NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F093445

Metagenome / Metatranscriptome Family F093445

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F093445
Family Type Metagenome / Metatranscriptome
Number of Sequences 106
Average Sequence Length 40 residues
Representative Sequence LARGAYKVLYQAGYRNMVILDEGIPGWAKKRYPTEKTVGKS
Number of Associated Samples 87
Number of Associated Scaffolds 106

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 79.25 %
% of genes near scaffold ends (potentially truncated) 23.58 %
% of genes from short scaffolds (< 2000 bps) 85.85 %
Associated GOLD sequencing projects 82
AlphaFold2 3D model prediction Yes
3D model pTM-score0.33

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.226 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil
(9.434 % of family members)
Environment Ontology (ENVO) Unclassified
(30.189 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(33.019 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 31.88%    β-sheet: 0.00%    Coil/Unstructured: 68.12%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.33
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 106 Family Scaffolds
PF00581Rhodanese 48.11
PF01523PmbA_TldD 14.15
PF00456Transketolase_N 6.60
PF03454MoeA_C 2.83
PF02779Transket_pyr 1.89
PF00535Glycos_transf_2 0.94
PF07978NIPSNAP 0.94
PF03737RraA-like 0.94
PF06271RDD 0.94
PF00005ABC_tran 0.94

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 106 Family Scaffolds
COG0312Zn-dependent protease PmbA/TldA or its inactivated homologGeneral function prediction only [R] 14.15
COG0021TransketolaseCarbohydrate transport and metabolism [G] 6.60
COG3959Transketolase, N-terminal subunitCarbohydrate transport and metabolism [G] 6.60
COG0303Molybdopterin Mo-transferase (molybdopterin biosynthesis)Coenzyme transport and metabolism [H] 2.83
COG0684RNA degradosome component RraA (regulator of RNase E activity)Translation, ribosomal structure and biogenesis [J] 0.94
COG1714Uncharacterized membrane protein YckC, RDD familyFunction unknown [S] 0.94

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.23 %
UnclassifiedrootN/A3.77 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_101890398All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium604Open in IMG/M
3300003319|soilL2_10211153All Organisms → cellular organisms → Bacteria1358Open in IMG/M
3300003995|Ga0055438_10090143All Organisms → cellular organisms → Bacteria853Open in IMG/M
3300004114|Ga0062593_100970154Not Available868Open in IMG/M
3300004114|Ga0062593_103238433All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300005186|Ga0066676_11106278All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium522Open in IMG/M
3300005328|Ga0070676_10726741All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300005332|Ga0066388_106644257All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300005332|Ga0066388_107468046All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300005440|Ga0070705_101350294All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300005445|Ga0070708_100231428All Organisms → cellular organisms → Bacteria1734Open in IMG/M
3300005467|Ga0070706_101578085Not Available599Open in IMG/M
3300005471|Ga0070698_100471664All Organisms → cellular organisms → Bacteria1191Open in IMG/M
3300005577|Ga0068857_100622929All Organisms → cellular organisms → Bacteria1021Open in IMG/M
3300005617|Ga0068859_101082476All Organisms → cellular organisms → Bacteria881Open in IMG/M
3300005617|Ga0068859_101764544All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300005618|Ga0068864_100238450All Organisms → cellular organisms → Bacteria1684Open in IMG/M
3300005713|Ga0066905_101318557All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300005764|Ga0066903_100357120All Organisms → cellular organisms → Bacteria2368Open in IMG/M
3300005764|Ga0066903_101091638All Organisms → cellular organisms → Bacteria1470Open in IMG/M
3300005764|Ga0066903_103299929All Organisms → cellular organisms → Bacteria872Open in IMG/M
3300005764|Ga0066903_105525919All Organisms → cellular organisms → Bacteria666Open in IMG/M
3300005764|Ga0066903_106134671All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300005843|Ga0068860_100081490All Organisms → cellular organisms → Bacteria3077Open in IMG/M
