NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F093732

Metagenome Family F093732

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F093732
Family Type Metagenome
Number of Sequences 106
Average Sequence Length 67 residues
Representative Sequence MSKQGETIHKQLEEMLQDMPVQERLERTLARIEQYLAHADEVENLNHVNFITEIKYQLEDITNKEKS
Number of Associated Samples 79
Number of Associated Scaffolds 106

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 84.76 %
% of genes near scaffold ends (potentially truncated) 24.53 %
% of genes from short scaffolds (< 2000 bps) 76.42 %
Associated GOLD sequencing projects 68
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (77.358 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(28.302 % of family members)
Environment Ontology (ENVO) Unclassified
(70.755 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(83.019 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 85.07%    β-sheet: 0.00%    Coil/Unstructured: 14.93%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 106 Family Scaffolds
PF03237Terminase_6N 2.83
PF00145DNA_methylase 1.89
PF13481AAA_25 0.94
PF13551HTH_29 0.94
PF02567PhzC-PhzF 0.94
PF05063MT-A70 0.94

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 106 Family Scaffolds
COG0270DNA-cytosine methylaseReplication, recombination and repair [L] 1.89
COG4725N6-adenosine-specific RNA methylase IME4Translation, ribosomal structure and biogenesis [J] 1.89
COG0384Predicted epimerase YddE/YHI9, PhzF superfamilyGeneral function prediction only [R] 0.94


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.28 %
UnclassifiedrootN/A4.72 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000115|DelMOSum2011_c10027028All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.2605Open in IMG/M
3300000115|DelMOSum2011_c10132470All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.763Open in IMG/M
3300000117|DelMOWin2010_c10033514All Organisms → Viruses → Predicted Viral2465Open in IMG/M
3300000117|DelMOWin2010_c10140752All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.811Open in IMG/M
3300000949|BBAY94_10180557All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.570Open in IMG/M
3300001460|JGI24003J15210_10040447All Organisms → Viruses → Predicted Viral1623Open in IMG/M
3300001460|JGI24003J15210_10067397All Organisms → Viruses → Predicted Viral1128Open in IMG/M
3300001460|JGI24003J15210_10082924All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. cty5g4964Open in IMG/M
3300004097|Ga0055584_101155948All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.808Open in IMG/M
3300004097|Ga0055584_101199528All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.792Open in IMG/M
3300004829|Ga0068515_123921All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.763Open in IMG/M
3300005057|Ga0068511_1014466All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1088Open in IMG/M
3300005920|Ga0070725_10503229All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.545Open in IMG/M
3300006027|Ga0075462_10021401All Organisms → Viruses → Predicted Viral2085Open in IMG/M
3300006735|Ga0098038_1013006All Organisms → cellular organisms → Bacteria3227Open in IMG/M
3300006735|Ga0098038_1087423Not Available1086Open in IMG/M
3300006735|Ga0098038_1094525All Organisms → Viruses → Predicted Viral1036Open in IMG/M
3300006735|Ga0098038_1094925All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1033Open in IMG/M
3300006737|Ga0098037_1039877All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1713Open in IMG/M
3300006737|Ga0098037_1066311All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1282Open in IMG/M
3300006752|Ga0098048_1011699All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.3077Open in IMG/M
3300006752|Ga0098048_1235455All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.536Open in IMG/M
