NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F093561

Metagenome / Metatranscriptome Family F093561

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F093561
Family Type Metagenome / Metatranscriptome
Number of Sequences 106
Average Sequence Length 44 residues
Representative Sequence VTIILCPAKNGAPVAYIGSGDPGTKVIFADGRELDFKDRTAP
Number of Associated Samples 98
Number of Associated Scaffolds 106

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.94 %
% of genes near scaffold ends (potentially truncated) 97.17 %
% of genes from short scaffolds (< 2000 bps) 94.34 %
Associated GOLD sequencing projects 95
AlphaFold2 3D model prediction Yes
3D model pTM-score0.28

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.113 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil
(13.207 % of family members)
Environment Ontology (ENVO) Unclassified
(21.698 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(47.170 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 22.86%    Coil/Unstructured: 77.14%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.28
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 106 Family Scaffolds
PF00486Trans_reg_C 12.26
PF04248NTP_transf_9 4.72
PF01738DLH 3.77
PF00756Esterase 0.94
PF02627CMD 0.94
PF01177Asp_Glu_race 0.94
PF00708Acylphosphatase 0.94
PF00583Acetyltransf_1 0.94
PF07626PSD3 0.94
PF15919HicB_lk_antitox 0.94
PF00041fn3 0.94
PF03544TonB_C 0.94
PF05496RuvB_N 0.94
PF04909Amidohydro_2 0.94
PF12681Glyoxalase_2 0.94
PF11848DUF3368 0.94
PF03972MmgE_PrpD 0.94
PF07690MFS_1 0.94
PF03928HbpS-like 0.94
PF02653BPD_transp_2 0.94
PF07586HXXSHH 0.94

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 106 Family Scaffolds
COG2343Uncharacterized conserved protein, DUF427 familyFunction unknown [S] 4.72
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 0.94
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 0.94
COG20792-methylcitrate dehydratase PrpDCarbohydrate transport and metabolism [G] 0.94
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 0.94
COG2255Holliday junction resolvasome RuvABC, ATP-dependent DNA helicase subunit RuvBReplication, recombination and repair [L] 0.94

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.11 %
UnclassifiedrootN/A1.89 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004463|Ga0063356_105230243All Organisms → cellular organisms → Bacteria → Acidobacteria557Open in IMG/M
3300005180|Ga0066685_10712312All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium688Open in IMG/M
3300005330|Ga0070690_100641656All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium810Open in IMG/M
3300005337|Ga0070682_100421970All Organisms → cellular organisms → Bacteria → Acidobacteria1014Open in IMG/M
3300005365|Ga0070688_100876476All Organisms → cellular organisms → Bacteria → Proteobacteria707Open in IMG/M
3300005438|Ga0070701_10810813All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bdellovibrionales → Bdellovibrionaceae → Bdellovibrio → unclassified Bdellovibrio → Bdellovibrio sp. qaytius639Open in IMG/M
3300005535|Ga0070684_100015391All Organisms → cellular organisms → Bacteria6230Open in IMG/M
3300005554|Ga0066661_10870543All Organisms → cellular organisms → Bacteria → Acidobacteria527Open in IMG/M
