Metagenome / Metatranscriptome Family F094027

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F094027
Family Type	Metagenome / Metatranscriptome
Number of Sequences	106
Average Sequence Length	40 residues
Representative Sequence	MKTVSGKWVAIVIGVAIIIAVAAGCYWLYLDFQSAPRQP
Number of Associated Samples	76
Number of Associated Scaffolds	106

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	22.64 %
% of genes near scaffold ends (potentially truncated)	32.08 %
% of genes from short scaffolds (< 2000 bps)	83.96 %
Associated GOLD sequencing projects	62
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.56

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (66.981 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere (11.321 % of family members)
Environment Ontology (ENVO)	Unclassified (59.434 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (68.868 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	Yes	Secondary Structure distribution:	α-helix: 43.28% β-sheet: 0.00% Coil/Unstructured: 56.72%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.56
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.56
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 106 Family Scaffolds
PF03602	Cons_hypoth95	43.40
PF05345	He_PIG	13.21
PF00271	Helicase_C	4.72
PF08842	Mfa2	3.77
PF12850	Metallophos_2	0.94
PF00719	Pyrophosphatase	0.94
PF13561	adh_short_C2	0.94
PF17191	RecG_wedge	0.94
PF05990	DUF900	0.94
PF01741	MscL	0.94

COG ID	Name	Functional Category	% Frequency in 106 Family Scaffolds
COG0742	16S rRNA G966 N2-methylase RsmD	Translation, ribosomal structure and biogenesis [J]	43.40
COG1092	23S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmI	Translation, ribosomal structure and biogenesis [J]	43.40
COG2242	Precorrin-6B methylase 2	Coenzyme transport and metabolism [H]	43.40
COG2265	tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family	Translation, ribosomal structure and biogenesis [J]	43.40
COG2890	Methylase of polypeptide chain release factors	Translation, ribosomal structure and biogenesis [J]	43.40
COG0221	Inorganic pyrophosphatase	Energy production and conversion [C]	0.94
COG1970	Large-conductance mechanosensitive channel	Cell wall/membrane/envelope biogenesis [M]	0.94
COG4782	Esterase/lipase superfamily enzyme	General function prediction only [R]	0.94

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	66.98 %
Unclassified	root	N/A	33.02 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	66.98 %
Unclassified	root	N/A	33.02 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	66.98 %
Unclassified	root	N/A	33.02 %

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	52.83 %
Unclassified	root	N/A	33.02 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	33.02 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	21.70 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	5.66 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	33.02 %
Bryobacterales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	10.38 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_59_13	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_59_13	4.72 %
unclassified Terriglobia	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia	4.72 %
Acidobacteriales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales	3.77 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.94 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	33.02 %
Solibacteraceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae	7.55 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_59_13	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_59_13	4.72 %
Acidobacteriia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	3.77 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	3.77 %
Bryobacteraceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae	1.89 %
Acidobacteriia bacterium 12-62-4	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4	0.94 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.94 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	33.02 %
Candidatus Solibacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter	7.55 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_59_13	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_59_13	4.72 %