3300006793|Ga0098055_1053001All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1633Open in IMG/M
3300006916|Ga0070750_10013655All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.4229Open in IMG/M
3300006916|Ga0070750_10325149All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.653Open in IMG/M
3300006920|Ga0070748_1083789All Organisms → Viruses → Predicted Viral1228Open in IMG/M
3300006928|Ga0098041_1199448All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.641Open in IMG/M
3300007229|Ga0075468_10115102All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.840Open in IMG/M
3300007276|Ga0070747_1135750All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.890Open in IMG/M
3300009124|Ga0118687_10016635All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.2407Open in IMG/M
3300009193|Ga0115551_1002310All Organisms → cellular organisms → Bacteria11663Open in IMG/M
3300009481|Ga0114932_10213362All Organisms → Viruses → Predicted Viral1172Open in IMG/M
3300009593|Ga0115011_10051059All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.2826Open in IMG/M
3300010148|Ga0098043_1050404All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1274Open in IMG/M
3300010148|Ga0098043_1101230All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.840Open in IMG/M
3300010150|Ga0098056_1060368All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1306Open in IMG/M
3300010392|Ga0118731_107999471All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.615Open in IMG/M
3300010430|Ga0118733_101937419All Organisms → Viruses → Predicted Viral1172Open in IMG/M
3300011118|Ga0114922_10507656All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.997Open in IMG/M
3300017697|Ga0180120_10114706All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1162Open in IMG/M
3300017709|Ga0181387_1031606All Organisms → Viruses → Predicted Viral1038Open in IMG/M
3300017709|Ga0181387_1035476All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.982Open in IMG/M
3300017714|Ga0181412_1007426All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.3464Open in IMG/M
3300017719|Ga0181390_1063520All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1054Open in IMG/M
3300017720|Ga0181383_1077392All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.893Open in IMG/M
3300017727|Ga0181401_1001897Not Available7939Open in IMG/M
3300017727|Ga0181401_1137192All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.603Open in IMG/M
3300017728|Ga0181419_1012019All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.2524Open in IMG/M
3300017730|Ga0181417_1066533All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.876Open in IMG/M
3300017739|Ga0181433_1087145All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.766Open in IMG/M
3300017741|Ga0181421_1128444All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.656Open in IMG/M
3300017746|Ga0181389_1158145All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.600Open in IMG/M
3300017755|Ga0181411_1062944All Organisms → Viruses → Predicted Viral1129Open in IMG/M
3300017755|Ga0181411_1120018All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.768Open in IMG/M
3300017760|Ga0181408_1167792All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.562Open in IMG/M
3300017763|Ga0181410_1035248All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1588Open in IMG/M
3300017764|Ga0181385_1237341All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.547Open in IMG/M
3300017769|Ga0187221_1022548All Organisms → Viruses → Predicted Viral2191Open in IMG/M
3300017772|Ga0181430_1160479All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium652Open in IMG/M
3300017773|Ga0181386_1094093All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.937Open in IMG/M
