NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F092623

Metagenome / Metatranscriptome Family F092623

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F092623
Family Type Metagenome / Metatranscriptome
Number of Sequences 107
Average Sequence Length 43 residues
Representative Sequence PETAALGHALVRKARHVPGVVAVRDRLTYPDTYPIVAGPVF
Number of Associated Samples 93
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.94 %
% of genes near scaffold ends (potentially truncated) 98.13 %
% of genes from short scaffolds (< 2000 bps) 87.85 %
Associated GOLD sequencing projects 87
AlphaFold2 3D model prediction Yes
3D model pTM-score0.36

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (90.654 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(22.430 % of family members)
Environment Ontology (ENVO) Unclassified
(22.430 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(33.645 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 18.84%    β-sheet: 11.59%    Coil/Unstructured: 69.57%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.36
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF00583Acetyltransf_1 24.30
PF13607Succ_CoA_lig 19.63
PF13380CoA_binding_2 14.95
PF13302Acetyltransf_3 12.15
PF13420Acetyltransf_4 4.67
PF00144Beta-lactamase 1.87
PF09364XFP_N 0.93
PF14691Fer4_20 0.93
PF00990GGDEF 0.93
PF00571CBS 0.93
PF13185GAF_2 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 1.87
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 1.87
COG2367Beta-lactamase class ADefense mechanisms [V] 1.87


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.65 %
UnclassifiedrootN/A9.35 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004977|Ga0072329_1029984Not Available514Open in IMG/M
3300005175|Ga0066673_10717588All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia575Open in IMG/M
3300005345|Ga0070692_11227929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia535Open in IMG/M
3300005353|Ga0070669_101568990All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia573Open in IMG/M
3300005436|Ga0070713_100045630All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales3592Open in IMG/M
3300005436|Ga0070713_100047863All Organisms → cellular organisms → Bacteria3517Open in IMG/M
3300005436|Ga0070713_100060661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales3162Open in IMG/M
3300005436|Ga0070713_102044995All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300005437|Ga0070710_10712029All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia709Open in IMG/M
3300005439|Ga0070711_100642844All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales889Open in IMG/M
3300005445|Ga0070708_100682065All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia967Open in IMG/M
3300005471|Ga0070698_100801871All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia886Open in IMG/M
3300005566|Ga0066693_10224877All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia738Open in IMG/M
3300005618|Ga0068864_101195722All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia759Open in IMG/M
3300006028|Ga0070717_10320711All Organisms → cellular organisms → Bacteria1380Open in IMG/M
3300006173|Ga0070716_100178083All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1393Open in IMG/M
3300006173|Ga0070716_101484628All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales554Open in IMG/M
3300006603|Ga0074064_11763728All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia664Open in IMG/M