3300005981|Ga0081538_10010063All Organisms → cellular organisms → Bacteria7796Open in IMG/M
3300006845|Ga0075421_100125238All Organisms → cellular organisms → Bacteria3223Open in IMG/M
3300006847|Ga0075431_100275038All Organisms → cellular organisms → Bacteria1706Open in IMG/M
3300006852|Ga0075433_11092376All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Parcubacteria694Open in IMG/M
3300006854|Ga0075425_103117670All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300006894|Ga0079215_10538085All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300009090|Ga0099827_10197748All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1670Open in IMG/M
3300009094|Ga0111539_10983796All Organisms → cellular organisms → Bacteria981Open in IMG/M
3300009101|Ga0105247_11878215Not Available500Open in IMG/M
3300009148|Ga0105243_10704016All Organisms → cellular organisms → Bacteria985Open in IMG/M
3300009176|Ga0105242_10790131All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium938Open in IMG/M
3300009553|Ga0105249_10139559All Organisms → cellular organisms → Bacteria2322Open in IMG/M
3300009818|Ga0105072_1084780All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300010046|Ga0126384_10393072All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1169Open in IMG/M
3300010048|Ga0126373_12111468All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium625Open in IMG/M
3300010359|Ga0126376_10986198All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium841Open in IMG/M
3300010361|Ga0126378_11242687All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium841Open in IMG/M
3300010362|Ga0126377_12964596All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300010376|Ga0126381_100420187All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1868Open in IMG/M
3300010376|Ga0126381_103581662All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium609Open in IMG/M
3300010391|Ga0136847_11285595All Organisms → cellular organisms → Bacteria1332Open in IMG/M
3300010391|Ga0136847_12969528All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300010398|Ga0126383_12769098All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300011419|Ga0137446_1032374All Organisms → cellular organisms → Bacteria1116Open in IMG/M
3300011433|Ga0137443_1151325All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium687Open in IMG/M
3300011439|Ga0137432_1151299All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium745Open in IMG/M
3300012204|Ga0137374_10001017All Organisms → cellular organisms → Bacteria31085Open in IMG/M
3300012349|Ga0137387_10537271All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium848Open in IMG/M
3300012923|Ga0137359_11414925All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300014321|Ga0075353_1152626All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300014968|Ga0157379_11892313All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300015259|Ga0180085_1004405All Organisms → cellular organisms → Bacteria3970Open in IMG/M
3300015372|Ga0132256_103896230All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium502Open in IMG/M
3300015373|Ga0132257_100804926All Organisms → cellular organisms → Bacteria1173Open in IMG/M
3300015373|Ga0132257_102501345All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium671Open in IMG/M
3300015374|Ga0132255_102590789All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium775Open in IMG/M
3300017959|Ga0187779_10111131All Organisms → cellular organisms → Bacteria1660Open in IMG/M
3300018058|Ga0187766_10032562All Organisms → cellular organisms → Bacteria3030Open in IMG/M
3300018060|Ga0187765_10035090All Organisms → cellular organisms → Bacteria2502Open in IMG/M
3300018060|Ga0187765_10324374All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium930Open in IMG/M
3300018061|Ga0184619_10396503All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300018063|Ga0184637_10018363All Organisms → cellular organisms → Bacteria4205Open in IMG/M
3300018084|Ga0184629_10716946All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium503Open in IMG/M
3300018089|Ga0187774_11447522Not Available506Open in IMG/M
3300018433|Ga0066667_11602693All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium580Open in IMG/M