3300017779|Ga0181395_1156045All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.718Open in IMG/M
3300017963|Ga0180437_10285229All Organisms → Viruses → Predicted Viral1262Open in IMG/M
3300018416|Ga0181553_10174772All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1260Open in IMG/M
3300018416|Ga0181553_10288102All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.918Open in IMG/M
3300018420|Ga0181563_10138415All Organisms → Viruses → Predicted Viral1545Open in IMG/M
3300018420|Ga0181563_10426801All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.753Open in IMG/M
3300018420|Ga0181563_10465072All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.714Open in IMG/M
3300019706|Ga0193995_1057861All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.506Open in IMG/M
3300019716|Ga0193984_1032955All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.641Open in IMG/M
3300019751|Ga0194029_1023900All Organisms → cellular organisms → Bacteria943Open in IMG/M
3300019751|Ga0194029_1038369Not Available772Open in IMG/M
3300019752|Ga0193958_1090680Not Available640Open in IMG/M
3300020403|Ga0211532_10043329All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.2180Open in IMG/M
3300020439|Ga0211558_10013474All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.4224Open in IMG/M
3300021371|Ga0213863_10218047All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.831Open in IMG/M
3300021389|Ga0213868_10466472All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.685Open in IMG/M
3300021389|Ga0213868_10524278All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.633Open in IMG/M
3300022065|Ga0212024_1003167All Organisms → Viruses → Predicted Viral2006Open in IMG/M
3300022065|Ga0212024_1083265All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.569Open in IMG/M
3300022074|Ga0224906_1031038All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1826Open in IMG/M
3300022306|Ga0224509_10083203All Organisms → Viruses → Predicted Viral1102Open in IMG/M
3300024293|Ga0228651_1053766All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium963Open in IMG/M
3300024297|Ga0228658_1010722All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.2398Open in IMG/M
3300024344|Ga0209992_10133992All Organisms → Viruses → Predicted Viral1088Open in IMG/M
3300025070|Ga0208667_1022444All Organisms → Viruses → Predicted Viral1210Open in IMG/M
3300025070|Ga0208667_1038915All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.812Open in IMG/M
3300025086|Ga0208157_1006631All Organisms → cellular organisms → Bacteria4088Open in IMG/M
3300025098|Ga0208434_1079675All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.668Open in IMG/M
3300025108|Ga0208793_1055541All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1205Open in IMG/M
3300025108|Ga0208793_1078846All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.953Open in IMG/M
3300025120|Ga0209535_1018713All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.3574Open in IMG/M
3300025120|Ga0209535_1027225All Organisms → cellular organisms → Bacteria2764Open in IMG/M
3300025120|Ga0209535_1032533All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.2439Open in IMG/M
3300025128|Ga0208919_1173901All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.657Open in IMG/M
3300025137|Ga0209336_10015320All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.2871Open in IMG/M
3300025137|Ga0209336_10172971All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300025632|Ga0209194_1088819All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.801Open in IMG/M
3300025652|Ga0208134_1059766All Organisms → Viruses → Predicted Viral1172Open in IMG/M
3300025759|Ga0208899_1032219All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.2438Open in IMG/M
3300025806|Ga0208545_1086389All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.845Open in IMG/M
