NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F092243

Metagenome Family F092243

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F092243
Family Type Metagenome
Number of Sequences 107
Average Sequence Length 43 residues
Representative Sequence VGVSAIVWGQIQVGNFSPIYGLAIAAAGFPVHHLWKRFKRSA
Number of Associated Samples 97
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.95 %
% of genes near scaffold ends (potentially truncated) 97.20 %
% of genes from short scaffolds (< 2000 bps) 97.20 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction Yes
3D model pTM-score0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (89.720 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(19.626 % of family members)
Environment Ontology (ENVO) Unclassified
(40.187 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(38.318 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 50.00%    β-sheet: 0.00%    Coil/Unstructured: 50.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF01042Ribonuc_L-PSP 52.34
PF01168Ala_racemase_N 13.08
PF14031D-ser_dehydrat 5.61
PF11999Ice_binding 3.74
PF00440TetR_N 3.74
PF08240ADH_N 2.80
PF13360PQQ_2 2.80
PF04851ResIII 1.87
PF13602ADH_zinc_N_2 1.87
PF00211Guanylate_cyc 0.93
PF12146Hydrolase_4 0.93
PF12833HTH_18 0.93
PF069833-dmu-9_3-mt 0.93
PF00561Abhydrolase_1 0.93
PF12704MacB_PCD 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG0251Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 familyDefense mechanisms [V] 52.34
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 0.93
COG2764Zn-dependent glyoxalase, PhnB familyEnergy production and conversion [C] 0.93
COG3865Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferaseGeneral function prediction only [R] 0.93

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms89.72 %
UnclassifiedrootN/A10.28 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908032|Perma_A_C_ConsensusfromContig19233All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium834Open in IMG/M
2124908044|A5_c1_ConsensusfromContig61257All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium859Open in IMG/M
3300002568|C688J35102_118586841All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium574Open in IMG/M
3300004156|Ga0062589_102637730All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium522Open in IMG/M
3300004782|Ga0062382_10578014All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300005167|Ga0066672_10799557All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium593Open in IMG/M
3300005171|Ga0066677_10082922All Organisms → cellular organisms → Bacteria1668Open in IMG/M
3300005176|Ga0066679_10053053All Organisms → cellular organisms → Bacteria2342Open in IMG/M
3300005177|Ga0066690_10404366All Organisms → cellular organisms → Bacteria926Open in IMG/M
3300005179|Ga0066684_10981860All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300005440|Ga0070705_100329490All Organisms → cellular organisms → Bacteria1105Open in IMG/M
3300005441|Ga0070700_100837393All Organisms → cellular organisms → Bacteria → Acidobacteria744Open in IMG/M
3300005447|Ga0066689_10225418All Organisms → cellular organisms → Bacteria1146Open in IMG/M
3300005450|Ga0066682_10781466All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium578Open in IMG/M
3300005518|Ga0070699_101570739All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium603Open in IMG/M
3300005546|Ga0070696_101248436All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300005575|Ga0066702_10127340All Organisms → cellular organisms → Bacteria1485Open in IMG/M
3300005578|Ga0068854_100751779All Organisms → cellular organisms → Bacteria846Open in IMG/M