3300006954|Ga0079219_10700744All Organisms → cellular organisms → Bacteria → Terrabacteria group770Open in IMG/M
3300009176|Ga0105242_12957763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia526Open in IMG/M
3300009700|Ga0116217_10867490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia554Open in IMG/M
3300010159|Ga0099796_10322948All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia659Open in IMG/M
3300010343|Ga0074044_10091216All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2053Open in IMG/M
3300010371|Ga0134125_10268612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1895Open in IMG/M
3300010373|Ga0134128_10920102All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia968Open in IMG/M
3300010379|Ga0136449_100951140All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1391Open in IMG/M
3300010379|Ga0136449_102162878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia813Open in IMG/M
3300010379|Ga0136449_102739459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia698Open in IMG/M
3300010400|Ga0134122_12992137All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia527Open in IMG/M
3300010858|Ga0126345_1060146All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1283Open in IMG/M
3300010876|Ga0126361_10618416All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1080Open in IMG/M
3300011068|Ga0138599_1030136All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia819Open in IMG/M
3300011083|Ga0138560_1179503All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia614Open in IMG/M
3300012360|Ga0137375_11276377All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia556Open in IMG/M
3300012960|Ga0164301_10250134Not Available1163Open in IMG/M
3300013296|Ga0157374_12276714All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia569Open in IMG/M
3300014162|Ga0181538_10202768All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1112Open in IMG/M
3300014968|Ga0157379_10537581All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1086Open in IMG/M
3300015373|Ga0132257_102262416All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia704Open in IMG/M
3300017946|Ga0187879_10744966Not Available546Open in IMG/M
3300017974|Ga0187777_10274885Not Available1147Open in IMG/M
3300018001|Ga0187815_10095828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1250Open in IMG/M
3300018007|Ga0187805_10591869All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia524Open in IMG/M
3300018034|Ga0187863_10249629All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia986Open in IMG/M
3300018038|Ga0187855_10656984All Organisms → cellular organisms → Bacteria → Terrabacteria group611Open in IMG/M
3300018086|Ga0187769_10309718All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1181Open in IMG/M
3300021374|Ga0213881_10150802All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1018Open in IMG/M
3300021388|Ga0213875_10667289Not Available504Open in IMG/M
3300021403|Ga0210397_10246321All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1295Open in IMG/M
3300021404|Ga0210389_10757335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia759Open in IMG/M
3300021475|Ga0210392_10582798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria829Open in IMG/M
3300022708|Ga0242670_1038920All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia642Open in IMG/M
3300022720|Ga0242672_1036000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia774Open in IMG/M