3300027906|Ga0209404_10072148All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.1993Open in IMG/M
3300032011|Ga0315316_10693473All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.846Open in IMG/M
3300032073|Ga0315315_10040508All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.4330Open in IMG/M
3300032136|Ga0316201_11365485All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300032277|Ga0316202_10618812All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.511Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine28.30%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater20.75%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous11.32%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater4.72%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh4.72%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine3.77%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment1.89%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater1.89%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment1.89%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater1.89%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine1.89%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine1.89%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.89%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface1.89%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater Microbial Mat0.94%
Marine WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water0.94%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface0.94%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine0.94%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat0.94%
Worm BurrowEnvironmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow0.94%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.94%
Marine WaterEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Water0.94%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.94%
Hypersaline Lake SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment0.94%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment0.94%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.94%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300000949Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94Host-AssociatedOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300004829Marine water microbial communities from the Pohang Bay, Korea with extracellular vesicles - Pohang-EVsEnvironmentalOpen in IMG/M
3300005057Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-0.2umEnvironmentalOpen in IMG/M
3300005920Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2EnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006737Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaGEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300006928Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaGEnvironmentalOpen in IMG/M
3300007229Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300009124Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsfEnvironmentalOpen in IMG/M
3300009193Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321EnvironmentalOpen in IMG/M
3300009481Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaGEnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300010148Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaGEnvironmentalOpen in IMG/M
3300010150Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaGEnvironmentalOpen in IMG/M
3300010392Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385EnvironmentalOpen in IMG/M
3300010430Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samplesEnvironmentalOpen in IMG/M
3300011118Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaGEnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017709Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27EnvironmentalOpen in IMG/M
