGLTRHVDLAKDEHEALLNLSNYETMPIVH* |
Ga0132255_1013232692 | 3300015374 | Arabidopsis Rhizosphere | EKSGARIAFSEVNNQTIGLFEMLGLTRHVVLAKDEREAVINLSRFEAAPIVH* |
Ga0132255_1042462072 | 3300015374 | Arabidopsis Rhizosphere | QTVQLFEMLGLTRHVVLAKDEREALNNLSRFETTTPVVH* |
Ga0190265_126413971 | 3300018422 | Soil | KSGARVAFSEVNRQTIELFEMLGLTRHVLLAKDEREALLNLSNYESTHVIH |
Ga0190274_107670862 | 3300018476 | Soil | AFSEVNNETVQLFEMLGLTRHVVLAKDEREALLNLSHYETTPIVH |
Ga0210380_102823532 | 3300021082 | Groundwater Sediment | QTVQLFDMLGLTRHVSLAKDKDEALTNLSGFGTQPNVH |
Ga0207688_107054181 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | TVELFDMLGLTRHVALAKDEQEALLTLSTTVSGFDSTPTVH |
Ga0207688_109712071 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | IQLFEMLGLTRQVLLAKDEREAILNLSQFETTPVVH |
Ga0207662_108377171 | 3300025918 | Switchgrass Rhizosphere | VFSEVNSQTEQLFEMLGLTRHVVLAKDEREALLNISRYETSPIVH |
Ga0207646_109790771 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | ARIVFSDVNNQTVELFEMLGLTRHVVLAKDEREALLNLSHFETAPTVH |
Ga0207687_100706934 | 3300025927 | Miscanthus Rhizosphere | DVNNETVELFDMLGLTRHVALAKDEQEALLTLSTTVSGFDSTPTVH |
Ga0207690_102224671 | 3300025932 | Corn Rhizosphere | SGAQIVFSDVNNQTVELFDMLGLTRHVVLAKDEQEALLSLSQFETTPVVH |
Ga0207686_101398963 | 3300025934 | Miscanthus Rhizosphere | NNQTVELFDMLGLTRHVALAKDEQEALSNISQLDPTPTLH |
Ga0207709_110554782 | 3300025935 | Miscanthus Rhizosphere | VAEKSGAQIVFSDVNNQTVELFEMLGLTRHVALAKDEREALLNLSHFETTTPVVH |
Ga0207669_107997472 | 3300025937 | Miscanthus Rhizosphere | NQTVELFEMLGLTRHVALAKDEREALLNLSHFETTNTVVH |
Ga0207704_110764461 | 3300025938 | Miscanthus Rhizosphere | QIVFSDVNNQTVELFDMLGLTRHVALAKDEQEALSNISQLDPTPTLH |
Ga0207704_116941631 | 3300025938 | Miscanthus Rhizosphere | IAFSEVNNQTVELFEMLGLTRHVVLAKDEREAVNNLSHCEATPIVH |
Ga0207691_109003081 | 3300025940 | Miscanthus Rhizosphere | EKNGAKVIFADVNNQTVELFQMLGLTRHVALAKNEQEALSDLTHPDATPTIH |
Ga0207689_102760342 | 3300025942 | Miscanthus Rhizosphere | AQIVFSDVNNQTVELFEMLGLTRHVLLAKDEREALLNLSRFETTTPVVH |
Ga0207640_103453892 | 3300025981 | Corn Rhizosphere | VVFSDVNNQTVELFQMLGLTRHVALAKNEQEALSDLSTLSSSPTLHLN |
Ga0207703_118416592 | 3300026035 | Switchgrass Rhizosphere | ELFEMLGLTRHVALAKDEREALLNLSHFETTTPVVH |
Ga0207639_118210332 | 3300026041 | Corn Rhizosphere | AEKNGARIIFAEVNNQTVQLFEMLGLTRHVLLAKDEHEALLNLAGYETTPTVH |
Ga0207702_106106821 | 3300026078 | Corn Rhizosphere | ETVQLFEMLGLTRHVVLAKDEREALMNLSPYETTPIVH |
Ga0207702_120105301 | 3300026078 | Corn Rhizosphere | DVNHQTIQLFEMLGLTRHVLLAKDEREAILNLSQFETTPVVH |
Ga0207648_122127741 | 3300026089 | Miscanthus Rhizosphere | AEKNGAQIVFSDVNNQTIELFEMLGLTRHVLLAKDEREALLNLSRFEATTPVVH |
Ga0207676_105628561 | 3300026095 | Switchgrass Rhizosphere | EKNGARVIFADVNNQTIELFQMLGLTRHVALAKNQEEALSDLSRPDPTPTLH |
Ga0207676_115136872 | 3300026095 | Switchgrass Rhizosphere | IVFSDVNNQTIELFEMLGLTRHVLLAKDEREALLNLSRFEATTPVVH |
Ga0209382_113260341 | 3300027909 | Populus Rhizosphere | EVNRQTVELFEMLGLTRHVVLAKDEREALLNLSNYEASHIVH |
Ga0310813_121654592 | 3300031716 | Soil | IVFSDVNNQTVELFEMLGLTRHVVLAKDEQEAILNLSQFETTPVVH |
Ga0307410_100254721 | 3300031852 | Rhizosphere | GARIAFSEVNNETVQLFEMLGLTRHVVLAKDEREALMNLSHYETTTPVVH |
Ga0310900_118827312 | 3300031908 | Soil | AKIAFSEVNVQTTQLFEMLGLTRHVVLAKDEREALLTLSGFEPTPIVH |
Ga0307416_1013807071 | 3300032002 | Rhizosphere | NPTIELFEMLGLTRHVVLAKDESEALMNLSRLETTPPVVH |
Ga0307414_118749431 | 3300032004 | Rhizosphere | IFSEVNSQTVELFEMLGLTRHVILAKDEREALLNISRYETTPIVH |
⦗Top⦘ |