Acidobacteriia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	3.77 %
unclassified Acidobacteriaceae	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae	2.83 %
Bryobacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter	1.89 %
Acidobacteriia bacterium 12-62-4	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4	0.94 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.94 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.94 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	33.02 %
Candidatus Solibacter usitatus	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	7.55 %
Acidobacteria bacterium RIFCSPLOWO2_02_FULL_59_13	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_59_13	4.72 %
Acidobacteriia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	3.77 %
Acidobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium	2.83 %
Bryobacter aggregatus	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus	1.89 %
Acidobacteriia bacterium 12-62-4	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4	0.94 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.94 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.94 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2170459010\|GIO7OMY02JPG8N	Not Available	521	Open in IMG/M
3300000955\|JGI1027J12803_101233043	Not Available	641	Open in IMG/M
3300001356\|JGI12269J14319_10329433	Not Available	542	Open in IMG/M
3300004019\|Ga0055439_10022302	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	1534	Open in IMG/M
3300005295\|Ga0065707_10791838	Not Available	602	Open in IMG/M
3300005327\|Ga0070658_10632660	All Organisms → cellular organisms → Bacteria → Acidobacteria	928	Open in IMG/M
3300005328\|Ga0070676_10203463	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	1299	Open in IMG/M
3300005329\|Ga0070683_100008426	All Organisms → cellular organisms → Bacteria → Proteobacteria	8756	Open in IMG/M
3300005329\|Ga0070683_100149344	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	2215	Open in IMG/M
3300005329\|Ga0070683_101102872	All Organisms → cellular organisms → Bacteria → Acidobacteria	762	Open in IMG/M
3300005334\|Ga0068869_100448827	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus	1069	Open in IMG/M
3300005334\|Ga0068869_101034726	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus	716	Open in IMG/M
3300005338\|Ga0068868_101601915	All Organisms → cellular organisms → Bacteria → Acidobacteria	612	Open in IMG/M
3300005340\|Ga0070689_100193941	All Organisms → cellular organisms → Bacteria → Acidobacteria	1655	Open in IMG/M
3300005365\|Ga0070688_101126360	All Organisms → cellular organisms → Bacteria → Acidobacteria	628	Open in IMG/M
3300005434\|Ga0070709_10505153	All Organisms → cellular organisms → Bacteria → Acidobacteria	919	Open in IMG/M
3300005436\|Ga0070713_100804704	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium	901	Open in IMG/M
3300005439\|Ga0070711_100868531	All Organisms → cellular organisms → Bacteria → Acidobacteria	768	Open in IMG/M
3300005439\|Ga0070711_101085301	Not Available	689	Open in IMG/M
3300005439\|Ga0070711_101223727	All Organisms → cellular organisms → Bacteria → Acidobacteria	650	Open in IMG/M
3300005459\|Ga0068867_101031265	All Organisms → cellular organisms → Bacteria	747	Open in IMG/M
3300005538\|Ga0070731_10397782	All Organisms → cellular organisms → Bacteria	916	Open in IMG/M
3300005542\|Ga0070732_10271134	All Organisms → cellular organisms → Bacteria → Acidobacteria	1017	Open in IMG/M
3300005545\|Ga0070695_100784603	All Organisms → cellular organisms → Bacteria	762	Open in IMG/M
3300005563\|Ga0068855_100461214	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_59_13	1385	Open in IMG/M
3300005578\|Ga0068854_100073790	All Organisms → cellular organisms → Bacteria → Acidobacteria	2502	Open in IMG/M
3300005614\|Ga0068856_100074822	All Organisms → cellular organisms → Bacteria	3354	Open in IMG/M
3300005614\|Ga0068856_101104229	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium	810	Open in IMG/M
3300005718\|Ga0068866_10239767	Not Available	1104	Open in IMG/M
3300005718\|Ga0068866_10429734	All Organisms → cellular organisms → Bacteria → Acidobacteria	859	Open in IMG/M
3300005842\|Ga0068858_100767182	Not Available	940	Open in IMG/M
3300005842\|Ga0068858_100839403	Not Available	897	Open in IMG/M