3300017714Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017720Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23EnvironmentalOpen in IMG/M
3300017727Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20EnvironmentalOpen in IMG/M
3300017728Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24EnvironmentalOpen in IMG/M
3300017730Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13EnvironmentalOpen in IMG/M
3300017739Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10EnvironmentalOpen in IMG/M
3300017741Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19EnvironmentalOpen in IMG/M
3300017746Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29EnvironmentalOpen in IMG/M
3300017755Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09EnvironmentalOpen in IMG/M
3300017760Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017764Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11EnvironmentalOpen in IMG/M
3300017769Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2)EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017773Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24EnvironmentalOpen in IMG/M
3300017779Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16EnvironmentalOpen in IMG/M
3300017963Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaGEnvironmentalOpen in IMG/M
3300018416Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019706Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_1-2_MGEnvironmentalOpen in IMG/M
3300019716Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRC_0-1_MGEnvironmentalOpen in IMG/M
3300019751Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MGEnvironmentalOpen in IMG/M
3300019752Microbial mat bacterial communities from the Broadkill River, Lewes, Delaware, United States - FB_1_MGEnvironmentalOpen in IMG/M
3300020403Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145)EnvironmentalOpen in IMG/M
3300020439Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029)EnvironmentalOpen in IMG/M
3300021371Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497EnvironmentalOpen in IMG/M
3300021389Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127EnvironmentalOpen in IMG/M
3300022065Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2)EnvironmentalOpen in IMG/M
3300022074Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)EnvironmentalOpen in IMG/M
3300022306Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_24EnvironmentalOpen in IMG/M
3300024293Seawater microbial communities from Monterey Bay, California, United States - 63DEnvironmentalOpen in IMG/M
3300024297Seawater microbial communities from Monterey Bay, California, United States - 71DEnvironmentalOpen in IMG/M
3300024344Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025070Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025086Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025098Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025108Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025128Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025137Marine viral communities from the Pacific Ocean - LP-32 (SPAdes)EnvironmentalOpen in IMG/M
3300025632Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 (SPAdes)EnvironmentalOpen in IMG/M
3300025652Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025806Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027906Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300032011Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416EnvironmentalOpen in IMG/M
3300032073Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416EnvironmentalOpen in IMG/M
3300032136Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrowEnvironmentalOpen in IMG/M