3300005558|Ga0066698_10288861Not Available1135Open in IMG/M
3300005569|Ga0066705_10049414All Organisms → cellular organisms → Bacteria2357Open in IMG/M
3300005616|Ga0068852_101914216All Organisms → cellular organisms → Bacteria → Acidobacteria615Open in IMG/M
3300005834|Ga0068851_10433405All Organisms → cellular organisms → Bacteria → Acidobacteria778Open in IMG/M
3300005836|Ga0074470_10458461All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300005841|Ga0068863_100088592All Organisms → cellular organisms → Bacteria2933Open in IMG/M
3300005844|Ga0068862_101398380All Organisms → cellular organisms → Bacteria → Acidobacteria703Open in IMG/M
3300006032|Ga0066696_10874970All Organisms → cellular organisms → Bacteria → Acidobacteria572Open in IMG/M
3300006162|Ga0075030_100075306All Organisms → cellular organisms → Bacteria2776Open in IMG/M
3300006797|Ga0066659_10784721All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium786Open in IMG/M
3300006800|Ga0066660_10717433All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium819Open in IMG/M
3300006845|Ga0075421_100154858All Organisms → cellular organisms → Bacteria2862Open in IMG/M
3300006846|Ga0075430_100196840All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1674Open in IMG/M
3300006852|Ga0075433_10276017All Organisms → cellular organisms → Bacteria → Acidobacteria1490Open in IMG/M
3300006853|Ga0075420_100451073All Organisms → cellular organisms → Bacteria → Proteobacteria1111Open in IMG/M
3300006854|Ga0075425_100398445All Organisms → cellular organisms → Bacteria → Acidobacteria1586Open in IMG/M
3300009012|Ga0066710_100938680All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Salinibacter → Salinibacter ruber1333Open in IMG/M
3300009148|Ga0105243_12457247All Organisms → cellular organisms → Bacteria → Acidobacteria560Open in IMG/M
3300009553|Ga0105249_12144662All Organisms → cellular organisms → Bacteria → Acidobacteria632Open in IMG/M
3300009792|Ga0126374_11454794All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300010047|Ga0126382_10732120All Organisms → cellular organisms → Bacteria → Acidobacteria834Open in IMG/M
3300010107|Ga0127494_1130274All Organisms → cellular organisms → Bacteria → Acidobacteria806Open in IMG/M
3300010114|Ga0127460_1037980All Organisms → cellular organisms → Bacteria → Acidobacteria626Open in IMG/M
3300010124|Ga0127498_1076201All Organisms → cellular organisms → Bacteria → Acidobacteria508Open in IMG/M
3300010304|Ga0134088_10015135All Organisms → cellular organisms → Bacteria3347Open in IMG/M
3300010326|Ga0134065_10218299All Organisms → cellular organisms → Bacteria → Acidobacteria698Open in IMG/M
3300010335|Ga0134063_10227780All Organisms → cellular organisms → Bacteria → Acidobacteria882Open in IMG/M
3300010358|Ga0126370_11624745All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium619Open in IMG/M
3300010360|Ga0126372_12647083All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300010362|Ga0126377_13024697All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300010362|Ga0126377_13150633All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300010366|Ga0126379_13851226Not Available503Open in IMG/M