3300005718|Ga0068866_10873541All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium630Open in IMG/M
3300006046|Ga0066652_101290218All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium689Open in IMG/M
3300006237|Ga0097621_101433467All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium654Open in IMG/M
3300006797|Ga0066659_10363078All Organisms → cellular organisms → Bacteria1127Open in IMG/M
3300006806|Ga0079220_11744467All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium546Open in IMG/M
3300006871|Ga0075434_100862888Not Available920Open in IMG/M
3300007076|Ga0075435_100857991All Organisms → cellular organisms → Bacteria → Acidobacteria791Open in IMG/M
3300007255|Ga0099791_10119459All Organisms → cellular organisms → Bacteria1221Open in IMG/M
3300007255|Ga0099791_10368393All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium689Open in IMG/M
3300007265|Ga0099794_10725380All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium530Open in IMG/M
3300009012|Ga0066710_100492041All Organisms → cellular organisms → Bacteria1847Open in IMG/M
3300009012|Ga0066710_100552753All Organisms → cellular organisms → Bacteria1742Open in IMG/M
3300009137|Ga0066709_102146686All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300009143|Ga0099792_10064796All Organisms → cellular organisms → Bacteria1825Open in IMG/M
3300009597|Ga0105259_1055141Not Available891Open in IMG/M
3300009792|Ga0126374_11781126All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium514Open in IMG/M
3300009812|Ga0105067_1022127Not Available887Open in IMG/M
3300009814|Ga0105082_1034504Not Available815Open in IMG/M
3300010304|Ga0134088_10187054All Organisms → cellular organisms → Bacteria991Open in IMG/M
3300010304|Ga0134088_10397058All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium672Open in IMG/M
3300010333|Ga0134080_10238924All Organisms → cellular organisms → Bacteria798Open in IMG/M
3300010403|Ga0134123_12864774All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium551Open in IMG/M
3300011402|Ga0137356_1067124Not Available680Open in IMG/M
3300011430|Ga0137423_1061496Not Available1115Open in IMG/M
3300011445|Ga0137427_10085242Not Available1267Open in IMG/M
3300012198|Ga0137364_10168299All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1594Open in IMG/M
3300012203|Ga0137399_11519348All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium557Open in IMG/M
3300012203|Ga0137399_11725425All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium515Open in IMG/M
3300012205|Ga0137362_10624000All Organisms → cellular organisms → Bacteria929Open in IMG/M
3300012211|Ga0137377_11078457All Organisms → cellular organisms → Bacteria733Open in IMG/M
3300012211|Ga0137377_11472037All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium608Open in IMG/M
3300012356|Ga0137371_11099368All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium598Open in IMG/M
3300012359|Ga0137385_11178808All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium627Open in IMG/M
3300012359|Ga0137385_11661200All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium503Open in IMG/M
3300012359|Ga0137385_11661202All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium503Open in IMG/M
3300012363|Ga0137390_11958130All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium513Open in IMG/M
3300012685|Ga0137397_10905930All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium654Open in IMG/M
3300012918|Ga0137396_10231345All Organisms → cellular organisms → Bacteria1362Open in IMG/M