3300032277Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotiteEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2011_1002702843300000115MarineMSKQGETIHKQLEEMLQDMPTQERLERTLARIEQYLAHADEVENLNHVNFITEIKYQLEDITNKEQA*
DelMOSum2011_1013247043300000115MarineMVRRMATRGTKPMSKQGETIHKQLEEMLQDMPTQERLERTLARIEQYLAHADEVENLNHVNFITEIKYQLEDITNKETN*
DelMOWin2010_1003351443300000117MarineMSKQGETIHKQLEEMLQDMPTQERLERTLARIEQYLAHADEVENLNHVNFITEIKYQLEDITNKENNQ*
DelMOWin2010_1014075233300000117MarineMSKQGETIHKQLEEMLQDMPTQERLERTLARIEQYLAHADEVENLNHVNFITEIKYQLEDITNKETN*
BBAY94_1018055713300000949Macroalgal SurfaceEEILQDMPVQERLERTLARIEQYLAHANEVQNLNHINFINEIKYQLEDITNREKS*
JGI24003J15210_1004044723300001460MarineMSKQGETIHKQLEEMLQDMPIQERLERTLARIEQYLAHADEVENLNHVNFITEIKYQLEDITNKEKS*
JGI24003J15210_1006739713300001460MarineMSKQGETIHKQLEEMLQDMPVQERLERTLARIEQYLSHADEVENLNHVNFITEIKYQLEDITNKEKS*
JGI24003J15210_1008292433300001460MarineMIRQGETIHKQLEEMLQDMPVQERLERTLARIEQYLAHADEVENLNHVNFITEIKYQLEDITNKEKS*
Ga0055584_10115594833300004097Pelagic MarineMSKQGETIHKQLEEMLQDMPVQERLERTLARIEQYLAHADEVENLNHVNFITEIKYQLEDITNKGKS*
Ga0055584_10119952833300004097Pelagic MarineMSKQGETIHKQLEEMLQDMPTQERLERTLARIEQYLAHADEVQNLNHVNFITEIKYQLEDITNREKG*
Ga0068515_12392123300004829Marine WaterMSKQGETIHKQLEEILQDMPVQERLERTLARIEQYLAHADEVKNLNHVNFINEIKYQLEDITNRENNQ*
Ga0068511_101446613300005057Marine WaterMSKQGETIHKQLEEILQDMPVQERLERTLARIEQYLVHADEVQNLNHVNFINEIKYQLEDITNKEKS*
Ga0070725_1050322913300005920Marine SedimentMSKQGETIHKQLEEMLQDMPTQERLERTLARIEQYLAHADEVENLNHVNFITEIKYQ
Ga0075462_1002140153300006027AqueousMSKQGETIHKQLEEILQDMPVQERLERTLARIEQYLAHADEVKNLNHVNFINEIKYQLEDITNREKS*
Ga0098038_101300623300006735MarineMSKQGETIHKQLEEILQDMPVQERLERTLARIEQYLAHADEVKNLNHVNFINEIKYQLEDITNKEKS*
Ga0098038_108742313300006735MarineMSKQGETIHKQLEEILQDRPVQERLERTLARIEQYLAHTDEAQNLNHVNFITEIKYQLEDITNKEKS*
Ga0098038_109452513300006735MarineQGETIHKQLEEILQDMPVQERLERTLARIEQYLAHADEVQNLNHVNFINEIKYQLEDITNKGER*
Ga0098038_109492513300006735MarineMSKQGETIHKQLEEMLQDMPVQERLERTLARIEQYLAHTDEVENLNHVNFITEIKYLLEDITNKGEK*
Ga0098037_103987763300006737MarineMSKQGETIHKQLEEILQDMPVQERLERTLARIEQYLAHADEVQNLNHVNFINEIKYQLEDITNKEKS*
Ga0098037_106631133300006737MarineMSKQGETIHKKLEEMLQDMPTQERLERTLARIEQYLAQTDEVENLNHVNFITEIKYQLEDITNKEKS*
Ga0098048_101169963300006752MarineMSKQGETIHKQLEEMLQDMPVQERLERTLARIEQYLAHTDEVENLNHVNFITEIKYQLEDITNKEKS*
Ga0098048_123545523300006752MarineMSKQGETIHKQLEEILQDMPVQERLERTLARIEQYLAHADEVKNLNHVNFINEIKYQLEDITNKGER*
Ga0098055_105300143300006793MarineMSKQGETIHKQLEEMLQDMSVQKRLNRLLFKIEQYLAHTDEVENLNHVNFITEIKYQLEDITNKEKS*
Ga0070750_1001365583300006916AqueousMSKQGETIHKQLEEMLQDMPVQKRLERLLFKIEQYLAHSDEAQNLNHVNFITEIKYQLEDITNKEKS*
Ga0070750_1032514933300006916AqueousMSKQGETIHKQLEEILQDMPVQERLERTLARIEQYLAHADDVENLNHVNFINEIKYQLEDITNKERS*
Ga0070748_108378933300006920AqueousMSRQGETIHKQLEEMLQDMPVQERLERTLARIEQYLAHADEVENLNHVNFITEIKYQLEDITNRERS*
Ga0098041_119944813300006928MarineMSKQGETIHKQLEEILQDMPVQERLERTLARIEQYLAHADEVKNLNHVNFINEIKYQLEDITNK
Ga0075468_1011510223300007229AqueousMSKQGETIHKQLEEMLQDMPVQERLERTLARIEQYLAHADEVENLNHVNFITEIKYQLEDITNKETN*
Ga0070747_113575023300007276AqueousMSKQGETIHKQLEEMLQDMPVQERLERTLARIEQYLAHADEVENLNHVNFITEIKYQLEDITNKEKS*
Ga0118687_1001663563300009124SedimentMSKQGETIHKQLEEILQDMPVQERLERTLARIEQYLAHADEVENLNHINFINEIKYQLEDITNKEKS*
Ga0115551_1002310173300009193Pelagic MarineMSKQGETIHKQLEEMLQDMPVQERLERTLARIQQYLAHADEVKNLNHVNFITEIKYQLEDITNKEKS*
Ga0114932_1021336233300009481Deep SubsurfaceMSKQGETIHKQLEEMLQDMPTQERLERTLARIEQYLAHADEAQNLNHVNFITEIKYQLEDITNKEKS*
Ga0115011_1005105953300009593MarineMSKQGETIHKQLEEILQDMPVQERLERTLARIEQYLAHADEVENLNHVNFINEIKYQLEDITNRENK*
Ga0098043_105040413300010148MarineETIHKQLEEILQDMPVQERLERTLARIEQYLAHTDEAQNLNHVNFITEIKYQLEDITNKEKS*
Ga0098043_110123013300010148MarineMSKQGETIHKQLEEILQDMPVQERLERTLARIEQYLAHANEVKNLNHVNFINEIKYQLEDITNKEKS*
Ga0098056_106036823300010150MarineMSKQGETIHKQLEEMLQDMPTQERLERTLARIEQYLAHTDEVENLNHVNFITEIKYQLEDITNKEKS*
Ga0118731_10799947123300010392MarineMSKQGETIHKQLEEMLQDMPTQERLERTLARIEQYLAHADEVENLNHVNFITEIKYQLEDITNKEKS*
Ga0118733_10193741943300010430Marine SedimentMATRGTKPMSKQGETIHKQLEEMLQDMPTQERLERTLARIEQYLAHADEVENLNHVNFITEIKYQLEDITNKETN*
Ga0114922_1050765633300011118Deep SubsurfaceMSRQGETIHKQLEEMLQDMPTQERLERTLAKIEQWLAHSDEAQNLNHVNFITEIKYQLEDITNKEKS*
Ga0180120_1011470613300017697Freshwater To Marine Saline GradientAKPMSKQGETIHKQLEEMLQDMPVQKRLERLLFKIEQYLAHSDEAQNLNHVNFITEIKYQLEDITNKEKS
Ga0181387_103160633300017709SeawaterMSKQGETIHKQLEEMLQDMPTQERLERTLARIEQYLSHADEVENLNHVNFITEIKYQLEDITNKEKS
Ga0181387_103547623300017709SeawaterMSKQGETIHKQLEEMLQDMPTQERLERTLARIEQYLAHADEVENLNHVNFINEIKYQLEDITNKGE
Ga0181412_100742673300017714SeawaterMSKQGETIHKKLEEMLQDMPVQERLERTLARIEQYLAHTDEVENLNHVNFITEIKYQLEDITNKENN
Ga0181390_106352013300017719SeawaterHKQLEEMLQDMPVQERLERTLARIQQYLAHTDEVENLNHVNFITEIKYQLEDITNKEKS
Ga0181383_107739243300017720SeawaterMSKQGETIHKQLEEMLQDMPTQERLERTLARIEQYLAHADEVENLNHVNFITEIKYQLEDITNREKS
Ga0181401_100189763300017727SeawaterMSKQGETIHKQLEEMLQDMPIQERLERTLARIEQYLAHADEVENLNHVNFITEIKYQLEDITNREKS
Ga0181401_113719213300017727SeawaterMSKQGETIHKQLEEMLQDMPVQERLERTLARIEQYLSHADEVENLNHVNFITEIKYQLEDITNREKS
Ga0181419_101201943300017728SeawaterMSKQGETIHKQLEEMLQDMPVQERLERTLARIEQYLAHTDEVENLNHVNFITEIKYQLEDITNKENN
Ga0181417_106653333300017730SeawaterMRMVWRMATRGTKPMSKQGETIHKQLEEMLQDMPVQERLERTLARIEQYLAHTDEVENLNHVNFITEIKYQLEDITNKENN
Ga0181433_108714533300017739SeawaterMSKQGETIHKQLEEMLQDMPVQERLERTLARIEQYLSHADEVENLNHVNFITEIKYQLEDITNKE
Ga0181421_112844423300017741SeawaterMSKQGETIHKQLEEMLQDMPVQERLERTLARIEQYLAHADEVENLNHVNFITEIKYQLEDITNKENN
Ga0181389_115814533300017746SeawaterMSKQGETIHKQLEEMLQDMPTQERLERTLARIEQYLAHADEVENLNHVNFITEIKYQLEDITNKEKS
Ga0181411_106294453300017755SeawaterMRMVWRMATRGTKPMSKQGETIHKQLEEMLQDMPVQERLERTLARIEQYLAHTDEVENLNHVNFITEIKYQLEDITNKEKS
Ga0181411_112001813300017755SeawaterMSKQGETIHKQLEEMLQDMPVQERLERTLARIEQYLSHADEVENLNHVNFITEIKYQLEDITNKENNNES
Ga0181408_116779213300017760SeawaterMSKQGETIHKQLEEMLQDMPVQERLERTLARIEQYLSHADEVENLNHVNFITEIKYQLEDITNKENN
Ga0181410_103524813300017763SeawaterQGETIHKQLEEMLQDMPVQERLERTLARIEQYLSHADEVENLNHVNFITEIKYQLEDITNKEKS
Ga0181385_123734123300017764SeawaterMSKQGETIHKQLEEMLQDMPVQERLERTLARIEQYLAHADEVQNLNHVNFINEIKYQLEDITNKGE
Ga0187221_102254863300017769SeawaterMLKLVTRLLITKGAKPMSKQGETIHKQLEEMLQDMPTQERLERTLARIEQYLAHADEVENLNHVNFITEIKYQLEDITNREKS
Ga0181430_116047943300017772SeawaterMSKQGETIHKQLEEMLQDMPVQERLERTLARIEQYLAHADEVENLNHVNFITEIK
Ga0181386_109409323300017773SeawaterMSKQGETIHKQLEEMLQDMSVQERLERTLARIEQYLAHADEVENLNHVNFITEIKYQLEDITNKEKS
Ga0181395_115604523300017779SeawaterMSKQGETIHKQLEEMLQDMPVQERLERTLARIEQYLAHTDEVENLNHVNFITEIKYQLEDITNKEKS
Ga0180437_1028522913300017963Hypersaline Lake SedimentTELQQLRNQTMSKQGETIHKQLEEILQDMPVQERLERTLARIEQYLAHADEVENLNHVNFINEIKYQLEDITNKEKN
Ga0181553_1017477223300018416Salt MarshMSKQGETIHKQLEEILQDMPIQERLERTLARIEQYLAHADEVKNLNHVNFITEIKYTLEDITNKEGS
Ga0181553_1028810253300018416Salt MarshMSKQGETIHKQLEEILQDMPVQERLERTLARIEQYLAHADEVKNLNHVNFITEIKYTLEDITN
Ga0181563_1013841553300018420Salt MarshMSKQGETIHKQLEEILQDMPVQERLERTLARIEQYLAHADEVKNLNHVNFITEIKYTLEDITNKEGS
Ga0181563_1042680113300018420Salt MarshMSKQGETIHKQLEEILQDMPVQERLERTLARIEQYLAHADEVQNLNHINFINEIKYQ
Ga0181563_1046507213300018420Salt MarshKPMSKQGETIHKQLEEILQDMPVQERLERTLARIEQYLAHADEVKNLNHVNFINEIKYQLEDITNREKS
Ga0193995_105786123300019706SedimentMSKQGETIHKQLEEILQDMPVQERLERTLARIEQYLAHADEVKNLNHVNFINEIKYQLEDITNKEKS
Ga0193984_103295533300019716SedimentMSRQGETIHKQLEEMLQDMPVQERLERTLARIEQYLAHADEVENLNHVNFITEIKYQLEDITNRERS
Ga0194029_102390013300019751FreshwaterMSRQGETIHKQLEEMLQDMPVQERLERTLARIEQYLAHADEVENLNHVNFITEIKYQLEDITNKEKS