3300010376|Ga0126381_101665000All Organisms → cellular organisms → Bacteria → Acidobacteria922Open in IMG/M
3300010376|Ga0126381_102665865All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300010398|Ga0126383_10467639All Organisms → cellular organisms → Bacteria → Acidobacteria1313Open in IMG/M
3300010398|Ga0126383_11793193All Organisms → cellular organisms → Bacteria → Acidobacteria702Open in IMG/M
3300010399|Ga0134127_11307769All Organisms → cellular organisms → Bacteria → Acidobacteria794Open in IMG/M
3300010905|Ga0138112_1045620All Organisms → cellular organisms → Bacteria → Acidobacteria800Open in IMG/M
3300011080|Ga0138568_1133470All Organisms → cellular organisms → Bacteria → Acidobacteria539Open in IMG/M
3300011087|Ga0138570_1155266All Organisms → cellular organisms → Bacteria → Acidobacteria886Open in IMG/M
3300011119|Ga0105246_10752008All Organisms → cellular organisms → Bacteria → Acidobacteria860Open in IMG/M
3300012205|Ga0137362_10747198All Organisms → cellular organisms → Bacteria → Acidobacteria839Open in IMG/M
3300012357|Ga0137384_10459901All Organisms → cellular organisms → Bacteria1047Open in IMG/M
3300012383|Ga0134033_1150905All Organisms → cellular organisms → Bacteria → Acidobacteria608Open in IMG/M
3300012401|Ga0134055_1117820All Organisms → cellular organisms → Bacteria → Acidobacteria860Open in IMG/M
3300012469|Ga0150984_111636892All Organisms → cellular organisms → Bacteria → Acidobacteria580Open in IMG/M
3300012892|Ga0157294_10072637All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium831Open in IMG/M
3300012917|Ga0137395_10931294All Organisms → cellular organisms → Bacteria → Acidobacteria627Open in IMG/M
3300012960|Ga0164301_11577898All Organisms → cellular organisms → Bacteria → Acidobacteria544Open in IMG/M
3300012971|Ga0126369_10596558All Organisms → cellular organisms → Bacteria → Acidobacteria1174Open in IMG/M
3300013100|Ga0157373_10321603All Organisms → cellular organisms → Bacteria → Acidobacteria1100Open in IMG/M
3300013308|Ga0157375_11264315All Organisms → cellular organisms → Bacteria → Acidobacteria867Open in IMG/M
3300013308|Ga0157375_12678576All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium596Open in IMG/M
3300014499|Ga0182012_10225228All Organisms → cellular organisms → Bacteria → Proteobacteria1300Open in IMG/M
3300014969|Ga0157376_11183280All Organisms → cellular organisms → Bacteria → Proteobacteria792Open in IMG/M
3300015373|Ga0132257_102923050All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300015374|Ga0132255_105406414All Organisms → cellular organisms → Bacteria → Acidobacteria541Open in IMG/M
3300016357|Ga0182032_11636971All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium560Open in IMG/M
3300016387|Ga0182040_11810119All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium523Open in IMG/M
3300018431|Ga0066655_10374986All Organisms → cellular organisms → Bacteria → Acidobacteria937Open in IMG/M
3300020000|Ga0193692_1031076All Organisms → cellular organisms → Bacteria → Acidobacteria1247Open in IMG/M
3300021432|Ga0210384_10170227All Organisms → cellular organisms → Bacteria → Acidobacteria1957Open in IMG/M
3300021432|Ga0210384_10225857All Organisms → cellular organisms → Bacteria → Acidobacteria1685Open in IMG/M