3300019458|Ga0187892_10001576All Organisms → cellular organisms → Bacteria51346Open in IMG/M
3300019458|Ga0187892_10004442All Organisms → cellular organisms → Bacteria23511Open in IMG/M
3300020060|Ga0193717_1084301All Organisms → cellular organisms → Bacteria1033Open in IMG/M
3300020063|Ga0180118_1345140All Organisms → cellular organisms → Bacteria780Open in IMG/M
3300021051|Ga0206224_1005037All Organisms → cellular organisms → Bacteria1378Open in IMG/M
3300021063|Ga0206227_1033993All Organisms → cellular organisms → Bacteria890Open in IMG/M
3300021560|Ga0126371_10278541All Organisms → cellular organisms → Bacteria1794Open in IMG/M
3300021560|Ga0126371_11810474All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300025289|Ga0209002_10729257All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300025549|Ga0210094_1034227All Organisms → cellular organisms → Bacteria861Open in IMG/M
3300025560|Ga0210108_1088125All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300025900|Ga0207710_10309781All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium799Open in IMG/M
3300025910|Ga0207684_10295549All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1396Open in IMG/M
3300025935|Ga0207709_10343115All Organisms → cellular organisms → Bacteria1125Open in IMG/M
3300025941|Ga0207711_10529724All Organisms → cellular organisms → Bacteria1099Open in IMG/M
3300026075|Ga0207708_11184023All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium668Open in IMG/M
3300026095|Ga0207676_11282885All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300026524|Ga0209690_1144455All Organisms → cellular organisms → Bacteria885Open in IMG/M
3300028807|Ga0307305_10063981All Organisms → cellular organisms → Bacteria1696Open in IMG/M
3300028814|Ga0307302_10596469All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium549Open in IMG/M
3300031226|Ga0307497_10598691All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300031740|Ga0307468_100154731All Organisms → cellular organisms → Bacteria1479Open in IMG/M
3300031740|Ga0307468_102380047All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium516Open in IMG/M
3300031820|Ga0307473_10866331All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium650Open in IMG/M
3300031949|Ga0214473_10036977All Organisms → cellular organisms → Bacteria → Proteobacteria5733Open in IMG/M
3300031949|Ga0214473_12078168All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300032076|Ga0306924_11797867All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium639Open in IMG/M
3300032174|Ga0307470_10505815All Organisms → cellular organisms → Bacteria882Open in IMG/M
3300032174|Ga0307470_10657050All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium792Open in IMG/M
3300032180|Ga0307471_100815646All Organisms → cellular organisms → Bacteria1100Open in IMG/M
3300032180|Ga0307471_101483591All Organisms → cellular organisms → Bacteria837Open in IMG/M
3300032180|Ga0307471_102799777All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300032397|Ga0315287_11022798All Organisms → cellular organisms → Bacteria961Open in IMG/M
3300032770|Ga0335085_10962934All Organisms → cellular organisms → Bacteria925Open in IMG/M
3300033004|Ga0335084_10064192All Organisms → cellular organisms → Bacteria3797Open in IMG/M
3300033004|Ga0335084_10082486All Organisms → cellular organisms → Bacteria3335Open in IMG/M
3300034165|Ga0364942_0280015All Organisms → cellular organisms → Bacteria545Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil9.43%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil7.55%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil7.55%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.66%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere4.72%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.72%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil3.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.77%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.77%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere3.77%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands2.83%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.83%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.83%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.83%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment1.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil1.89%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment1.89%