Ga0194029_103836933300019751FreshwaterMSKQGETIHKQLEEMLQDMPTQERLERTLARIEQYLAHADEVENLNHVNFITEIKY
Ga0193958_109068013300019752Freshwater Microbial MatMSRQGETIHKQLEEMLQDMPVQERLERTLARIEQYLAHADEVENLNHVNFINEIKYQLEDITNKEKS
Ga0211532_1004332923300020403MarineMSKQGETIHKQIEEILQDMPVQERLERTLARIEQYLAHADEVQNLNHVNFINEIKYQLEDITNKGKG
Ga0211558_1001347453300020439MarineMSKQGETIHKQLEEILQDMPVQERLERTLARIEQYLAHADEVENLNHVNFINEIKYQLEDITNKEKS
Ga0213863_1021804713300021371SeawaterATTRGTKPMSKQGETIHKQLEEMLQDMPVQERLERTLARIQQYLAHADEVENLNHVNFITEIKYQLEDITNKEKS
Ga0213868_1046647233300021389SeawaterETIHKQLEEMLQDMPTQERLERTLARIEQYLAHADEVENLNHVNFITEIKYQLEDITNKENNQ
Ga0213868_1052427813300021389SeawaterMSKQGETIHKQLEEMLQDMPTQERLERTLAKIEQYLAHADEVENLNHVNFITEIKYQLEDITNKETN
Ga0212024_100316773300022065AqueousMSKQGETIHKQLEEILQDMPVQERLERTLARIEQYLAHADEVKNLNHVNFINEIKYQLEDITNREKS
Ga0212024_108326513300022065AqueousMSKQGETIHKQLEEILQDMPVQERLERTLARIEQYLAHADEVKNLNHVNFINEIKYQLAF
Ga0224906_103103853300022074SeawaterMSKQGETIHKQLEEMLQDMPVQERLERTLARIQQYLAHADEVENLNHVNFITEIKYQLEDITNKENN
Ga0224509_1008320333300022306SedimentMSKQGETIHKQLEEMLQDMPVQERLERTLARIEQYLSHADEVENLNHVNFITEIKYQLEDITNKEKS
Ga0228651_105376643300024293SeawaterMAIRGTKPMSKQGETIHKQLEEMLQDMPVQERLERTLARIQQYLAHADEVENLNHVNFITEIKYQLEDITNKEKS
Ga0228658_101072273300024297SeawaterMSKQGETIHKQLEEMLQDMPVQERLERTLARIQQYLAHADEVENLNHVNFITEIKYQLEDITNKEKS
Ga0209992_1013399233300024344Deep SubsurfaceMSKQGETIHKQLEEMLQDMPTQERLERTLARIEQYLAHADEAQNLNHVNFITEIKYQLEDITNKEKS
Ga0208667_102244433300025070MarineMSKQGETIHKQLEEMLQDMPVQERLERTLARIEQYLAHTDEVENLNHVNFITEIKYLLEDITNKGEK
Ga0208667_103891523300025070MarineMSKQGETIHKQLEEMLQDMSVQKRLNRLLFKIEQYLAHTDEVENLNHVNFITEIKYQLEDITNKEKS
Ga0208157_100663183300025086MarineMSKQGETIHKQLEEILQDMPVQERLERTLARIEQYLAHADEVQNLNHVNFINEIKYQLEDITNKEKS
Ga0208434_107967523300025098MarineMSKQGETIHKQLEEMLQDMSVQKRLNRLLFKIEQYLAHTDEVENLNHVNFITEIKYQLEDITNKGEK
Ga0208793_105554153300025108MarineTIHKQLEEMLQDMPTQERLERTLARIEQYLAHTDEVENLNHVNFITEIKYQLEDITNKEK
Ga0208793_107884643300025108MarineKQGETIHKQLEEMLQDMPVQERLERTLARIEQYLAHTDEVENLNHVNFITEIKYLLEDITNKGEK
Ga0209535_101871383300025120MarineMIRQGETIHKQLEEMLQDMPVQERLERTLARIEQYLAHADEVENLNHVNFITEIKYQLEDITNKEKS
Ga0209535_102722563300025120MarineMSKQGETIHKQLEEMLQDMPIQERLERTLARIEQYLAHADEVENLNHVNFITEIKYQLEDITNKEKS
Ga0209535_103253363300025120MarineMIRQGETIHKQLEEMLQDMPTQERLERTLARIEQYLAHADEVENLNHVNFITEIKYQLEDITNKEKS
Ga0208919_117390113300025128MarineTATTRGAKPMSKQGETIHKKLEEMLQDMPTQERLERTLARIEQYLAHTDEVENLNHVNFITEIKYQLEDITNKEKS
Ga0209336_1001532063300025137MarineMSKQGETIHKQLEEMLQDMPVQERLERTLARIEQYLAHADEVENLNHVNFITEIKYQLEDITNKEKS
Ga0209336_1017297113300025137MarineMSKQGETIHKQLEEMLQDMPVQERLERTLARIEQYLSHADEVENLNHVNFITEIKYQLEDITNKEK
Ga0209194_108881923300025632Pelagic MarineMSKQGETIHKQLEEMLQDMPVQERLERTLARIQQYLAHADEVKNLNHVNFITEIKYQLEDITNKEKS
Ga0208134_105976623300025652AqueousMSKQGETIHKQLEEMLQDMPTQERLERTLARIEQYLAHADEVENLNHVNFITEIKYQLEDITNKETN
Ga0208899_103221933300025759AqueousMSKQGETIHKQLEEMLQDMPVQKRLERLLFKIEQYLAHSDEAQNLNHVNFITEIKYQLEDITNKEKS
Ga0208545_108638923300025806AqueousMRMVRRMATRGTKPMSKQGETIHKQLEEMLQDMPVQERLERTLARIEQYLAHADEVENLNHVNFITEIKYQLEDITNKETN
Ga0208545_115478533300025806AqueousEGEEMSRSNRIKLETELQQLRNQTMSKQGETIHKQIEEMLQDMPVQERLERTLARIEQYLTHADQVENLNHVNFINEIKYQLEDITNKEKS
Ga0209404_1007214843300027906MarineMSKQGETIHKQLEEILQDMPVQERLERTLARIEQYLAHADEVENLNHVNFINEIKYQLEDITNRENK
Ga0315316_1069347313300032011SeawaterMSKQGETIHKQLEEMLQDMPVQERLERTLARIEQYLAHADEVENLNHVNFINEIKYQLEDITNKEKS
Ga0315315_1004050863300032073SeawaterMSKQGETIHKQLEEMLQDMSVQERLERTLARIEQYLAHADEVENLNHVNFINEIKYQLEDITNKEKS
Ga0316201_1136548513300032136Worm BurrowMSKQGETIHKQLEEMLQDMPVQERLERTLARIEQYLAHADEVENLNHVNFITEIKYQLEDITN
Ga0316202_1061881223300032277Microbial MatMSRQGETIHKQLEEMLQDMPTQERLERTLARIEQYLAHADEVENLNHVNFITEIKYQLEDITNKERS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.