3300024279|Ga0247692_1081462All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia510Open in IMG/M
3300025905|Ga0207685_10820979All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria513Open in IMG/M
3300025911|Ga0207654_10401890All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia953Open in IMG/M
3300025916|Ga0207663_10018078All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3941Open in IMG/M
3300025916|Ga0207663_10866624All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia721Open in IMG/M
3300025924|Ga0207694_10139237All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1951Open in IMG/M
3300025928|Ga0207700_10033255All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3688Open in IMG/M
3300025928|Ga0207700_10421112All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1173Open in IMG/M
3300025928|Ga0207700_11292852All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia650Open in IMG/M
3300025929|Ga0207664_10358723All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1291Open in IMG/M
3300025937|Ga0207669_10893120All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia742Open in IMG/M
3300025939|Ga0207665_10202832All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1446Open in IMG/M
3300025939|Ga0207665_11282566All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia584Open in IMG/M
3300025942|Ga0207689_11121743All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia663Open in IMG/M
3300026067|Ga0207678_11702451All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia554Open in IMG/M
3300026142|Ga0207698_12158050All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia570Open in IMG/M
3300026552|Ga0209577_10443247All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia909Open in IMG/M
3300027915|Ga0209069_10910313All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium533Open in IMG/M
3300028714|Ga0307309_10146165All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia595Open in IMG/M
3300028828|Ga0307312_10069380All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2137Open in IMG/M
3300031035|Ga0074026_11066345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia726Open in IMG/M
3300031543|Ga0318516_10032389All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2767Open in IMG/M
3300031549|Ga0318571_10376402All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia550Open in IMG/M
3300031668|Ga0318542_10077081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1572Open in IMG/M
3300031719|Ga0306917_10404567All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1066Open in IMG/M
3300031744|Ga0306918_10740138All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia769Open in IMG/M
3300031768|Ga0318509_10571900All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia630Open in IMG/M
3300031771|Ga0318546_10785096All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia670Open in IMG/M
3300031771|Ga0318546_11002798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia587Open in IMG/M
3300031832|Ga0318499_10010258All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3020Open in IMG/M
3300031833|Ga0310917_10739229All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia666Open in IMG/M
3300031890|Ga0306925_10828892All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia957Open in IMG/M
3300031890|Ga0306925_11755370All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia596Open in IMG/M
3300031912|Ga0306921_10662493Not Available1202Open in IMG/M