Bio-OozeEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze1.89%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.94%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.94%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.94%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.94%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.94%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.94%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.94%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.94%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.94%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere0.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.94%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.94%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300003319Sugarcane bulk soil Sample L2EnvironmentalOpen in IMG/M
3300003995Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005981Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009818Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011419Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT357_2EnvironmentalOpen in IMG/M
3300011433Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT300_2EnvironmentalOpen in IMG/M
3300011439Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2EnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300014321Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1EnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015259Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10DEnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300019458Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaGEnvironmentalOpen in IMG/M
3300020060Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2EnvironmentalOpen in IMG/M
3300020063Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT730_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021051Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos A1EnvironmentalOpen in IMG/M
3300021063Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos D4EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025289Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 2EnvironmentalOpen in IMG/M
3300025549Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025560Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026524Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes)EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300034165Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10189039823300000364SoilLARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKTEXKS*
soilL2_1021115323300003319Sugarcane Root And Bulk SoilLARAAYRILYQAGYRNMAILDEGIPGWHAKKYPTESSAGPRGKTG*
Ga0055438_1009014323300003995Natural And Restored WetlandsLARGAYKVLYLAGYRNMLILDEGIPGWVQKRYPVQSTGGKG*
Ga0062593_10097015413300004114SoilCPHALARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTERSEGKS*
Ga0062593_10323843323300004114SoilLARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKTVGKS*
Ga0066676_1110627823300005186SoilLARGAFKVLYQAGYRNMVILDEGIPGWARKRYPTERTAAG*
Ga0070676_1072674113300005328Miscanthus RhizosphereLARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKSEGKS*
Ga0066388_10664425723300005332Tropical Forest SoilLARGAYRVLYLAGYRNMMILDEGIPGWVQKHYPVDTAVGKG*
Ga0066388_10746804613300005332Tropical Forest SoilLARAAYKILYQAGYRNMAILDEGIPGWHAKNYPTEAGAGSRGKAG
Ga0070705_10135029423300005440Corn, Switchgrass And Miscanthus RhizosphereLARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKTEGKS*
Ga0070708_10023142833300005445Corn, Switchgrass And Miscanthus RhizosphereLARGAFKLLYLAGYRNMMILDEGLPGWAEKRYPVEKTAAKS*
Ga0070706_10157808523300005467Corn, Switchgrass And Miscanthus RhizosphereLARGAYKVLYQAGYRNMVILDEGIPGWAKKRYPTEKTVGKS*
Ga0070698_10047166413300005471Corn, Switchgrass And Miscanthus RhizosphereLARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTERTEGKS*
Ga0068857_10062292923300005577Corn RhizosphereLARAAYRILYQAGYRNMAILDEGIPGWHGKKYPTESSAPPRGKSG*
Ga0068859_10108247623300005617Switchgrass RhizosphereRGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKTVGKS*