3300012918|Ga0137396_10405257All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1011Open in IMG/M
3300012929|Ga0137404_10849919All Organisms → cellular organisms → Bacteria831Open in IMG/M
3300012944|Ga0137410_11905156All Organisms → cellular organisms → Bacteria → Acidobacteria527Open in IMG/M
3300012955|Ga0164298_11667713All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium505Open in IMG/M
3300013100|Ga0157373_11285089All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium554Open in IMG/M
3300014157|Ga0134078_10674800All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium504Open in IMG/M
3300014326|Ga0157380_12222791All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300015201|Ga0173478_10402036All Organisms → cellular organisms → Bacteria656Open in IMG/M
3300015254|Ga0180089_1010851All Organisms → cellular organisms → Bacteria1582Open in IMG/M
3300015372|Ga0132256_101540501All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium775Open in IMG/M
3300018000|Ga0184604_10170412All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium730Open in IMG/M
3300018028|Ga0184608_10104818All Organisms → cellular organisms → Bacteria → Proteobacteria1184Open in IMG/M
3300018071|Ga0184618_10104591All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1114Open in IMG/M
3300018084|Ga0184629_10554681All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium591Open in IMG/M
3300018482|Ga0066669_11364704All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium642Open in IMG/M
3300019868|Ga0193720_1054804All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium557Open in IMG/M
3300020001|Ga0193731_1019479All Organisms → cellular organisms → Bacteria1769Open in IMG/M
3300020004|Ga0193755_1213055Not Available542Open in IMG/M
3300020059|Ga0193745_1010601All Organisms → cellular organisms → Bacteria1985Open in IMG/M
3300021953|Ga0213880_10014775All Organisms → cellular organisms → Bacteria1656Open in IMG/M
3300022534|Ga0224452_1254619All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium537Open in IMG/M
3300025910|Ga0207684_10871202All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300025931|Ga0207644_10904749All Organisms → cellular organisms → Bacteria → Proteobacteria740Open in IMG/M
3300025939|Ga0207665_10435792All Organisms → cellular organisms → Bacteria1003Open in IMG/M
3300025940|Ga0207691_11124481Not Available653Open in IMG/M
3300025981|Ga0207640_10418601All Organisms → cellular organisms → Bacteria1096Open in IMG/M
3300026067|Ga0207678_11167049All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium682Open in IMG/M
3300026078|Ga0207702_11021027All Organisms → cellular organisms → Bacteria820Open in IMG/M
3300026089|Ga0207648_11465086All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium642Open in IMG/M
3300026316|Ga0209155_1097525All Organisms → cellular organisms → Bacteria1069Open in IMG/M
3300026324|Ga0209470_1061903All Organisms → cellular organisms → Bacteria1765Open in IMG/M
3300026329|Ga0209375_1280230All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium547Open in IMG/M
3300026507|Ga0257165_1027405All Organisms → cellular organisms → Bacteria983Open in IMG/M
3300027669|Ga0208981_1178393All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium536Open in IMG/M
3300027840|Ga0209683_10131774All Organisms → cellular organisms → Bacteria1139Open in IMG/M
3300028072|Ga0247675_1020698All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium944Open in IMG/M
3300028138|Ga0247684_1075543All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium555Open in IMG/M
3300028713|Ga0307303_10173435All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium526Open in IMG/M