3300031941|Ga0310912_10996482All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia643Open in IMG/M
3300031942|Ga0310916_10186532All Organisms → cellular organisms → Bacteria → Terrabacteria group1730Open in IMG/M
3300031946|Ga0310910_11092650All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia621Open in IMG/M
3300032041|Ga0318549_10307358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia715Open in IMG/M
3300032055|Ga0318575_10019284All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2829Open in IMG/M
3300032055|Ga0318575_10059611All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1772Open in IMG/M
3300032063|Ga0318504_10073862All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1486Open in IMG/M
3300032066|Ga0318514_10129115Not Available1300Open in IMG/M
3300032090|Ga0318518_10163570Not Available1133Open in IMG/M
3300032160|Ga0311301_11377754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia882Open in IMG/M
3300032261|Ga0306920_104099522Not Available527Open in IMG/M
3300032770|Ga0335085_10986723All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia911Open in IMG/M
3300032782|Ga0335082_10083020All Organisms → cellular organisms → Bacteria3215Open in IMG/M
3300032783|Ga0335079_10037829All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia5541Open in IMG/M
3300032805|Ga0335078_11169772All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia892Open in IMG/M
3300032805|Ga0335078_12047714All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia610Open in IMG/M
3300032829|Ga0335070_11314597All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia661Open in IMG/M
3300032898|Ga0335072_10580500All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1134Open in IMG/M
3300033134|Ga0335073_10780678All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1029Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil22.43%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere18.69%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil7.48%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil7.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.61%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.80%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.80%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.87%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.87%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.87%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.87%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil1.87%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.93%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.93%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.93%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.93%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.93%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.93%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.93%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004977Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 67 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006603Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010858Boreal forest soil eukaryotic communities from Alaska, USA - C3-2 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011068Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 67 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011083Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 45 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300021374Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08EnvironmentalOpen in IMG/M