3300005842\|Ga0068858_101076462	All Organisms → cellular organisms → Bacteria → Acidobacteria	789	Open in IMG/M
3300006059\|Ga0075017_100154418	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_59_13	1636	Open in IMG/M
3300006237\|Ga0097621_100799268	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium	874	Open in IMG/M
3300006237\|Ga0097621_102418929	Not Available	503	Open in IMG/M
3300006358\|Ga0068871_100175655	All Organisms → cellular organisms → Bacteria → Acidobacteria	1839	Open in IMG/M
3300006638\|Ga0075522_10000014	All Organisms → cellular organisms → Bacteria	100958	Open in IMG/M
3300006804\|Ga0079221_10474640	Not Available	803	Open in IMG/M
3300006854\|Ga0075425_101829467	All Organisms → cellular organisms → Bacteria → Acidobacteria	681	Open in IMG/M
3300006881\|Ga0068865_100092861	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2193	Open in IMG/M
3300006881\|Ga0068865_101492891	All Organisms → cellular organisms → Bacteria	605	Open in IMG/M
3300006893\|Ga0073928_11030898	All Organisms → cellular organisms → Bacteria → Acidobacteria	559	Open in IMG/M
3300009093\|Ga0105240_10069148	All Organisms → cellular organisms → Bacteria → Acidobacteria	4372	Open in IMG/M
3300009093\|Ga0105240_11746539	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	649	Open in IMG/M
3300009098\|Ga0105245_10003189	All Organisms → cellular organisms → Bacteria	14667	Open in IMG/M
3300009098\|Ga0105245_10095757	All Organisms → cellular organisms → Bacteria	2739	Open in IMG/M
3300009098\|Ga0105245_10878135	Not Available	938	Open in IMG/M
3300009148\|Ga0105243_12488283	All Organisms → cellular organisms → Bacteria → Acidobacteria	557	Open in IMG/M
3300009176\|Ga0105242_10016220	All Organisms → cellular organisms → Bacteria	5789	Open in IMG/M
3300009176\|Ga0105242_11593788	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_59_13	686	Open in IMG/M
3300009553\|Ga0105249_10459866	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_59_13	1312	Open in IMG/M
3300009553\|Ga0105249_12566033	All Organisms → cellular organisms → Bacteria → Acidobacteria	582	Open in IMG/M
3300010359\|Ga0126376_11946661	Not Available	628	Open in IMG/M
3300010373\|Ga0134128_11146358	Not Available	858	Open in IMG/M
3300010379\|Ga0136449_100136126	All Organisms → cellular organisms → Bacteria	4874	Open in IMG/M
3300010396\|Ga0134126_11900815	All Organisms → cellular organisms → Bacteria	651	Open in IMG/M
3300010400\|Ga0134122_13368147	Not Available	503	Open in IMG/M
3300011119\|Ga0105246_10202182	Not Available	1545	Open in IMG/M
3300012982\|Ga0168317_1001434	All Organisms → cellular organisms → Bacteria	13438	Open in IMG/M
3300013105\|Ga0157369_10019065	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	7681	Open in IMG/M
3300013306\|Ga0163162_13366306	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_59_13	511	Open in IMG/M
3300013308\|Ga0157375_12767075	Not Available	586	Open in IMG/M
3300014325\|Ga0163163_10061996	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	3705	Open in IMG/M
3300014325\|Ga0163163_10971656	Not Available	913	Open in IMG/M
3300014969\|Ga0157376_10322269	All Organisms → cellular organisms → Bacteria	1470	Open in IMG/M
3300014969\|Ga0157376_10650848	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	1054	Open in IMG/M
3300017973\|Ga0187780_11276002	Not Available	539	Open in IMG/M
3300020580\|Ga0210403_10679804	Not Available	826	Open in IMG/M
3300020580\|Ga0210403_11066236	Not Available	629	Open in IMG/M
3300021168\|Ga0210406_10906474	Not Available	663	Open in IMG/M
3300021170\|Ga0210400_11105018	Not Available	641	Open in IMG/M
3300021170\|Ga0210400_11221516	All Organisms → cellular organisms → Bacteria → Acidobacteria	605	Open in IMG/M
3300022724\|Ga0242665_10369182	Not Available	518	Open in IMG/M
3300025558\|Ga0210139_1061498	Not Available	762	Open in IMG/M
3300025862\|Ga0209483_1000013	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	217700	Open in IMG/M
3300025911\|Ga0207654_10287430	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	1114	Open in IMG/M
3300025911\|Ga0207654_10483835	All Organisms → cellular organisms → Bacteria → Acidobacteria	872	Open in IMG/M
3300025911\|Ga0207654_10560591	Not Available	812	Open in IMG/M