3300028791|Ga0307290_10093326All Organisms → cellular organisms → Bacteria1097Open in IMG/M
3300028828|Ga0307312_10328785All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium998Open in IMG/M
3300031199|Ga0307495_10048862All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium858Open in IMG/M
3300031548|Ga0307408_100578018All Organisms → cellular organisms → Bacteria995Open in IMG/M
3300031740|Ga0307468_100319712All Organisms → cellular organisms → Bacteria1139Open in IMG/M
3300031740|Ga0307468_100397990All Organisms → cellular organisms → Bacteria1050Open in IMG/M
3300031740|Ga0307468_102407271All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300031911|Ga0307412_11622328All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria591Open in IMG/M
3300032005|Ga0307411_11543790All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300032180|Ga0307471_100253562All Organisms → cellular organisms → Bacteria1814Open in IMG/M
3300034178|Ga0364934_0192556All Organisms → cellular organisms → Bacteria772Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil19.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil10.28%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil9.35%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil5.61%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.61%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.74%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.74%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.74%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.80%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.80%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.80%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere2.80%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment1.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil1.87%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.87%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.87%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.93%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.93%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.93%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.93%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.93%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.93%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.93%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.93%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908032Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Perma_allEnvironmentalOpen in IMG/M
2124908044Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5EnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004782Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2FreshEnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009597Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT299EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009812Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_50_60EnvironmentalOpen in IMG/M
3300009814Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011402Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT830_2EnvironmentalOpen in IMG/M
3300011430Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2EnvironmentalOpen in IMG/M
3300011444Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2EnvironmentalOpen in IMG/M
3300011445Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015254Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10DEnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019868Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s1EnvironmentalOpen in IMG/M