3300021388Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8Host-AssociatedOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300022708Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022720Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024279Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028714Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300031035Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Humus N1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0072329_102998413300004977Peatlands SoilVTVAGSPETAALGHHIVHKVQHVQGVVAVRDHLSYPDVYPIVAGPVL*
Ga0066673_1071758823300005175SoilAPETASFGRALIRKARHVPGVVAVRDRLSYPDVYPVAAGPVF*
Ga0070692_1122792913300005345Corn, Switchgrass And Miscanthus RhizosphereGSPETAALGHDIVRKIRHVPGVVAVHDQLGYPDIYPIVAGPVF*
Ga0070669_10156899013300005353Switchgrass RhizosphereTMEGTPETAALGHALIRKARHVPGVVAVRDRLSYPDTYPVVAGPVF*
Ga0070674_10092254813300005356Miscanthus RhizosphereVTVQTGVVTAQGSPETAALGRDIVRKIRHVPGVVAVHQLSYPDTYPIVAGPVF*
Ga0070713_10004563013300005436Corn, Switchgrass And Miscanthus RhizosphereTPETAALGHALIRKARHVPGVVAVRDRLSYPDAYPVVAEPVF*
Ga0070713_10004786333300005436Corn, Switchgrass And Miscanthus RhizosphereESGVVTMEGTPETAALGHALIRKARHVPGVVAVRDRLSYPDTHPVVAGPVF*
Ga0070713_10006066113300005436Corn, Switchgrass And Miscanthus RhizospherePETAAFGRALIRKVRHVPGVVAVRDRLSYSDVYPVVAGPVF*
Ga0070713_10204499513300005436Corn, Switchgrass And Miscanthus RhizosphereESGVVTMEGTPETAALGHALIRKARHVPGVVAVRDRLSYPDTYPVVAGPVF*
Ga0070710_1071202913300005437Corn, Switchgrass And Miscanthus RhizosphereAGVVTVQGSPETAALGHDIVRKIRHVPGVVAVHDQLGYPDIYPIVAGPVF*
Ga0070711_10064284413300005439Corn, Switchgrass And Miscanthus RhizosphereGVVTLEGTPETAALGRSLVRKARHVRGVVAVRDRLSYPDVYPVIAGPVC*
Ga0070708_10068206513300005445Corn, Switchgrass And Miscanthus RhizosphereVTVQGSPETAALGHDIVRKIRHVPGVVAVHDELSYPDTYPIVAGPVF*
Ga0070698_10080187123300005471Corn, Switchgrass And Miscanthus RhizosphereGSPETAALGHDIVRKIRHVPGVVAVHDELSYPDTYPIVAGPVF*
Ga0066693_1022487713300005566SoilEGTPETAALGRALIRKARHVPGVVAVRDRLSYPDVYPVVAGPVF*
Ga0068864_10119572223300005618Switchgrass RhizosphereLGHALIRKARHVPGVVAVRDRLSYPDTHPVVAGPVF*
Ga0070717_1032071133300006028Corn, Switchgrass And Miscanthus RhizosphereESGVVTMEGTPETAALGHALIRKARHVPGVVAVRDRLSYPDAYPVVAEPVF*
Ga0070716_10017808313300006173Corn, Switchgrass And Miscanthus RhizosphereAALGHALIRKARHVPGVVAVRDRLSYPDTYPVVAGPVF*
Ga0070716_10148462813300006173Corn, Switchgrass And Miscanthus RhizosphereGVVTLEGTPETAALGRALVRKARHVRGVVAVRDLLSYPDVYPVIAGPVC*
Ga0074064_1176372823300006603SoilGHALIRKARHVPGVVAVRDRLSYPDTYPVVAGPVF*
Ga0079219_1070074413300006954Agricultural SoilTAALGRTLIRKARHVSGVVAVRDRLSYPDTYPVVAGPVF*
Ga0105242_1295776313300009176Miscanthus RhizosphereAALGHALIRKARHVPGVVAVRDRLSYPDVYPVVAGPVF*
Ga0116217_1086749013300009700Peatlands SoilTAALGHHIVGKVRHVQGVVAVRDQLSYPDVYPIVAGPVL*
Ga0099796_1032294823300010159Vadose Zone SoilMEGIPETAALGHALIRKARHVPGVVAVRDRLSYPDIYPVVASPVF*
Ga0074044_1009121613300010343Bog Forest SoilAALGHHIVDKVRDIQGVVAVRDQLSYPDVYPIVAGPVL*
Ga0134125_1026861213300010371Terrestrial SoilGTPETAALGQALIRKARHVPGVVAVRDRLSYPDTYPVVAGPVF*
Ga0134128_1092010223300010373Terrestrial SoilGSPETAALGHDIVRKIRHVPGVVAVHDQLSYPDTYPIVAGPVF*
Ga0136449_10095114023300010379Peatlands SoilVTVAGSPETAALGHHIVGKVRHVQGVVAVRDQLSYPDVYPIVAGPVL*