3300025912\|Ga0207707_10016764	All Organisms → cellular organisms → Bacteria → Acidobacteria	6382	Open in IMG/M
3300025913\|Ga0207695_11008723	All Organisms → cellular organisms → Bacteria → Acidobacteria	712	Open in IMG/M
3300025913\|Ga0207695_11040686	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	698	Open in IMG/M
3300025923\|Ga0207681_10880116	Not Available	750	Open in IMG/M
3300025927\|Ga0207687_10176673	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	1651	Open in IMG/M
3300025927\|Ga0207687_10611720	Not Available	919	Open in IMG/M
3300025927\|Ga0207687_11114434	Not Available	678	Open in IMG/M
3300025934\|Ga0207686_10108746	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4	1866	Open in IMG/M
3300025934\|Ga0207686_11398676	Not Available	576	Open in IMG/M
3300025960\|Ga0207651_11614289	Not Available	584	Open in IMG/M
3300025961\|Ga0207712_10131227	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	1910	Open in IMG/M
3300025981\|Ga0207640_10455050	Not Available	1056	Open in IMG/M
3300026023\|Ga0207677_10737988	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	877	Open in IMG/M
3300026023\|Ga0207677_12300545	Not Available	502	Open in IMG/M
3300026035\|Ga0207703_10633142	Not Available	1014	Open in IMG/M
3300026035\|Ga0207703_12054084	Not Available	548	Open in IMG/M
3300026078\|Ga0207702_10432822	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	1274	Open in IMG/M
3300026089\|Ga0207648_10284037	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	1480	Open in IMG/M
3300026089\|Ga0207648_10814570	All Organisms → cellular organisms → Bacteria → Acidobacteria	870	Open in IMG/M
3300027842\|Ga0209580_10221682	Not Available	939	Open in IMG/M
3300027842\|Ga0209580_10616320	All Organisms → cellular organisms → Bacteria → Acidobacteria	538	Open in IMG/M
3300031232\|Ga0302323_101674593	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	719	Open in IMG/M
3300031595\|Ga0265313_10001600	All Organisms → cellular organisms → Bacteria	21015	Open in IMG/M
3300031716\|Ga0310813_11336203	All Organisms → cellular organisms → Bacteria → Acidobacteria	663	Open in IMG/M
3300031938\|Ga0308175_101937475	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	660	Open in IMG/M
3300032160\|Ga0311301_11425073	All Organisms → cellular organisms → Bacteria → Acidobacteria	861	Open in IMG/M
3300033412\|Ga0310810_10276325	All Organisms → cellular organisms → Bacteria → Acidobacteria	1826	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	57.55%
Environmental	Environmental	42.45%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	57.55%
Terrestrial	Environmental → Terrestrial	38.68%
Aquatic	Environmental → Aquatic	3.77%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	36.79%
Rhizosphere	Host-Associated → Plants → Rhizosphere	30.19%
Rhizoplane	Host-Associated → Plants → Rhizoplane	22.64%
Roots	Host-Associated → Plants → Roots	4.72%
Marine	Environmental → Aquatic → Marine	1.89%
Thermal Springs	Environmental → Aquatic → Thermal Springs	0.94%
Sediment	Environmental → Aquatic → Sediment	0.94%
Peat	Environmental → Terrestrial → Peat	0.94%
Geologic	Environmental → Terrestrial → Geologic	0.94%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	25.47%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	24.53%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	22.64%
Loam	Environmental → Terrestrial → Soil → Loam	11.32%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	4.72%
Soil	Host-Associated → Plants → Rhizosphere → Soil	4.72%
Wetlands	Environmental → Aquatic → Marine → Wetlands	1.89%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	0.94%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.94%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.94%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.94%
Mine	Environmental → Terrestrial → Geologic → Mine	0.94%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	25.47%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	22.64%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	13.21%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	11.32%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	5.66%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	4.72%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	4.72%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	1.89%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	1.89%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	1.89%