3300020001Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2EnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300020059Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2EnvironmentalOpen in IMG/M
3300021953Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R07EnvironmentalOpen in IMG/M
3300022534Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026316Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)EnvironmentalOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes)EnvironmentalOpen in IMG/M
3300026507Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-BEnvironmentalOpen in IMG/M
3300027669Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027840Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300028072Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK16EnvironmentalOpen in IMG/M
3300028138Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25EnvironmentalOpen in IMG/M
3300028713Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300031199Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_SEnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031911Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1Host-AssociatedOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300034178Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Perma_A_C_006585702124908032SoilTVAGLTAIVWGEIENGNYTPLYGLAIAAAGFPVHQVWKRMGPAERDAAQV
A5_c1_003331402124908044SoilVSAIVWGEIQVGNFSPIYGLGIALAGFPVHHLWKRLKRSA
C688J35102_11858684113300002568SoilLFVIGTIVGVSAIVWGEIQVGNFSPIYGLLIAAAGFPVHHLWNRWKRST*
Ga0062589_10263773023300004156SoilVGLSAIVWGQIKAGNFSPIYGLFIAAGGLPVYHFWKRLKRTS*
Ga0062382_1057801423300004782Wetland SedimentFGTLAGVSAIVWGEVQVGNFSPIYGLGIAAAGFPVHHLWKQLKAKL*
Ga0066672_1079955713300005167SoilGTVVGVSAIVWGQIQVGNFSPIYGLAIAAAGFPVHHLWKRFKRSA*
Ga0066677_1008292213300005171SoilVGVSAIVWGQIQVGNFSPIYGLAIAAAGFPVHHLWKRFKRSA*
Ga0066679_1005305313300005176SoilGTVVGVSAIVWGQIQVGNLSPVYGLAIAAAGFPVHQLWKRLQRSP*
Ga0066690_1040436633300005177SoilGTVVGVSAIVWGQMQVGNVSPVYGLGIAAAGFPVHYLWKRLTRTA*
Ga0066684_1098186033300005179SoilFVFGTILGVSAIVWGEVQVGNFSPLYGLAIALAGFPVHHLWKRLKRIP*
Ga0070705_10032949033300005440Corn, Switchgrass And Miscanthus RhizosphereVTAIVWGQIRAGNFAPIYGLGIAAAGFPVHYLWKRWKRS*
Ga0070700_10083739323300005441Corn, Switchgrass And Miscanthus RhizosphereIGTLIGLAAIVWGEIEVGNYSPVYGLAIAAAGFPVYHLWKRLAKPGGPSA*
Ga0066689_1022541813300005447SoilGTVVGLSAIVGGQIQVGNFSPVYGLGIAVAGFPVHFLWKRLKRSA*
Ga0066682_1078146613300005450SoilGTVVGLSAIVGGQIQVGNYSPIYGLGIAAAGFPVHYLWKRLKRIA*
Ga0070699_10157073933300005518Corn, Switchgrass And Miscanthus RhizosphereLSFILGTVVGLSAIVWGQIQVGNLAPIYGLAIAAAGFPVHHLWKRLKRSA*
Ga0070696_10124843633300005546Corn, Switchgrass And Miscanthus RhizosphereGLSAIVWGQIQVGNYAPIYGLLIAAAGFPVHQLWKRLKRSS*
Ga0066702_1012734033300005575SoilGTVVGVSAIVWGQIQVGNFSPVYGLGIAAAGFPVHHLWKRLQRSP*
Ga0068854_10075177933300005578Corn RhizosphereFVVGTIIGLSAILWGQIQVGNYSPVYGLLIALAGFPVHQLWKGLKRSS*
Ga0068866_1087354113300005718Miscanthus RhizosphereGTLAGVTAIVWGQIRAGNFAPIYGLAIAAAGFPVHYLWKRWKRS*
Ga0066652_10129021813300006046SoilWGQIQVGNFSPIYGLLIAAAGFPVYQLWKRLKRSP*
Ga0097621_10143346713300006237Miscanthus RhizosphereVGTLIGLSAIVWGQIQVGNFAPIYGLLIAAAGFPVHQLWKRLKRSS*
Ga0066659_1036307833300006797SoilGVSAIVWGQIQVGNVSPVYGLGIAAAGFPVHYLWKRLKRSA*
Ga0079220_1174446713300006806Agricultural SoilAIVWGQINVGNFSPIYGLGIAAAGFPIYHLWQRMKRST*
Ga0075434_10086288823300006871Populus RhizosphereSAIVWGQIQVGNFAPLYGLGIAAAGFPVHHLWQRFKKHERGV*
Ga0075435_10085799123300007076Populus RhizosphereIVWGEIAVGNYSPVYGLAIAAAGFPVYHLWRRLAKDRSLTA*