Ga0068859_10176454423300005617Switchgrass RhizosphereLARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKTEGKG*
Ga0068864_10023845023300005618Switchgrass RhizosphereLARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKAEAKS*
Ga0066905_10131855723300005713Tropical Forest SoilLARAAYKVLYQAGFRNMAILDEGIPGWARKRYPTETTGKG*
Ga0066903_10035712023300005764Tropical Forest SoilLARAAYKVLYNAGYRNMAILDEGIPGWARKRYPTETTGKG*
Ga0066903_10109163813300005764Tropical Forest SoilVLYLAGYRNMAILDEGIPGWADKGYPVEASSGKG*
Ga0066903_10329992923300005764Tropical Forest SoilMARAAYKMLYLAGYRNMAILDEGIPGWASKGYPVDKS*
Ga0066903_10552591923300005764Tropical Forest SoilLARGAYKVLYQAGYRNMAILDEGIPGWAKKRYPTEKTVGKS*
Ga0066903_10613467123300005764Tropical Forest SoilLARGAYKLLYLAGYRNMSILDEGIPGWADKGYPVDKGKS*
Ga0068860_10008149043300005843Switchgrass RhizosphereAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKTVGKS*
Ga0081538_1001006363300005981Tabebuia Heterophylla RhizosphereLARGAYKILYLAGYRNMLILDEGLPGWVDNRYPTARKP*
Ga0075421_10012523833300006845Populus RhizosphereLARAAYRILYQARYRNMAILDEGIPGWHAKKYPTESSAGPPGKTG*
Ga0075431_10027503833300006847Populus RhizosphereLARAAYRILYQARYRNMAILDEGIPGWHAKKYPTESSAGPRGKTG*
Ga0075433_1109237613300006852Populus RhizosphereLARGAYKVLYLAGRRNMVILDEGLPGWAGKEYPLAKTQKTG*
Ga0075425_10311767013300006854Populus RhizosphereLARAAYKILYLAGYRNMMILDEGIPGWAEKGYPVEPSAAKS*
Ga0079215_1053808523300006894Agricultural SoilLARGAYRILYAAGYRNMFILDEGLPGWIAQGYPTEP*
Ga0099827_1019774823300009090Vadose Zone SoilVLYIAGYRNMMILDEGIPGWYAKKYPTEATTSKG*
Ga0111539_1098379623300009094Populus RhizosphereLARAAYRILYQAGYRNMAILDEGIPGWHGKKYPTESSAPLRGKSG*
Ga0105247_1187821523300009101Switchgrass RhizosphereLARGAYKVLYDAGYRNMVILDEGLLGWAKKRYPTEKSEGKS*
Ga0105243_1070401623300009148Miscanthus RhizosphereLARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPMEKTEGKS*
Ga0105242_1079013113300009176Miscanthus RhizosphereLARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEMSVGKS*
Ga0105249_1013955913300009553Switchgrass RhizosphereGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKTVGKS*
Ga0105072_108478023300009818Groundwater SandLARGAYKVLYQAGYRNMVILDEGIPGWAQKRYPTAKTVAKS*
Ga0126384_1039307233300010046Tropical Forest SoilMARAAYRTLYQAGYRNMMILDEGIPGWAEKRYPTAMTAARRP*
Ga0126373_1211146823300010048Tropical Forest SoilMARAAYKVLYLAGFRNMAILDEGIPGWASKGYPVDKS*
Ga0126376_1098619823300010359Tropical Forest SoilLARGAYKILYLAGRRNMVILDEGLPGWVDKEYPLAKTG*
Ga0126378_1124268713300010361Tropical Forest SoilKILYLAGYRNMMILDEGIPGWADKGYPVEQSAAKS*
Ga0126377_1296459623300010362Tropical Forest SoilLARAAYKVLYQEGYRNMVILDEGIPGWAKKRYPTEATGKS*
Ga0126381_10042018723300010376Tropical Forest SoilMARAAYKVLYLAGYRNMAILDEGIPGWASKGYPVDKS*
Ga0126381_10358166233300010376Tropical Forest SoilLARAAYKVLYNAGYRNMAILDEGITGWARKRYPTETTGKG*
Ga0136847_1128559533300010391Freshwater SedimentLARGANEILYVAGYRNMLILDEGLPGWNQKKYPTAVTAVRQR*
Ga0136847_1296952823300010391Freshwater SedimentHALARGANEILYTAGYRNMLILDEGIPGWHEKKYPTAVTAVRQQ*
Ga0126383_1276909823300010398Tropical Forest SoilLARAAYKVLYQAGYRNMAILDEGIPGWARRRYPTETTGQG*
Ga0137446_103237423300011419SoilLARGANEILYTAGYRNMLILDEGIPGWHQKRYPTAVTAVRQR*
Ga0137443_115132523300011433SoilLARAAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKTVEKS*
Ga0137432_115129913300011439SoilPARGAYRTLYTAGFRNMLILDEGLPGRMAQGYPTKP*
Ga0137374_10001017183300012204Vadose Zone SoilVLYLAGYRNMMILDEGIPGWYAKKYPTEATAPKG*
Ga0137387_1053727123300012349Vadose Zone SoilLARGAYKVLYQAGYRNMTILDEGIPGWVDKSYPTDKSAKG*
Ga0137359_1141492523300012923Vadose Zone SoilVLYLAGYRNMLILDEGIPGWAEKGYPLEKPAAKS*
Ga0075353_115262623300014321Natural And Restored WetlandsVLYLAGYRNMSILDEGIPGWADKGYPLEKSVRKS*
Ga0157379_1189231323300014968Switchgrass RhizosphereLARGASKVLYDAGYRNMVILDEGLPGWAKKRYPTEKTEGKS*
Ga0180085_100440523300015259SoilLARGAYKVLYLAGYRNMTILDEGLPGWDQKGYPLEKTAAKG*
Ga0132256_10389623023300015372Arabidopsis RhizosphereLARAAYKILYQAGYRNMAILYEGIPGWHAKQYPTDSGAGARGKPG
Ga0132257_10080492623300015373Arabidopsis RhizosphereLARAAYKILYLAGYRNMMILDEGIPGWTDKGYPVEQSAAKS*
Ga0132257_10250134523300015373Arabidopsis RhizosphereLARAAYKILYQAGYRSLAILDEGIPGWHAKKYPTESGAAARGKAG*
Ga0132255_10259078923300015374Arabidopsis RhizosphereYRVLYQAGYRNMVILDEGLPGWHAKNYPTEVTASRGKSG*
Ga0187779_1011113133300017959Tropical PeatlandLARGAYKILYLAGYRNMSILDEGIPGWADKGYPLEEGPRKG
Ga0187766_1003256233300018058Tropical PeatlandVLYLAGYRNLAILDEGMPGWADRGYPVEGSSKQAS
Ga0187765_1003509023300018060Tropical PeatlandVLYLAGYRNLAILDEGMPGWADRGYPVEGSSKKAS
Ga0187765_1032437423300018060Tropical PeatlandMARAAYKILYLAGYRNMQILDEGIPGWANKGYPIAEASATRG
Ga0184619_1039650333300018061Groundwater SedimentLARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEK
Ga0184637_1001836353300018063Groundwater SedimentVLARGAFKILYQAGYRNMAILDEGIPGWQAKKYPTASAAATPKTRT
Ga0184629_1071694623300018084Groundwater SedimentLARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKTVGKS
Ga0187774_1144752213300018089Tropical PeatlandLARGAYKVLYLVGFRNMSILDEGIPGWARRGYPVDQSARKGP
Ga0066667_1160269323300018433Grasslands SoilARAAYRTLYQAGYRNMMILDEGIPGWTEKRYPTAVTAARRP
Ga0187892_10001576483300019458Bio-OozeMARAAYKILYQAGHRNMVILDEGLPDWARKRYPTEGPDRRS
Ga0187892_10004442193300019458Bio-OozeMARAAYKTLYQAGYRNMAILDEGIPGWVKANYPTVRGTKKS
Ga0193717_108430133300020060SoilLARGAYKVLYDAGYRNMVILDEGIPGWAKKRYPTEKTVGKS
Ga0180118_134514023300020063Groundwater SedimentLARGAYKVLYLAGYRNMTILDEGLPGWDQKGYPLEKTAAKG
Ga0206224_100503723300021051Deep Subsurface SedimentLARGANEILYTAAYRNMLILDEGIPGWHQKKYPTAVTAVRQR
Ga0206227_103399323300021063Deep Subsurface SedimentLARGANEILYTAGYRNMLILDEGIPGWHQKRYPTAVTVVRRP
Ga0126371_1027854133300021560Tropical Forest SoilMARAAYKVLYLAGFRNMAILDEGIPGWASKGYPVDKS
Ga0126371_1181047423300021560Tropical Forest SoilMARAAYKVLYLAGYRNMAILDEGIPGWASKGYPVDKS
Ga0209002_1072925723300025289SoilASEILYAAGYRNMLILDEGMPGWDKKKYPTAVTALRKP
Ga0210094_103422723300025549Natural And Restored WetlandsLARGAYKVLYLAGYRNMLILDEGIPGWVQKRYPVQSTGGKG
Ga0210108_108812513300025560Natural And Restored WetlandsGANEILYVAGYRNMVILNEGIPGWHEKNYPTAVTAARRP
Ga0207710_1030978133300025900Switchgrass RhizosphereLARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKSEGKS
Ga0207684_1029554923300025910Corn, Switchgrass And Miscanthus RhizosphereLARGAFKLLYLAGYRNMMILDEGLPGWAEKRYPVEKTAAKS
Ga0207709_1034311533300025935Miscanthus RhizosphereLARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPMEKTEGKS
Ga0207711_1052972433300025941Switchgrass RhizosphereLARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKTEGKG
Ga0207708_1118402313300026075Corn, Switchgrass And Miscanthus RhizosphereLARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKTEGTS
Ga0207676_1128288513300026095Switchgrass RhizosphereHALARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKAEAKS
Ga0209690_114445523300026524SoilLARAAYRTLYQAGYRNMMILDEGIPGWTEKRYPTAVTAARRP
Ga0307305_1006398113300028807SoilARGAYRILYVAGYRNMLILDEGLPGWIAQGYPTEP
Ga0307302_1059646913300028814SoilLARGAYKVLYDVGYRNMVILDEGLPGWAKKRYPTEKTEGKS
Ga0307497_1059869123300031226SoilLARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKTEGKS
Ga0307468_10015473133300031740Hardwood Forest SoilLARGAYKVLYQAGYRNMVILDEGIPGWAKKRYPTEKTVGKS
Ga0307468_10238004723300031740Hardwood Forest SoilLARAAYKVLYQAGYRNMAILDEGIPGWHAKNYPTDSTPRGKSS
Ga0307473_1086633133300031820Hardwood Forest SoilLARGAYKVLYQAGYRNMAILDEGIPGWAKKRYPTEKTVGKS
Ga0214473_1003697733300031949SoilLARGAYKVLYRAGYRNMVILDEGIPGWVQKRYPTARTAGKS
Ga0214473_1207816813300031949SoilLARGAYKVLYQAGYRNMVILDEGIPGWAQKRYPTAR
Ga0306924_1179786723300032076SoilELARAAYKILYLAGHRNMMILDEGIPGWADKGYPVEPSAAKS
Ga0307470_1050581513300032174Hardwood Forest SoilACPHALARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKTEGKS
Ga0307470_1065705033300032174Hardwood Forest SoilLARGAYKVLYDAGYRNMVILDEGLPGWAKKRYPTEKSAGKS
Ga0307471_10081564623300032180Hardwood Forest SoilAFKLLYLAGYRNMMILDEGLPGWADKRYPVEKTAAKS
Ga0307471_10148359123300032180Hardwood Forest SoilLARGAYQVLYQAGYRNMVILDEGIPGWVDKHYPTETSAAS
Ga0307471_10279977723300032180Hardwood Forest SoilVQARAAFGILYQAGFRNMAILDEGIPGWDAKRYPTESTAGKRTS
Ga0315287_1102279813300032397SedimentLARGANEVLYVAGYRNMAILDEGIPGWHEKKYPTAVTAARKP
Ga0335085_1096293423300032770SoilLARGAYKVLYLAGYRNMVILDEGIPGWVQKHYPVETAVGKG
Ga0335084_1006419243300033004SoilLARGAYKVLYQAGYRNMAILDEGIPGWAKKRYPTEKTVGKG
Ga0335084_1008248623300033004SoilLARGAFKILYRAGYRNAAILDEGIPGWADKQYPVASGPG
Ga0364942_0280015_240_3683300034165SedimentLARGANEILYTAGYRNMLILDEGIPGWHQKRYPTAVTAVRRP

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.