Acidic	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic	0.94%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.94%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.94%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.94%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.94%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.94%
Unclassified	Environmental → Terrestrial → Geologic → Mine → Unclassified	0.94%

Habitat	Taxonomy	Distribution
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	11.32%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	11.32%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	6.60%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	5.66%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	5.66%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	5.66%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	4.72%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	3.77%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	3.77%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.83%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	2.83%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	2.83%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	2.83%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.83%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	1.89%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.89%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	1.89%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	1.89%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	1.89%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.89%
Iron-Sulfur Acid Spring	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring	0.94%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.94%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	0.94%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere	0.94%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.94%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	0.94%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil	0.94%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.94%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.94%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	0.94%
Weathered Mine Tailings	Environmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings	0.94%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.94%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	0.94%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.94%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	0.94%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.94%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.94%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2170459010	Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!)	Environmental	Open in IMG/M
3300000955	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300001356	Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007	Environmental	Open in IMG/M
3300004019	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2	Environmental	Open in IMG/M
3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3	Environmental	Open in IMG/M
3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Host-Associated	Open in IMG/M
3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Host-Associated	Open in IMG/M
3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Environmental	Open in IMG/M
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated	Open in IMG/M
3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Host-Associated	Open in IMG/M
3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Environmental	Open in IMG/M
3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Environmental	Open in IMG/M
3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Environmental	Open in IMG/M
3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Environmental	Open in IMG/M
3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Environmental	Open in IMG/M
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated	Open in IMG/M