Ga0136449_10216287813300010379Peatlands SoilLQGSPETAALGHHIVRKIRHVQGVVAVRDSLSYPEVYPIVAGPVL*
Ga0136449_10273945923300010379Peatlands SoilETAALGHHIVHKVQHVQGVVAVRDHLSYPDVYPIVAGPVL*
Ga0134122_1299213713300010400Terrestrial SoilETAALGHDIVRKIRHVPGVVAVHDQLSYPDTYPIVAGPVF*
Ga0126345_106014613300010858Boreal Forest SoilTMEGTPETAALGHALIRKARHVPGVVAVRDRLSYPDIYPVVAGPVF*
Ga0126361_1061841613300010876Boreal Forest SoilALGHDIVRKIRHVQGVVAVRDRLSYPDAYPIVAGPLC*
Ga0138599_103013613300011068Peatlands SoilHHIVHKVQHVQGVVAVRDHLSYPDVYPIVAGPVL*
Ga0138560_117950313300011083Peatlands SoilPETAALGHHIVHKVQHVQGVVAVRDHLSYPDVYPIVAGPVL*
Ga0137375_1127637713300012360Vadose Zone SoilLGRALIRKARHVPGVVAVRDRLSYPDIYPVVAGPVF*
Ga0164301_1025013423300012960SoilHDIVRKIRHVPGLVAVHDQLGYPDTYPIVAGPVF*
Ga0157374_1227671413300013296Miscanthus RhizosphereGVVTVQGSPETAALGHDIVRKIRHVPGLVAVHDQLGYPDTYPIVAGPVF*
Ga0181538_1020276823300014162BogPETAALGHHIVHKVQHVEGVVAVRDHLSYPDVYPIVAGPVL*
Ga0157379_1053758123300014968Switchgrass RhizosphereAALGHDIVRKIRHVPGVVAVHQLSYPDTYPIVAGPVF*
Ga0132257_10226241613300015373Arabidopsis RhizosphereTPETAAFGRSLVRKARHVPGVVAVRDRLAYSDDYPVVAGPVL*
Ga0187879_1074496613300017946PeatlandSLGQDLVRKIRHVQGVVAVRDRLSYPEAFPIVAGPLF
Ga0187777_1027488513300017974Tropical PeatlandAAALGHALVRKARHVPGVVAVRDRLTYPDTTPVVAGPVS
Ga0187815_1009582813300018001Freshwater SedimentLGHHIVGKVRHVQGVVAVRDQLSYPDVYPIVAGPVL
Ga0187805_1059186923300018007Freshwater SedimentVEDGVVTLAGSPETAALGHHIVGKVRHVQGVVAVRDQLSYPDVYPIVAGPVL
Ga0187863_1024962923300018034PeatlandSLGQDLVRKIRHVQGVVAVRDRLSYPEVFPIVAGPIF
Ga0187855_1065698423300018038PeatlandGHDLVEKVRHVQGVVAVRDRLSYPDAFPVVVGPVF
Ga0187769_1030971823300018086Tropical PeatlandGRDLVRKARHVPGVVAVRDRLTYPDTYPVASGPLS
Ga0213881_1015080223300021374Exposed RockGRALVRKARHVPGVVAVRDRLSYSDDYPIAAGPVF
Ga0213875_1066728913300021388Plant RootsEGTPETAALGHHLMHRARHVAGVVAVRDRLSYPDTYPIVAGPQF
Ga0210397_1024632113300021403SoilGVVTVQGSPETAALGHDIVRKIRHVPGVVAVHDQLSYPDTYPIVAGRVF
Ga0210389_1075733523300021404SoilQGSPETAALGHDIARKIRHVPGVVAVHDQLSYPDTYPIVAGPVF
Ga0210392_1058279823300021475SoilVVTLEGNAETAALGHVIVRKVRHVQGVVAVRDRLTYPDVYASIAGPDSDPAIGRPR
Ga0242670_103892013300022708SoilALGHALVRKARHVPGVVAVRDRLTYPDNYPVVAGPVF
Ga0242672_103600013300022720SoilATAALGHDMVRRIRHVQGVVAVRDRLSYPDGYPIVAGPVF
Ga0247692_108146223300024279SoilAALGHALIRKARHVPGVVAVRDRLSYPDTYPVVAGPVF
Ga0207685_1082097933300025905Corn, Switchgrass And Miscanthus RhizosphereTMEGTPETAALGHALIRKARHVPGVVAVRDRLSYPDIYPVVAGPVF
Ga0207654_1040189023300025911Corn RhizosphereTVESGVVTMEGTPETAALGHALIRKARHVPGVVAVRDRLSYPDTYPVVAGPVF
Ga0207663_1001807833300025916Corn, Switchgrass And Miscanthus RhizosphereEGTPETAAFGRALIRKVRHVPGVVAVRDRLSYSDVYPVVAGPVF
Ga0207663_1086662413300025916Corn, Switchgrass And Miscanthus RhizosphereEGIPETAALGRALVRKARHIRGVVAVRDRLSHPVVAGPVF
Ga0207694_1013923713300025924Corn RhizosphereESGVVTMEGTPETAALGHALIRKARHVPGVVAVRDRLSYPDTHPVVAGPVF
Ga0207700_1003325513300025928Corn, Switchgrass And Miscanthus RhizosphereTMEGTPETAALGHALIRKARHVPGVVAVRDRLSYPDTHPVVAGPVF
Ga0207700_1042111213300025928Corn, Switchgrass And Miscanthus RhizosphereEGTPETAALGHALIRKARHVPGVVAVRDRLSYPDAYPVVAEPVF
Ga0207700_1129285223300025928Corn, Switchgrass And Miscanthus RhizosphereGVVTLEGTPETAALGRSLVRKARHVPGVVAVRDRLSYSDDYPIVAGPVF
Ga0207664_1035872313300025929Agricultural SoilPETAAFGRALIRKVRHVPGVVAVRDRLSYQDVYPVVAGPVF
Ga0207669_1089312023300025937Miscanthus RhizosphereTVESGVVTMEGTPETAALGHALIRKARHVPGVVAVRDRLSYPDTHPVVAGPVF
Ga0207665_1020283223300025939Corn, Switchgrass And Miscanthus RhizosphereALGHALIRKARHVPGVVAVRDRLSYPDTYPVVAGPVF
Ga0207665_1128256623300025939Corn, Switchgrass And Miscanthus RhizosphereSGVVTMEGTPETAALGHALIRKARHVPGVVAVRDRLSYPDTYPVVAGPVF
Ga0207689_1112174323300025942Miscanthus RhizosphereTMEGTPETAALGHALIRKARHVPGVVAVRDRLSYPDTYPVVAGPVF
Ga0207678_1170245123300026067Corn RhizosphereTVIVEDGVVTLEGIPETVALGRALVRKARHIRGVVAVRDRLSHPVVAGPVF
Ga0207698_1215805013300026142Corn RhizosphereGSPETAALGHDIVRKIRHVPGVVAVHDQLGYPDIYPIVAGPVF
Ga0209577_1044324713300026552SoilPETAAFGRALIRKARHVPGVVAVRDRLSYPDVYPVVAGPVF
Ga0209069_1091031323300027915WatershedsMEGCPETAALGRDLVRKARHVPGVVAVLDRLSYPDSYPVVGAPLS
Ga0307309_1014616513300028714SoilEGTPETAALGHTLIRKARHVPGVVAVRDRLSYPDVYPVVAGPVFGAGFS
Ga0307312_1006938033300028828SoilGRTLIRKARHVPGVVAVRDRLSYPDIYPVVAGPVL
Ga0074026_1106634513300031035SoilFQAGVVTLEGRPETAALGHDMVRRVRRVQGVVAVRDRLSYPDAYPVVAGPVSLTR
Ga0318516_1003238913300031543SoilSGVVTMEGCPETAALGRALVRKARHVRGVVAVRDRFTYPDTYPVVAGPVF
Ga0318571_1037640213300031549SoilGHALVRKARHVPGVVAVRDRLTYPDTSPVVAGPVF
Ga0318542_1007708113300031668SoilSGVVTMEGCPETAALGHALVRKARHVPGVVAVRDRLTYPDNYSIVSGPVF
Ga0306917_1040456723300031719SoilTMEGTPETAALGHALVRKARHVPGVVAVRDRLTYPDTYPVVAGPVL
Ga0306918_1074013823300031744SoilLGRALVRKARHVPGVVAVRDRLTYPDTYPVVAGPVV
Ga0318509_1057190023300031768SoilAALGRALVRKARHVPGVVAVRDRLTYPDTSPVVAGPVF
Ga0318546_1078509613300031771SoilSGVVTMEGCPETAALGRALVRKARHVPGVVAVRDRLTYPDTSPVVAGPVF
Ga0318546_1100279813300031771SoilPETAALGHALVRKARHVPGVVAVRDRLTYPDTYPIVAGPVF
Ga0318499_1001025833300031832SoilVVTMEGCPETAALGHALVRKARHVPGVVAVRDRLTYPDNYSIVSGPVF
Ga0310917_1073922913300031833SoilPETAALGHALVRKARHVPGVVAVRDRLTYPDNYSIVSGPVF
Ga0306925_1082889223300031890SoilVTMEGCPETAALGHALVRKARHVPGVVAVRDRLTYPDNYSIVSGPVF
Ga0306925_1175537023300031890SoilGHALVRKARHVPGVVAVRDRLTYPDTYPVVAGPVL
Ga0306921_1066249323300031912SoilGTPETAALGHALVRKARHVPGVVAVRDRLTYPDTYPVVAGPVL
Ga0310912_1099648223300031941SoilMEGTPETAALGHALVRKARHVPGVVAVRDRLTYPDTYPVVAGPVL
Ga0310916_1018653223300031942SoilGCPETAALGHALVRKARHVPGVVAVRDRLTYPDNYSIVSGPVF
Ga0310910_1109265013300031946SoilAALGHALVRKARHVPGVVAVRDRLTYPDTYPIVAGPVF
Ga0318549_1030735813300032041SoilTMEGTPETAALGRALVRKARHVPGVVAVRDRLTYPDTYPVVAGPVF
Ga0318575_1001928413300032055SoilCPETAALGHALVRKARHVPGVVAVRDRLTYPDNYSIVSGPVF
Ga0318575_1005961113300032055SoilRGNPETTELGHEIVRKVRHVPGVVAVRDRLSYPDDAPVAAAPLF
Ga0318504_1007386223300032063SoilVVTMEGCPETAALGHALVRKARHVPGVVAVRDRLTYPDTYPIVAGPVF
Ga0318514_1012911513300032066SoilEGTPETAALGHALVRKARHVPGVVAVRDRLTYPDTYPVVAGPVL
Ga0318518_1016357013300032090SoilGHALVRKARHVPGVVAVRDRLTYPDNYSIVSGPVF
Ga0311301_1137775413300032160Peatlands SoilLGHHIVHKVQHVQGVVAVRDHLSYPDVYPIVAGPVL
Ga0306920_10409952223300032261SoilVTMEGCPETAALGRALVRKARHVPGVVAVRDRLTYPDTYPVVAGPVV
Ga0335085_1098672313300032770SoilVVTLQGKPETAALGHEIVRKVRHVPGVVAVRDRLSYPDESPVVAAPLF
Ga0335082_1008302033300032782SoilEAGVVTLEGSPETTALGREIVRRVRHVPGVVAVRDRLSYPDDSPVVAAPLF
Ga0335079_1003782953300032783SoilVVTMEGTPETAALGRALVRKARHVPGVVAVRDRLTYPDTYPVVAGPVF
Ga0335078_1116977223300032805SoilPETAAFGRALIRKVRHVPGVVAVRDRLSYSDVYPVVAGPVF
Ga0335078_1204771413300032805SoilSGVVTMEGCPETTALGRALVRKARHVPGVVAVRDRLTYPDTYPVVAGPVF
Ga0335070_1131459713300032829SoilESGVVTMEGCPETAALGHALVRKARHVPGVVAVRDRFTYPDTYPVVAGPVL
Ga0335072_1058050013300032898SoilESGVVTMEGTPETAALGRALVRKARHVPGVVAVRDRLTYPDTYPVVAGPVL
Ga0335073_1078067833300033134SoilTVESGVVTLEGTPETAAFGHALIRKVRHVPGVVAVRDRLSYPDVYPVVAGPVF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.