3300021475|Ga0210392_11308216All Organisms → cellular organisms → Bacteria → Acidobacteria542Open in IMG/M
3300021560|Ga0126371_11983473All Organisms → cellular organisms → Bacteria → Acidobacteria700Open in IMG/M
3300021560|Ga0126371_13680451All Organisms → cellular organisms → Bacteria → Acidobacteria517Open in IMG/M
3300021861|Ga0213853_11068104All Organisms → cellular organisms → Bacteria → Acidobacteria668Open in IMG/M
3300025898|Ga0207692_10774401All Organisms → cellular organisms → Bacteria → Acidobacteria626Open in IMG/M
3300025906|Ga0207699_10165892All Organisms → cellular organisms → Bacteria → Acidobacteria1474Open in IMG/M
3300025927|Ga0207687_11941792All Organisms → cellular organisms → Bacteria → Acidobacteria503Open in IMG/M
3300025933|Ga0207706_11187320All Organisms → cellular organisms → Bacteria → Acidobacteria634Open in IMG/M
3300025939|Ga0207665_11202043All Organisms → cellular organisms → Bacteria → Acidobacteria605Open in IMG/M
3300025944|Ga0207661_10218558All Organisms → cellular organisms → Bacteria1683Open in IMG/M
3300025944|Ga0207661_11361928All Organisms → cellular organisms → Bacteria → Acidobacteria651Open in IMG/M
3300026023|Ga0207677_11555924All Organisms → cellular organisms → Bacteria → Proteobacteria611Open in IMG/M
3300026075|Ga0207708_11384620All Organisms → cellular organisms → Bacteria → Proteobacteria617Open in IMG/M
3300026116|Ga0207674_10875329All Organisms → cellular organisms → Bacteria → Acidobacteria866Open in IMG/M
3300026121|Ga0207683_10753153All Organisms → cellular organisms → Bacteria904Open in IMG/M
3300026307|Ga0209469_1083284All Organisms → cellular organisms → Bacteria → Acidobacteria947Open in IMG/M
3300026309|Ga0209055_1264649All Organisms → cellular organisms → Bacteria → Acidobacteria534Open in IMG/M
3300026550|Ga0209474_10450910All Organisms → cellular organisms → Bacteria → Acidobacteria654Open in IMG/M
3300027905|Ga0209415_10928846All Organisms → cellular organisms → Bacteria → Acidobacteria588Open in IMG/M
3300027911|Ga0209698_10510251All Organisms → cellular organisms → Bacteria → Acidobacteria930Open in IMG/M
3300027911|Ga0209698_10532220All Organisms → cellular organisms → Bacteria → Acidobacteria908Open in IMG/M
3300031708|Ga0310686_118007735All Organisms → cellular organisms → Bacteria → Acidobacteria542Open in IMG/M
3300031712|Ga0265342_10694148All Organisms → cellular organisms → Bacteria → Acidobacteria509Open in IMG/M
3300031753|Ga0307477_10372206All Organisms → cellular organisms → Bacteria → Acidobacteria981Open in IMG/M
3300031879|Ga0306919_10513614All Organisms → cellular organisms → Bacteria → Acidobacteria924Open in IMG/M
3300031947|Ga0310909_11011222All Organisms → cellular organisms → Bacteria → Acidobacteria679Open in IMG/M
3300031962|Ga0307479_12102593All Organisms → cellular organisms → Bacteria → Acidobacteria512Open in IMG/M
3300032001|Ga0306922_10513203All Organisms → cellular organisms → Bacteria → Acidobacteria1277Open in IMG/M
3300032039|Ga0318559_10460067All Organisms → cellular organisms → Bacteria → Acidobacteria594Open in IMG/M
3300032783|Ga0335079_11694944All Organisms → cellular organisms → Bacteria → Acidobacteria618Open in IMG/M
3300033004|Ga0335084_11812864All Organisms → cellular organisms → Bacteria → Acidobacteria598Open in IMG/M