3300005538	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1	Environmental	Open in IMG/M
3300005542	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1	Environmental	Open in IMG/M
3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Environmental	Open in IMG/M
3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Host-Associated	Open in IMG/M
3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Host-Associated	Open in IMG/M
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated	Open in IMG/M
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300006059	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012	Environmental	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated	Open in IMG/M
3300006638	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A	Environmental	Open in IMG/M
3300006804	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200	Environmental	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated	Open in IMG/M
3300006893	Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG	Environmental	Open in IMG/M
3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Host-Associated	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300010379	Sb_50d combined assembly	Environmental	Open in IMG/M
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300012982	Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DCWfield	Environmental	Open in IMG/M
3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Host-Associated	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated	Open in IMG/M
3300017973	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG	Environmental	Open in IMG/M
3300020580	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M	Environmental	Open in IMG/M
3300021168	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M	Environmental	Open in IMG/M
3300021170	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M	Environmental	Open in IMG/M
3300022724	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300025558	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 (SPAdes)	Environmental	Open in IMG/M
3300025862	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes)	Environmental	Open in IMG/M
3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300027842	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300031232	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3	Environmental	Open in IMG/M
3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Host-Associated	Open in IMG/M
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental	Open in IMG/M
3300031938	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1	Environmental	Open in IMG/M
3300032160	Sb_50d combined assembly (MetaSPAdes)	Environmental	Open in IMG/M
3300033412	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
F62_03496300	2170459010	Grass Soil	MRSPAPVVSGRWLVIVIAVVIVIAVAAGCIWMYRDYLIAPRQP
JGI1027J12803_1012330432	3300000955	Soil	MKTVSGRWVAIVIGVAIIIAVAAGCYWLYLDFQVAPRQP*
JGI12269J14319_103294331	3300001356	Peatlands Soil	MKTVPGKWLAIAIAVVIFVAVTAACIWMYRDYLAAPRQP*
Ga0055439_100223022	3300004019	Natural And Restored Wetlands	MKSVSGKRVAIVIAVVIFIAVAAACYWMYMDYLAAPRQP*
Ga0065707_107918382	3300005295	Switchgrass Rhizosphere	MKTVSGKWVAIVIAVVIVAAVAAGWYWMYINYVAAPRQP*
Ga0070658_106326602	3300005327	Corn Rhizosphere	MASTPTVSGRWVAIVIAVVIAISVAVACIWLYRDYLSAPRQP*
Ga0070676_102034633	3300005328	Miscanthus Rhizosphere	MKTVSGKWVAIVIGVAIIIAVAAGCYWLYLDFQSAPRQP*
Ga0070683_1000084263	3300005329	Corn Rhizosphere	MESPAPVVSGKWVAIVIAVVIAIAVAAGCIWLYRDFLIAPRQP*
Ga0070683_1001493443	3300005329	Corn Rhizosphere	MKTVSGKWVAIVIGVAIILAVAAGCYWLYLDFLSAPRQP*
Ga0070683_1011028722	3300005329	Corn Rhizosphere	MSSTAPVVSGKWLVIVIAVVIVIAVTAGCIWMYNDYLIAPRQP*
Ga0068869_1004488272	3300005334	Miscanthus Rhizosphere	MKTVSGKWVAIVIGVAIIIAVAAGCIWLYLDFQVAPRQP*
Ga0068869_1010347262	3300005334	Miscanthus Rhizosphere	MNTVSGKWVAIVIGVAIIIAVAAGCYWLYLDFQSAPRQP*
Ga0068868_1016019152	3300005338	Miscanthus Rhizosphere	MKTVSGKLVAIVIGVAIIIAVAAGCIWLYLDFQVAPRQP*
Ga0070689_1001939412	3300005340	Switchgrass Rhizosphere	MKTVSGKWVAILIAAVIVAAVAAGCYWMYINYLVAPRQP*
Ga0070688_1011263601	3300005365	Switchgrass Rhizosphere	LTVDIGSMKTVSGKWVAIVIGVAIIIAVAAGCYWLYLDFQSAPRQP*
Ga0070709_105051532	3300005434	Corn, Switchgrass And Miscanthus Rhizosphere	MKTVSGKWLAIAIAVVILIAVTAACIFMYRDYLAAPRQP*