Ga0099791_1011945933300007255Vadose Zone SoilIGLSAIVWGQIQVGNFAPIYGLGIAAAGFPVHYLWKRLKRTA*
Ga0099791_1036839313300007255Vadose Zone SoilLSAIIWGQIQVHNFSPIYGLAIAAAGFPVHQLWKRLNRSPVT*
Ga0099794_1072538013300007265Vadose Zone SoilTVVGVSAIVWGQIQVGNFSPIYGLAIAVAGFPVHHLWKRLKRSP*
Ga0066710_10049204143300009012Grasslands SoilGTVVGLSAIVGGQIQVGNFSPIYGLAIAVAGFPVHYLWKRLKRSQ
Ga0066710_10055275313300009012Grasslands SoilVGLSAIVWGEIQVGNFSPIYGLGIAAAGFPVHYLWKRLQRSP
Ga0066709_10214668633300009137Grasslands SoilVGLSAIVWGEIQVGNFSPIYGLGIAAAGFPVHYLWKRLQRSP*
Ga0099792_1006479643300009143Vadose Zone SoilGQIQVKNFAPIYGLGIAAAGFPVHYLWKRLKRIA*
Ga0105259_105514123300009597SoilLFVIGTVIGLSAIVWGQIQVGNYAPLYGLAIAAAGFPVHHLWKRWKRV*
Ga0126374_1178112623300009792Tropical Forest SoilIFVSGTVVGLSAIVWGALQAGNVSPIYGLGIAVAGFPVYYLWKRVQRSA*
Ga0105067_102212713300009812Groundwater SandVVGLSAIVWGEIQVGNFSPIYGLAIAAAGFPVHHLWQRFKRRPQASSPN*
Ga0105082_103450423300009814Groundwater SandLSAIVWGQIQVGNYSPLYGLGIAAAGFPVHHLWKRLKRSPQASSPN*
Ga0134088_1018705433300010304Grasslands SoilTVVGVSAIVWGQIQVGNFSPMYGLGIAAAGFPVHHLWKRLKRS*
Ga0134088_1039705823300010304Grasslands SoilLGTVVGVSAIVWGQIQVDNFSPVYGLGIAVAGFPVHYLWKRLKRSQ*
Ga0134080_1023892433300010333Grasslands SoilAIVWGQIQVGNFSPVYGLAIAVAGFPVHYLWKRLKRIA*
Ga0134123_1286477423300010403Terrestrial SoilLSAIVWGQIRVGNYAPIYGLGIAAAGFPVHYLWKRLKRS*
Ga0137356_106712413300011402SoilIVWGQIQIDNFSPIYGLAIAAAGFPVHHLWKRLKRSA*
Ga0137423_106149613300011430SoilLSAIVWGQIQVGNYAPLYGLAIAAAGFPVHHLWKRWKRV*
Ga0137463_110105113300011444SoilIQVGNFSPIYGLAIAAAGFPVHHLWTRLKRSPAP*
Ga0137427_1008524223300011445SoilWGQIQVGNYAPLYGLAIAAAGFPVHHLWKRWKRV*
Ga0137364_1016829913300012198Vadose Zone SoilIVWGEIQVGNFSPIYGLAIALAGFPVHQLWKRLKRNQ*
Ga0137399_1151934813300012203Vadose Zone SoilILGTVVGLSAIVWGQIQVHNFSPVYGLGIAAAGFPVHYLWKRLKRSA*
Ga0137399_1172542523300012203Vadose Zone SoilSAIVWGQIQVGNFSPIYGLGIAAAGFPVHHLWKRVKRV*
Ga0137362_1062400023300012205Vadose Zone SoilFLIGTVVGLSAIVGGQIQIGNFSPVYGLAIAVAGFPVHYLWKRVQRSA*
Ga0137377_1107845723300012211Vadose Zone SoilGTVVGLSAIVGGQIQVGNFSPIYGLGIAAAGFPVHHLWKRLQRSA*
Ga0137377_1147203733300012211Vadose Zone SoilVSAIVWGQIQVGNFSPVYGLVIAVAGFPVHYLWKRLKRTA*
Ga0137371_1109936813300012356Vadose Zone SoilIVWGQIQVGNFSPVYGLVIAVAGFPVHYLWKRLKRTA*
Ga0137385_1117880833300012359Vadose Zone SoilLGTVIGVSAIVWGQIQVGNFAPVYGLAIAVAGFPVHYLWKQLKRSP*
Ga0137385_1166120023300012359Vadose Zone SoilFLIGTVVGLSAIVGGQIHVGNFSPVYGLAIAVAGFPVHYFWKRLKRIA*
Ga0137385_1166120223300012359Vadose Zone SoilLGTVIGVSAIVWGQIQVGNFAPVYGLAIAVAGFPVHYLWKRLKRSAPP*
Ga0137390_1195813023300012363Vadose Zone SoilLSAIVGGQIQVGNFSPVYGLAIAVAGFPVHYLWKRLKRIA*
Ga0137397_1090593013300012685Vadose Zone SoilTIVGLSAIVWGQIQVGNFSPVYGLGIAVAGFPVHHLWKRLQRSP*
Ga0137396_1023134513300012918Vadose Zone SoilLSAIVGGQIQVGNFSPIYGLTIAAAGFPVHHLWKRLQRSA*
Ga0137396_1040525713300012918Vadose Zone SoilTVIGLWAIVWGQIQVGNFAPLYGLAIAAAGFPVHYLWKRLTRIA*
Ga0137404_1084991913300012929Vadose Zone SoilAIVWGQIQVHNFAPLYGLAIAAAGFPVHHLWKRLKRSPVT*
Ga0137410_1190515623300012944Vadose Zone SoilLGTVIGLTAIVWGEIVVGNYSPVYGLAIAAAGFPVYHLWKRLAGGRSLNA*
Ga0164298_1166771323300012955SoilVVGTVAGLTAIVWGQINVGNFSPIYGLAIAAAGFPIYHLWQRVKRSR*
Ga0157373_1128508923300013100Corn RhizosphereGTVAGLTAIVWGQINVGNLSPIYGLGIAAAGFPIYHLWQRMKRST*
Ga0134078_1067480013300014157Grasslands SoilLFVFGTILGVSAIVWGEIQVGNFSPIYGLAIALAGFPVHHLWKRLKRIP*
Ga0157380_1222279113300014326Switchgrass RhizosphereLGTVIGVTAIVWGEIQAGNYSPMYGLCIAAAGFPVHHVWKRWH*
Ga0137420_124817913300015054Vadose Zone SoilFAPIYGGNFAPIYGLAIAAAGFPVHYLWKRLQRSP*
Ga0173478_1040203623300015201SoilLCFVVGTLAGVSAIVWGEIDGGNYSPLYGLFIAAAGFPVHHVWRRLGR*