3300033158|Ga0335077_11602867All Organisms → cellular organisms → Bacteria → Acidobacteria619Open in IMG/M
3300033289|Ga0310914_10215982All Organisms → cellular organisms → Bacteria → Acidobacteria1716Open in IMG/M
3300033433|Ga0326726_11772484All Organisms → cellular organisms → Bacteria → Acidobacteria601Open in IMG/M
3300034662|Ga0314783_170442All Organisms → cellular organisms → Bacteria515Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil13.21%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil9.43%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil8.49%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.66%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.72%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.77%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere3.77%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.83%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.83%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.83%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.83%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.83%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.89%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.89%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.89%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.89%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.94%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.94%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.94%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.94%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.94%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.94%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.94%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.94%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.94%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.94%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010107Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010114Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010124Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010905Grasslands soil microbial communities from Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300011080Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 53 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011087Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 55 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012383Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012401Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012892Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1EnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014499Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaGEnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300020000Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1EnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026307Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes)EnvironmentalOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031712Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaGHost-AssociatedOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300034662Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0063356_10523024323300004463Arabidopsis Thaliana RhizosphereCPAKNGEPVAYIGTGDPGTKVIFADGRELDFKDRTVPTP*
Ga0066685_1071231233300005180SoilRSVKPGDEVTIILCPAKNGEPVAYIGSGDPGTKIIFSDGRELDFKDRTAQ*
Ga0070690_10064165623300005330Switchgrass RhizosphereIMCPAKNGAPVAYMGSGDPGTKVIFADGHELDFTDKTGR*
Ga0070682_10042197013300005337Corn RhizosphereGDQITIILCPAKNGQPVAYAGSGGPGTKVIFADGRELDFTDKTVDKAVDTAK*
Ga0070688_10087647613300005365Switchgrass RhizosphereEVSIILCPAKNGAPVAYIGTGDPGTKVIFADGRELDFSEKTAK*
Ga0070701_1081081323300005438Corn, Switchgrass And Miscanthus RhizosphereRSVKPGDEVTIILCSAKNGAPVAYIGSGDPGTKVIFSNGKELDFQDRTTK*
Ga0070684_10001539173300005535Corn RhizosphereALKAGDQITIILCPAKNGQPVAYAGSGDPGTKVIFADGRELDFTDKTIDKTVDKTIDNAK
Ga0066661_1087054323300005554SoilIKPGDEVTIILCPAKNGEPVAYIGSGDPGTKIIFSDGRELDFKDRTAP*
Ga0066698_1028886123300005558SoilVTIILCPAKNGAPVAYIGSGDPGTKVIFADGRELDFKDRTAP*
Ga0066705_1004941443300005569SoilAKNGAPVAYIGSGDPGTKVIFADGRELDFKEKTAP*
Ga0068852_10191421623300005616Corn RhizosphereLKAGDKITIIMCPAKNGQPVAYAGSGDPGTKVIFADGHELDFTDKTAK*
Ga0068851_1043340513300005834Corn RhizospherePVAYAGSGDPGTKVIFADGRELDFTDKTVDKTAP*
Ga0074470_1045846113300005836Sediment (Intertidal)ITVILCPAKNGAPVAYIGSGDPGTKVIFADGRELDFTDKTTQ*
Ga0068863_10008859243300005841Switchgrass RhizosphereEVTIIMCPAKNGAPVAYAGSGDPGTKVIFSNGKELDFQDKTGK*
Ga0068862_10139838023300005844Switchgrass RhizosphereQITIILCPAKNGQPVAYAGSGDPGTKVIFADGRELDFTDKTVDKAIDNAK*
Ga0066696_1087497013300006032SoilRSLKPGDEVTIILCPAKNGAPVAYIGSGDPGTKVIFADGRELDFKEKTAP*
Ga0075030_10007530613300006162WatershedsIMCPAKNGQPVAYAGSGDPGTKVIFDDGRELDFVDKTR*
Ga0066659_1078472113300006797SoilPAKNGEPIAYIGSGDPGTKVIFSDGRELDFKDRTAP*
Ga0066660_1071743313300006800SoilGDEVTIILCPAKNGAPVAYIGSGDPGTKVIFFDGRELDFKDKTAQ*
Ga0075421_10015485813300006845Populus RhizosphereCPAKNGAPVAYIGSGDPGTKIIFSDGRELDFKDRTAQ*
Ga0075430_10019684033300006846Populus RhizosphereTIILCPAKNGAPVAYIGSGDPGTKVIFPDGRELDFKDKTAQ*
Ga0075433_1027601733300006852Populus RhizosphereSLKAGDEVTIILCPAKNGAPVAYIGSGDPGTKVIFSDGRELDFKDRTAQ*
Ga0075420_10045107333300006853Populus RhizosphereAGDEVTIILCPAKNGAPVAYIGSGDPGTKVIFSDGRELDFKDRTAQ*
Ga0075425_10039844533300006854Populus RhizosphereGDEVTIILCPAKNGAPVAYIGSGDPGTKVIFSDGRELDFKDRTAQ*
Ga0066710_10093868013300009012Grasslands SoilSLKAGDEVTIILCPARNGEPVAYIGSRDPGTKVIFSDGRELDFKDRTTPAP
Ga0105243_1245724713300009148Miscanthus RhizosphereVTIIMCPAKNGAPVAYAGSGDPGTKVIFSNGKELDFQDKTGK*
Ga0105249_1214466213300009553Switchgrass RhizosphereILCPAKNGSPVAYMGSGDPGTKVIFADGHELDFTDKAAQ*
Ga0126374_1145479413300009792Tropical Forest SoilTRHSLKAGDEITIILCPAKNGQPVAYAGSGDPGTKVIFSDGRELDFTDKTLP*
Ga0126382_1073212013300010047Tropical Forest SoilRSIKAGDEVTIILCPAKNGAPVAYIGSGDPGTKVIFADGRELDFKDKTAPAQ*
Ga0127494_113027413300010107Grasslands SoilPAKNGAPVAYIGSGDPGTKVILADGRELDFKEKTAP*
Ga0127460_103798023300010114Grasslands SoilGDEVTIILCPAKNGAPVAYIGSGDPGTKVIFADGRELDFKEKTAP*
Ga0127498_107620113300010124Grasslands SoilPGDEVTIILCPAKNGAPVAYIGSGDPGTKVIFADGRELDFKEKTAP*
Ga0134088_1001513553300010304Grasslands SoilIIVCPAKNGAPVAYIGSGDPGTKVIFADGRELDFKEKTAP*
Ga0134065_1021829913300010326Grasslands SoilEVTIILCPAKNGAPVAYIGSGDPGTKVIFADGRELDFKEKTAP*
Ga0134063_1022778013300010335Grasslands SoilKNGAPVAYIGSGDPGTKVIFADGRELDFKEKTAP*
Ga0126370_1162474513300010358Tropical Forest SoilPGDEVTIILCPAKNNAPVAYIGSGDPGTKVIFADGHELDFKDKTGAAQ*
Ga0126372_1264708323300010360Tropical Forest SoilRRSLKAGDEVTVILCPAKNGAPVAYIGSGDPGTKVIFADGRELDFKDRTAQ*
Ga0126377_1302469713300010362Tropical Forest SoilARNGAPIAYIGSGDPGTKIIFSNGKELDFKDRTATAQ*
Ga0126377_1315063313300010362Tropical Forest SoilKNGAPVAYIGSGDPGTKVIFADGRELDFKDRTAQ*
Ga0126379_1385122623300010366Tropical Forest SoilIILCPAKNGAPVAYIGSGDPGTKVIFSDGRELDFKDRTAQ*
Ga0126381_10166500023300010376Tropical Forest SoilLCPAKNGQPVAYIGSGDPGTKVIFKDGRELDFVDKTVP*
Ga0126381_10266586523300010376Tropical Forest SoilKAGDEITIILCPAKNGQPVAYAGSGDPGTKVIFSDGRELDFTDKTLP*
Ga0126383_1046763913300010398Tropical Forest SoilEVTIILCPAKNGQPVAYIGSGDPGTKVIFADGRELDFTDKTVEKTTP*
Ga0126383_1179319323300010398Tropical Forest SoilCPAKNGAPVAYIGSGDPGTKVIFADGRELDFKEKAAAQ*
Ga0134127_1130776923300010399Terrestrial SoilIILCPAKNGQPVAYAGSGDPGTKVIFADGRELDFIDKTLESAK*
Ga0138112_104562013300010905Grasslands SoilILCPAKNGAPVAYIGSGDPGTKVIFADGRELDFKEKTAP*
Ga0138568_113347023300011080Peatlands SoilILCPAKNGQPVAYAGSGDPGTKVIFADGRELLFADKTAGP*
Ga0138570_115526613300011087Peatlands SoilAKNGQPVAYAGSGDPGTKVIFADGRELLFADKTAGP*
Ga0105246_1075200813300011119Miscanthus RhizosphereAKNGQPVAYAGSGDPGTKVIFADGRELDFTDKTVDKTTDNAK*
Ga0137362_1074719823300012205Vadose Zone SoilKNGEPIAYIGSGDPGTKVIFSDGRELDFKDRTAP*
Ga0137384_1045990113300012357Vadose Zone SoilRSVKPGDEVTIILCPAKNGEPVAYIGSGDPGTKVIFSDGRELDFKDRTAQ*
Ga0134033_115090523300012383Grasslands SoilLCPAKNGAPVAYIGSGDPGTKVIFADGRELDFKEKTAP*
Ga0134055_111782013300012401Grasslands SoilTIIVCPAKNGAPVAYIGSGDPGTKVIFADGRELDFKEKTAP*
Ga0150984_11163689213300012469Avena Fatua RhizosphereNSEPVAYIGSGDPGTKVIFKDGRELDFKDKSTAP*
Ga0157294_1007263713300012892SoilPAKNGAPVAYMGSGDPGTKVIFADGKELDFTDKTLR*
Ga0137395_1093129413300012917Vadose Zone SoilIKAGDEVTIILCPAKNGQPVAYAGSGDPGTKVIFANGRELDFTDKTLP*
Ga0164301_1157789813300012960SoilPVAYAGSGDPGTKVIFADGREMDFTDKTIDKTLDKTIDNAK*
Ga0126369_1059655823300012971Tropical Forest SoilRSLKAGDEVTIILCPAKNGQPVAYIGSGDPGTKVIFADGRELNFTDKTAEKTNP*
Ga0157373_1032160313300013100Corn RhizosphereIILCPAKNGQPVAYAGSGDPGTKVIFADGRELDFTAKTVDKTAP*
Ga0157375_1126431513300013308Miscanthus RhizosphereIILCPAKNGQPVAYAGSGDPGTKVIFADGRELDFTDKTIDKTVDKTIDNAK*
Ga0157375_1267857613300013308Miscanthus RhizosphereRSIKYGDQLTVILCPAKNGAPVAYMGSGDPGTKVIFADGKELDFTDKTLR*
Ga0182012_1022522813300014499BogLKAGDRITIIVCPAKNGQPVAYAGSGDPGTKVVFADGQELDFTDKTK*
Ga0157376_1118328023300014969Miscanthus RhizosphereGDEVSIILCPAKNGAPVAYIGTGDPGTKVIFADGRELDFAEKTAK*
Ga0132257_10292305023300015373Arabidopsis RhizosphereRSVKPGDEVTVILCPAKNGAPIAYIGSGDPGTKIIFSTGRELDFKDRTAPAQ*
Ga0132255_10540641413300015374Arabidopsis RhizosphereVKPGDEVTVILCPAKNGAPIAYIGSGDPGTKIIFSTGRELDFKDRTAPAQ*
Ga0182032_1163697113300016357SoilVTIILCPAKNGEPVAYIGSGDPGTKIIFPDGRELDFKDKTTAP
Ga0182040_1181011913300016387SoilQVTIILCPAKNGEPVAYIGSGDPGTKVVFSDGRELDFKDKTAPAP
Ga0066655_1037498613300018431Grasslands SoilKPGDEVTIILCPAKNGAPVAYIGSGDPGTKVIFADGRELDFKEKTAP
Ga0193692_103107643300020000SoilSRSIKPGDEITIIMCPAKNGAPVAYAGSGDAGTKVIFSNGKELDFQDKTVH
Ga0210384_1017022713300021432SoilPAKNGQPVAYMGSGDPGTKVIFADGRELDFADKTLP
Ga0210384_1022585743300021432SoilDQVTIILCPAKNGQPVAYAGSGDPGTKVIFADGRELDFTDKTVDKTAP
Ga0210392_1130821623300021475SoilIIVCPAKNGQPVAYAGSGDPGTKVIFADGRELDFVDKTAR
Ga0126371_1198347313300021560Tropical Forest SoilHSLKAGDEVTIILCPAKNGQPVAYIGSGDPGTKVIFKDGLELAFVDKTVP
Ga0126371_1368045123300021560Tropical Forest SoilAKNGQPVAYIGSGDPGTKVIFADGRELNFTDKTVEKTTP
Ga0213853_1106810413300021861WatershedsVILCPAKNGEPVAYIGSGDPGTKVIFADGRVLEFVDKTAPGK
Ga0207692_1077440123300025898Corn, Switchgrass And Miscanthus RhizosphereSLKAGDEITIILCPAKNGQPVAYAGSGDPGTKVIFADGREMDFVDKTVDKTAP
Ga0207699_1016589233300025906Corn, Switchgrass And Miscanthus RhizosphereEVTIILCPAKNGQPVAYAGSGDPGTKVIFADGRELDFTDKTVDKTAP
Ga0207687_1194179223300025927Miscanthus RhizosphereIILCPAKNGQPVAYAGSGDPGTKVIFADGRELDFTDKTVDKTLDTAK
Ga0207706_1118732023300025933Corn RhizosphereSLKAGDEVTIILCPAKNGEPVAYIGTGDPGTKVIFADGRELDFKDRTVPTP
Ga0207665_1120204323300025939Corn, Switchgrass And Miscanthus RhizosphereVGDEVTIILCPAKNGQPVAYIGSGDPGTKVIFADGRELDFTDKTVDKTAP
Ga0207661_1021855813300025944Corn RhizosphereGDQITIILCPAKNGQPVAYAGSGDPGTKVIFADGRELDFTDKTIDKTVDKTIDNAK
Ga0207661_1136192823300025944Corn RhizosphereQPVAYAGSGDPGTKVIFADGRELDFTDKTVDKTAP
Ga0207677_1155592413300026023Miscanthus RhizosphereLCPAKNGAPVAYIGTGDPGTKVIFADGRELDFAEKTAK
Ga0207708_1138462013300026075Corn, Switchgrass And Miscanthus RhizosphereWTRRSFKAGDEVSIILCPAKNGAPVAYIGTGDPGTKVIFADGRELDFAEKTAK
Ga0207674_1087532923300026116Corn RhizosphereVKPGDEVTIILCPAKNGAPVAYIGSGDPGTKVIFSNGKELDFQDRTTK
Ga0207683_1075315323300026121Miscanthus RhizosphereKAGDEVSIILCPAKNGAPVAYIGTGDPGTKVIFADGRELDFSEKTAK
Ga0209469_108328423300026307SoilGDEVTIILCPAKNGAPVAYIGSGDPGTKVIFADGRELDFKEKTAP
Ga0209055_126464913300026309SoilDGLRRSIKPGDEVTIILCPARNGEPVAYIGSGDPGTKIIFSDGRELDFKDRTAP
Ga0209474_1045091013300026550SoilRRSLKPGDEVTIILCPAKNGAPVAYIGSGDPGTKVVFADGRELDFKEK
Ga0209415_1092884623300027905Peatlands SoilLCPAKNGQPVAYIGSGDPGTKVVFADGRVLDFVDKTVDKTVDKTVP
Ga0209698_1051025123300027911WatershedsIIMCPAKNGQPVAYAGSGDPGTKVIFDDGRELDFVDKTR
Ga0209698_1053222023300027911WatershedsPAKNGQPVAYAGSGDPGAKVIFADGRELDFVDKTVDKGADKTLP
Ga0310686_11800773513300031708SoilKAGDQITIIVCPAKNGQPVAYAGSGDPGTKVIFADGHELDFTDKTAK
Ga0265342_1069414823300031712RhizosphereDQVTIILCPAKNGQPVAYAGSGDPGTKVIFADGHELDFLDKTVDKSAP
Ga0307477_1037220623300031753Hardwood Forest SoilTRRSLKAGDQVTIILCPARNGQPVAYAGSGDPGTKVIFADGRELDFVDKTAP
Ga0306919_1051361413300031879SoilCPAKNGQPVAYAGSGDPGTKVIFSDGRELDFTDKTLP
Ga0310909_1101122213300031947SoilIILCPAKNGQPVAYAGSGDPGTKVIFSDGRELDFTDKTLP
Ga0307479_1210259323300031962Hardwood Forest SoilPAKNGQPVAYIGSGDPGTKVIFADGRELNFTDKTVEKTTP
Ga0306922_1051320313300032001SoilTIILCPAKNGQPVAYIGSGDPGTKVIFADGRELNFTDKTVEKTTP
Ga0318559_1046006713300032039SoilNGQPVAYIGAGDPGTKVIFADGRELNFTDKTVEKTTP
Ga0335079_1169494413300032783SoilPAKNGQPVAYAGSGDPGTKVIFADGHELDFTDKTVEKTTP
Ga0335084_1181286413300033004SoilIKPGDEVTIILCPAKNNAPVAYIGSGDPGTKVIFADGHELDFKDKTAATP
Ga0335077_1160286713300033158SoilIILCPAKNGQPVAYIGSGDPGTKVIFADGRELNFVDKTVDKTVP
Ga0310914_1021598213300033289SoilKAGDEITIILCPAKNGQPVAYAGSGDPGTKVIFSDGRELDFTDKTLP
Ga0326726_1177248423300033433Peat SoilKNGQPVAYAGSGDPGTKVIFADGRDLDFVDKTIDKAAP
Ga0314783_170442_7_1533300034662SoilVKPGDEVTVILCPAKNGAPVAYIGSGDPGTKVIFSNGKELDFQDRTTK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.