Ga0070713_1008047041	3300005436	Corn, Switchgrass And Miscanthus Rhizosphere	MESSTPVVSGRWVAIVIAVVILIAVAAGCIWMYRDYLSAPRQP*
Ga0070711_1008685312	3300005439	Corn, Switchgrass And Miscanthus Rhizosphere	MQPSAPVVSGRWLAIVIAVVILVAVAAGCVWLYLDYLAAPRQP*
Ga0070711_1010853011	3300005439	Corn, Switchgrass And Miscanthus Rhizosphere	MPSTAPVVSGKWVAIVIAVVIAIAVAAACLWLYRDFLIAP
Ga0070711_1012237272	3300005439	Corn, Switchgrass And Miscanthus Rhizosphere	MKTVSGKWIAIVIMVTIIIAVAAACVWLYHDYLVAPRQP*
Ga0068867_1010312652	3300005459	Miscanthus Rhizosphere	MKTVPGKWIAILIMVVIFIAVAAACAWLYHDYVNAPRQP*
Ga0070731_103977822	3300005538	Surface Soil	MESPAPVVSGRWVAIVIAVVILIAVAAGCIWMYNDYLIAPRQP*
Ga0070732_102711342	3300005542	Surface Soil	MQPSGKTVSGRWIAITIAVVIFVAVVAACYWLYLDYLSAPRQP*
Ga0070695_1007846031	3300005545	Corn, Switchgrass And Miscanthus Rhizosphere	HNMKSVSGKRVAITIAVVIFIAVAAGCYWMYVNYLLAPRQP*
Ga0068855_1004612141	3300005563	Corn Rhizosphere	DMRSPAPIVSGRWLVIVIVVVIAIAVAAGCIWMYRDYLIAPRQP*
Ga0068854_1000737903	3300005578	Corn Rhizosphere	KTVSGKWVAIVIGVAIIIAVAAGCYWLYLDFQSAPRQP*
Ga0068856_1000748223	3300005614	Corn Rhizosphere	MPSTAPVVSGKWVAIVIAVVIAIAVAAACLWLYRDFLIAPRQP*
Ga0068856_1011042293	3300005614	Corn Rhizosphere	STPTVSGRWVAIVIAVVIAISVAVACIWLYRDYLSAPRQP*
Ga0068866_102397671	3300005718	Miscanthus Rhizosphere	MKTVSGKWVAIVIGVAIIIAVAAGCYWLYLDFQSAP
Ga0068866_104297341	3300005718	Miscanthus Rhizosphere	MKPVSGKWVAIVIGVAIIIAVAAGCYWLYLDFQSAPRQP*
Ga0068858_1007671822	3300005842	Switchgrass Rhizosphere	MASSVPVVSGKWVAIVIAVVILIGVAAGCIWMYRDYLSAPRQP*
Ga0068858_1008394032	3300005842	Switchgrass Rhizosphere	MRSPAPVVSGRWLVIVIAVVIVIAVAAGCIWMYRDYL
Ga0068858_1010764622	3300005842	Switchgrass Rhizosphere	MQSVSGKWVAIAIAAVIAVAVAAGCYWMYSNYLIAPRQP*
Ga0075017_1001544182	3300006059	Watersheds	MKSVSGKWVAIVIGVAIVIAVAAACTWLYFDYLAAPRQP*
Ga0097621_1007992683	3300006237	Miscanthus Rhizosphere	VVSGKWLVIVIAAVIVIAVTAGCIWMYRDYLVAPRQP*
Ga0097621_1024189292	3300006237	Miscanthus Rhizosphere	MSSTAPVVSGKWLVIVIAAVIVIAVTAGCIWMYND
Ga0068871_1001756552	3300006358	Miscanthus Rhizosphere	MSSTAPVVSGKWLVIVIAAVIVIAVTAGCIWMYRDYLVAPRQP*
Ga0075522_1000001423	3300006638	Arctic Peat Soil	MRSTTPVVSGKWVAIVITVAIVISVTVACVWLYRDYLSAPRLP*
Ga0079221_104746403	3300006804	Agricultural Soil	MQPDGKTVSGRWVAIVIAAVIVVAVVAGCVWLYLDYLSAPRQP*
Ga0075425_1018294672	3300006854	Populus Rhizosphere	TVSGRWVAIVIAVAILIAVAAGCYWLYLDYQAAPRQP*
Ga0068865_1000928612	3300006881	Miscanthus Rhizosphere	MKPVSGKWVAIVIGVAIIIAVAAGCYWLYLDFQSAPRQ
Ga0068865_1014928912	3300006881	Miscanthus Rhizosphere	MKSVSGKRVAITIAVVIFIAVAAGCYWMYVNYLLAPRQP*
Ga0073928_110308982	3300006893	Iron-Sulfur Acid Spring	MKAQKMHGRMIAIVIAIAILVAVAAGCYWLYLDYLSAPRQP*
Ga0105240_100691481	3300009093	Corn Rhizosphere	MRSPAPIVSGRWLVIVIVVVIAIAVAAGCIWMYRDYLIA
Ga0105240_117465391	3300009093	Corn Rhizosphere	MQPSEKTVSGRWVAIVIAVVIAVAVAAACIWMYRDYLAAPRQP*
Ga0105245_1000318910	3300009098	Miscanthus Rhizosphere	MNTVSGKWVAIVIGVAIIIAVAAGCCWLYLDFQSAPRQP*
Ga0105245_100957572	3300009098	Miscanthus Rhizosphere	MRSPAPVVSGRWLVIVIAVVIVIAVAAGCIWMYRDYLIAPRQP*
Ga0105245_108781351	3300009098	Miscanthus Rhizosphere	MKTVSGKWVAIVIAAVIVAAVAAGCYWMYINYLAAPRQP*
Ga0105243_124882831	3300009148	Miscanthus Rhizosphere	GKRVAITIAVVIFIAVAAGCYWMYVNYLLAPRQP*
Ga0105242_100162204	3300009176	Miscanthus Rhizosphere	MKPVSGKWVAIVIGVAIIIAVAAGCYWLYLDFRSAPRQP*
Ga0105242_115937883	3300009176	Miscanthus Rhizosphere	SGKWVAIVIGVAIIIAVAAGCYWLYLDFQSAPRQP*
Ga0105249_104598661	3300009553	Switchgrass Rhizosphere	GKWVAIVIGVAIIIAVAAGCYWLYLDFQSAPRQP*
Ga0105249_125660331	3300009553	Switchgrass Rhizosphere	IDIGSMKPVSGKWVAIVIGVAIIIAVAAGCYWLYLDFQSAPRQP*
Ga0126376_119466612	3300010359	Tropical Forest Soil	MTPRGPSVSGRWLAIVIAVVIVVAVAAGCYWLYLDYLSAPRQP*
Ga0134128_111463582	3300010373	Terrestrial Soil	MKTVSGKWLAIAIAVVILIAVTAACIFMYRDYLAAPRKP*
Ga0136449_1001361263	3300010379	Peatlands Soil	MESHAPVVSGKWVAIVIAVVILIAVAAGCIWMYRDYLSAPRQP*
Ga0134126_119008151	3300010396	Terrestrial Soil	EEDMESSTPVVSGKWVAIVIAVVILIAVAAGCIWMYRDYLVAPRQP*
Ga0134122_133681472	3300010400	Terrestrial Soil	MKTVSGKWVAIVIGIAIVIAVAAGCYWLYLDFQSAPRQP*
Ga0105246_102021822	3300011119	Miscanthus Rhizosphere	MKTVSGKWVAIVIAAVIVAAVAAGCYWMYINYLVAPRQP*
Ga0168317_10014345	3300012982	Weathered Mine Tailings	MPSTTPVVSGKWVAIVIAVVIAIAVAAACLWLYRDFLIAPRQP*