Ga0180089_101085133300015254SoilLSAIVWGQIQVGNFSPIYGLAIAAAGFPVHHLWKRLQRSP*
Ga0132256_10154050133300015372Arabidopsis RhizosphereLFVFGTVVGVSAIVWGEIQVGNFSPIYGLGIALAGFPVHHLWKRLQRTA*
Ga0184604_1017041233300018000Groundwater SedimentVGLSAIVWGEIQVGNFSPIYGLGIALAGFPVHHLWKRLKRSP
Ga0184608_1010481833300018028Groundwater SedimentGLSAIVWGEIQVGNFSPLYGLAIAAAGFPVHHLWKRVKMSR
Ga0184618_1010459133300018071Groundwater SedimentWGEIQVGNFSPIYGLAIALAGFPVHHLWKRLKRSQ
Ga0184629_1055468123300018084Groundwater SedimentFILGTVVGLSAIVWGQVQVGNFAPIYGLAFAAAGFPVHHLWKRFKRSPPT
Ga0066669_1136470433300018482Grasslands SoilAGLSAIVWGQIQVRNFSPIYGLIIAAAGFPVHHLWKRLTRSA
Ga0193720_105480423300019868SoilLLFVVGTLVGVSAIVWGEIQVGNFSPIYGLAIAIAGFPVHQLWKRLKRNQ
Ga0193731_101947913300020001SoilGTLVGVSAIVWGEIQVGNFSPIYGLAIAIAGFPVHQLWKRLKRNQ
Ga0193755_121305523300020004SoilFILGTVVGLSAIVWGQIQIHNYSPVYGLGIAVAGFPVHYLWKRLKRSPQASSPN
Ga0193745_101060143300020059SoilIVWGEIQVGNFSPIYGLLIAAAGFPVHQLWKRLKRSS
Ga0213880_1001477513300021953Exposed RockTAIVWGQINVGNFSPIYGLGIAAAGFPIYHLWQRMKRST
Ga0224452_125461923300022534Groundwater SedimentLLFVIGTIIGVSAIVWGEIQVGNFSPIYGLAIAIAGFPVHQLWKRLKRNQ
Ga0207684_1087120213300025910Corn, Switchgrass And Miscanthus RhizosphereVVGLSAIVWGQVQVGNFAPIYGLAIAAAGFPVHHLWKRLKSP
Ga0207644_1090474913300025931Switchgrass RhizosphereVWGQIQVGNFSPIYGLLIAAAGFPVHQLWKRLKRSE
Ga0207665_1043579223300025939Corn, Switchgrass And Miscanthus RhizosphereMTALKVIGLTAIVWGEITVGNYSPLYGLAIAAAGFPVYHVWKRLTHE
Ga0207691_1112448113300025940Miscanthus RhizosphereVVGTLAGVSAIVWGEIDGGNYSPLYGLFIAAAGFPVHHVWRRLGR
Ga0207640_1041860113300025981Corn RhizosphereSAILWGQIQVGNFSPIYGLIIAAAGFPVYQLWKRMKRSS
Ga0207678_1116704913300026067Corn RhizosphereVLFVLGTLVGLSAIVWGQIKVGNYSPIYGLLIAAAGFPVHHLWQRMKRNA
Ga0207702_1102102733300026078Corn RhizosphereTVVGLSAIVWGQVQVRNFSPIYGLLIAAAGFPVYHLWKRLERSQ
Ga0207648_1146508633300026089Miscanthus RhizosphereGTLAGVTAIVWGQIRAGNFAPIYGLAIAAAGFPVHYLWKRWKRS
Ga0209155_109752513300026316SoilMLGTVVGLSAIVWGEIQVGNFSPIYGLGIAAAGFPVHYLWKRLQRST
Ga0209470_106190313300026324SoilAIVWGQIQVGNFSPMYGLGIAAAGFPVHHLWERLKRS
Ga0209375_128023023300026329SoilVVGLSAIVWGEIQVGNFSPIYGLGIAAAGFPVHYLWKRLQRST
Ga0257165_102740533300026507SoilVGLSAIVWGALQAGNVSPIYGLGIAVAGFPVHYVWKRLQRSA
Ga0208981_117839323300027669Forest SoilTVVGLSAIVWGQIKVDNYSPIYGLGIAAAGFPVHYVWQRLKRSA
Ga0209683_1013177423300027840Wetland SedimentFGTLAGVSAIVWGEVQVGNFSPIYGLGIAAAGFPVHHLWKQLKAKL
Ga0247675_102069833300028072SoilAAIVWGALQAGNVSPIYGLGIAVAGFPVFYVWKRLQRSS
Ga0247684_107554323300028138SoilVVGLAAIVWGALQAGNVSPIYGLGIAVAGFPVFYVWKRLQRSS
Ga0307303_1017343513300028713SoilIVWGEIQVGNFSPIYGLAIALAGFPVHHLWKRLKRTQ
Ga0307290_1009332633300028791SoilFVIGTIIGVSAIVWGEIQVGNFSPIYGLAIALAGFPVHHLWKRLKRSQ
Ga0307312_1032878513300028828SoilGTFIGLTAIVWGEIVVGNYSPVYGLAIAAAGFPVYHLWKRFASGRSLNA
Ga0307495_1004886233300031199SoilIGLSAIVWGQIQVGNFAPIYGLGIALAGFPVHHLWKRLQRSA
Ga0307408_10057801813300031548RhizosphereTIVGVSAIVWGQIQVGNFSPIYGLGVAAAGFPVHHLWKRLKRSA
Ga0307468_10031971213300031740Hardwood Forest SoilVGTIVGLSAIVWGQIQVRNFAPIYGLGIAAAGFPVHYLWKRFTRSA
Ga0307468_10039799023300031740Hardwood Forest SoilIVWGQIQVGNYAPIYGLGIAAAGFPVYHLWKRFQPTPGGRL
Ga0307468_10240727123300031740Hardwood Forest SoilFFILGTIVGLSAIVWGQIQVGNYSPIYGLGIAAAGFPVHHLWKRFQKLP
Ga0307412_1162232823300031911RhizosphereVSGEFQAGNYSPMYGLGIAAAGFPVHHVWKRWRSGRSDA
Ga0307411_1154379023300032005RhizosphereIGVTAIVWGEIEAGNYSPIYGLCIAAAGFPVHQVWKSRK
Ga0307471_10025356243300032180Hardwood Forest SoilVWGQVQVGNFSPIYGLAIAAAGFPVHYLWTRLKRSPLP
Ga0364934_0192556_9_1523300034178SedimentVLGTVAGLSAIVWGQIQVGNFSPIYGLAIAAAGFPVHHLWKRFKRGP

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.