Ga0157369_100190657	3300013105	Corn Rhizosphere	SPAPIVSGRWLVIVIVVVIAIAVAAGCIWMYRDYLIAPRQP*
Ga0163162_133663061	3300013306	Switchgrass Rhizosphere	GKLALNMQTVSGKWVAIVIGVAIIIAVAAGCIWLYLDFQVAPRRP*
Ga0157375_127670752	3300013308	Miscanthus Rhizosphere	MKPVSGKWVAIAIGVAIIIAVAAGCYWLYLDFQSAPRHP*
Ga0163163_100619963	3300014325	Switchgrass Rhizosphere	MKTVSGKWVAIVIGVAIIIAVAAGCVWLFLDFQAAPRQP*
Ga0163163_109716562	3300014325	Switchgrass Rhizosphere	MKTVSGKWVAIVIGVAIILAVAAGCYWLYLDFQSAPRQP*
Ga0157376_103222692	3300014969	Miscanthus Rhizosphere	MKSVSGKRVAIAIAAVIFIAVAAGCYWMYMNYLAAPRQP*
Ga0157376_106508483	3300014969	Miscanthus Rhizosphere	PVVSGRWLAIVIAVVILVAVAAGCVWLYLDYLAAPRQP*
Ga0187780_112760022	3300017973	Tropical Peatland	MASPAPVVSGKWVAIVIAVVIVIAVAAGCIWLYHDFLIAPRQP
Ga0210403_106798042	3300020580	Soil	MEASEKTVSGRWVAIVIAIAILLAVAAGCYWLYLDYLSAPRQP
Ga0210403_110662362	3300020580	Soil	MEASEKTVSGRWVAIVIAVVIFVAVTAACIWMYRDYLAAPRQR
Ga0210406_109064742	3300021168	Soil	MPAIGNNVSGRWVAIVVAVAILIAVAVACIWLFRDYQSAPRLP
Ga0210400_111050182	3300021170	Soil	MEQSGKTVPGRWIAIVIAVVILISVAAACIWLYRDYLAAPRQP
Ga0210400_112215161	3300021170	Soil	RVGSRQFAIDMSSPAPVVSGRWLVIVIAVVIVIAVAAGCIWMYRDYLIAPRQP
Ga0242665_103691821	3300022724	Soil	MQASGKTVSGRWVAIVIAVAIVVAVAVGCYWLYLDYVSAPR
Ga0210139_10614982	3300025558	Natural And Restored Wetlands	MKSVSGKRVAIVIAVVIFIAVAAACYWMYMDYLAAPRQP
Ga0209483_100001383	3300025862	Arctic Peat Soil	MRSTTPVVSGKWVAIVITVAIVISVTVACVWLYRDYLSAPRLP
Ga0207654_102874303	3300025911	Corn Rhizosphere	SMKTVSGKWVAIVIGVAIIIAVAAGCYWLYLDFQSAPRQP
Ga0207654_104838352	3300025911	Corn Rhizosphere	MNTVSGKWVAIVIGVAIIIAVAAGCYWLYLDFQSAPRQP
Ga0207654_105605912	3300025911	Corn Rhizosphere	MKTVSGKWVAIVIGVAIILAVAAGCYWLYLDFLSAPRQP
Ga0207707_100167643	3300025912	Corn Rhizosphere	MASTPTVSGRWVAIVIAVVIAISVAVACIWLYRDYLSAPRQP
Ga0207695_110087232	3300025913	Corn Rhizosphere	MESSTPVVSGRWVAIVIAVVILIAVAAGCIWMYRDYLSAPRQP
Ga0207695_110406862	3300025913	Corn Rhizosphere	MQPSEKTVSGRWVAIVIAVVIAVAVAAACIWMYRDYLAAPRQP
Ga0207681_108801162	3300025923	Switchgrass Rhizosphere	MKTVSGKWVAILIAAVIVAAVAAGCYWMYINYLVAPRQP
Ga0207687_101766733	3300025927	Miscanthus Rhizosphere	MKTVSGKWVAIVSGVAIIIAVAAGCYWLYLDFQSAPRQP
Ga0207687_106117202	3300025927	Miscanthus Rhizosphere	MKTVSGKWVAIVIAAVIVAAVAAGCYWMYINYLAAPRQP
Ga0207687_111144341	3300025927	Miscanthus Rhizosphere	MKTVSGKLVAIVIGVAIIIAVAAGCIWLYLDFQVAPRQP
Ga0207686_101087462	3300025934	Miscanthus Rhizosphere	MKPVSGKWVAIVIGVAIIIAVAAGCYWLYLDFRSAPRQP
Ga0207686_113986762	3300025934	Miscanthus Rhizosphere	PVSGKWVAIVIGVAIIIAVAAGCYWLYLDFQSAPRQP
Ga0207651_116142893	3300025960	Switchgrass Rhizosphere	MKTVPGKWIAILIMVVIFIAVAAACAWLYHDYVNAPR
Ga0207712_101312271	3300025961	Switchgrass Rhizosphere	VSGRWLVIVIAVVIVIAVAAGCIWMYRDYLIAPRQP
Ga0207640_104550502	3300025981	Corn Rhizosphere	MASTPTVSGRWVAIVIAVVIAISVAVACIWLYRDYLS
Ga0207677_107379882	3300026023	Miscanthus Rhizosphere	MKTVSGKWVAIVIGVAIIIAVAAGCIWLYLDFQVAPRQP
Ga0207677_123005452	3300026023	Miscanthus Rhizosphere	MESPAPVVSGKWVAIVIAVVIAIAVAAGCIWLYRDFLIAPRQP
Ga0207703_106331422	3300026035	Switchgrass Rhizosphere	MASSVPVVSGKWVAIVIAVVILIGVAAGCIWMYRDYLSAPRQP
Ga0207703_120540842	3300026035	Switchgrass Rhizosphere	MQSVSGKWVAIAIAAVIAVAVAAGCYWMYSNYLIAPRQP
Ga0207702_104328221	3300026078	Corn Rhizosphere	GSMKTVSGKWVAIVIGVAIIIAVAAGCYWLYLDFQSAPRQP
Ga0207648_102840373	3300026089	Miscanthus Rhizosphere	MKPVSGKWIAIVIGVAIIIAVAAGCYWLYLDFQSAPRQP
Ga0207648_108145702	3300026089	Miscanthus Rhizosphere	MKTVPGKWIAILIMVVIFIAVAAACAWLYHDYVNAPRQP
Ga0209580_102216822	3300027842	Surface Soil	MQPSGKTVSGRWIAITIAVVIFVAVVAACYWLYLDYLSAPRQ
Ga0209580_106163201	3300027842	Surface Soil	TVSGRWVAIVIAIVIFVAVTAACIWMYRDYLAAPRQP
Ga0302323_1016745932	3300031232	Fen	MESPAPVVSGKWITIVIAIVILIAVTAACVWMYRDYLSAPRQP
Ga0265313_1000160012	3300031595	Rhizosphere	MESRTPVVSGRWIAIVIAVVILIGVAAGCIWMYNDYLIAPRQP
Ga0310813_113362031	3300031716	Soil	KTVSGKWVAIVIGVAIIIAVAAGCYWLYLDFQSAPRQP
Ga0308175_1019374752	3300031938	Soil	MPSSAPVVSGKWLTIVIAVVIVIAVAAACIWLYRDFLIAPRQP
Ga0311301_114250732	3300032160	Peatlands Soil	MESHAPVVSGKWVAIVIAVVILIAVAAGCIWMYRDYLSAPRQP
Ga0310810_102763253	3300033412	Soil	GKTVSGRWVAIVIAIVIFVAVTAACIWMYRDYLAAPRQP

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F094027

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences