NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F094035

Metagenome Family F094035

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F094035
Family Type Metagenome
Number of Sequences 106
Average Sequence Length 42 residues
Representative Sequence RIGDLRSHMDSRFDDMRATWHSELRRVEEVLDARLKHLEER
Number of Associated Samples 88
Number of Associated Scaffolds 105

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 3.81 %
% of genes near scaffold ends (potentially truncated) 83.02 %
% of genes from short scaffolds (< 2000 bps) 84.91 %
Associated GOLD sequencing projects 79
AlphaFold2 3D model prediction Yes
3D model pTM-score0.60

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (85.849 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(9.434 % of family members)
Environment Ontology (ENVO) Unclassified
(50.943 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(55.660 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 56.52%    β-sheet: 0.00%    Coil/Unstructured: 43.48%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.60
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 105 Family Scaffolds
PF01715IPPT 5.71
PF12706Lactamase_B_2 4.76
PF00312Ribosomal_S15 4.76
PF01266DAO 3.81
PF13483Lactamase_B_3 2.86
PF00578AhpC-TSA 2.86
PF01138RNase_PH 2.86
PF01040UbiA 1.90
PF14559TPR_19 1.90
PF00436SSB 1.90
PF01381HTH_3 1.90
PF14534DUF4440 1.90
PF00069Pkinase 1.90
PF08241Methyltransf_11 1.90
PF13544Obsolete Pfam Family 1.90
PF00300His_Phos_1 1.90
PF12847Methyltransf_18 0.95
PF00106adh_short 0.95
PF01804Penicil_amidase 0.95
PF01144CoA_trans 0.95
PF00579tRNA-synt_1b 0.95
PF13432TPR_16 0.95
PF03726PNPase 0.95
PF07811TadE 0.95
PF08003Methyltransf_9 0.95
PF03481Sua5_C 0.95
PF07075DUF1343 0.95
PF00266Aminotran_5 0.95
PF08668HDOD 0.95
PF11799IMS_C 0.95
PF07929PRiA4_ORF3 0.95
PF01169UPF0016 0.95
PF00109ketoacyl-synt 0.95
PF03989DNA_gyraseA_C 0.95
PF03571Peptidase_M49 0.95
PF02321OEP 0.95
PF02687FtsX 0.95
PF07690MFS_1 0.95
PF04366Ysc84 0.95
PF13231PMT_2 0.95
PF01663Phosphodiest 0.95
PF00083Sugar_tr 0.95
PF01425Amidase 0.95
PF01906YbjQ_1 0.95
PF064393keto-disac_hyd 0.95
PF00717Peptidase_S24 0.95

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 105 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 7.62
COG0324tRNA A37 N6-isopentenylltransferase MiaATranslation, ribosomal structure and biogenesis [J] 5.71
COG0184Ribosomal protein S15P/S13ETranslation, ribosomal structure and biogenesis [J] 4.76
COG1185Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase)Translation, ribosomal structure and biogenesis [J] 3.81
COG0689Ribonuclease PHTranslation, ribosomal structure and biogenesis [J] 2.86
COG2123Exosome complex RNA-binding protein Rrp42, RNase PH superfamilyIntracellular trafficking, secretion, and vesicular transport [U] 2.86
COG0629Single-stranded DNA-binding proteinReplication, recombination and repair [L] 1.90
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 1.90
COG2965Primosomal replication protein NReplication, recombination and repair [L] 1.90
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 0.95
COG0162Tyrosyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.95
COG0180Tryptophanyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.95
COG0188DNA gyrase/topoisomerase IV, subunit AReplication, recombination and repair [L] 0.95
COG0393Uncharacterized pentameric protein YbjQ, UPF0145 familyFunction unknown [S] 0.95
COG1788Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunitLipid transport and metabolism [I] 0.95
COG2057Acyl-CoA:acetate/3-ketoacid CoA transferase, beta subunitLipid transport and metabolism [I] 0.95
COG2119Putative Ca2+/H+ antiporter, TMEM165/GDT1 familyGeneral function prediction only [R] 0.95
COG2366Acyl-homoserine lactone (AHL) acylase PvdQSecondary metabolites biosynthesis, transport and catabolism [Q] 0.95
COG2930Lipid-binding SYLF domain, Ysc84/FYVE familyLipid transport and metabolism [I] 0.95
COG3876Exo-beta-N-acetylmuramidase YbbC/NamZ, DUF1343 familyCell wall/membrane/envelope biogenesis [M] 0.95
COG4670Acyl CoA:acetate/3-ketoacid CoA transferaseLipid transport and metabolism [I] 0.95


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms85.85 %
UnclassifiedrootN/A14.15 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005330|Ga0070690_100712604All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium771Open in IMG/M
3300005334|Ga0068869_100295085All Organisms → cellular organisms → Bacteria1307Open in IMG/M
3300005334|Ga0068869_101191563All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae669Open in IMG/M
3300005336|Ga0070680_100521718All Organisms → cellular organisms → Bacteria → Acidobacteria1017Open in IMG/M
3300005354|Ga0070675_101672837All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium587Open in IMG/M
3300005355|Ga0070671_101653435All Organisms → cellular organisms → Bacteria → Acidobacteria568Open in IMG/M
3300005434|Ga0070709_11670057All Organisms → cellular organisms → Bacteria → Acidobacteria520Open in IMG/M
3300005458|Ga0070681_11740306All Organisms → cellular organisms → Bacteria → Acidobacteria550Open in IMG/M
3300005458|Ga0070681_11740306All Organisms → cellular organisms → Bacteria → Acidobacteria550Open in IMG/M
3300005542|Ga0070732_10645965Not Available643Open in IMG/M
3300005544|Ga0070686_100848612All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium739Open in IMG/M
3300005564|Ga0070664_100126430All Organisms → cellular organisms → Bacteria2243Open in IMG/M
3300005564|Ga0070664_102002255All Organisms → cellular organisms → Bacteria → Acidobacteria550Open in IMG/M
3300005614|Ga0068856_100051851All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia4045Open in IMG/M
3300005618|Ga0068864_100011438All Organisms → cellular organisms → Bacteria7331Open in IMG/M
3300005836|Ga0074470_11457115All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300005843|Ga0068860_101601218All Organisms → cellular organisms → Bacteria → Acidobacteria673Open in IMG/M
3300006050|Ga0075028_100373543All Organisms → cellular organisms → Bacteria → Acidobacteria810Open in IMG/M
3300006102|Ga0075015_100047451All Organisms → cellular organisms → Bacteria2020Open in IMG/M
3300006237|Ga0097621_100412864All Organisms → cellular organisms → Bacteria1210Open in IMG/M
3300006354|Ga0075021_10060109All Organisms → cellular organisms → Bacteria2211Open in IMG/M
3300006881|Ga0068865_101011469All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium728Open in IMG/M
3300007265|Ga0099794_10791614All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii507Open in IMG/M
3300009038|Ga0099829_11695254All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4520Open in IMG/M
3300009174|Ga0105241_12221388All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300009176|Ga0105242_10356212All Organisms → cellular organisms → Bacteria → Acidobacteria1353Open in IMG/M
3300009176|Ga0105242_11082759Not Available814Open in IMG/M
3300009176|Ga0105242_11957406All Organisms → cellular organisms → Bacteria → Acidobacteria628Open in IMG/M
3300009176|Ga0105242_12101895Not Available608Open in IMG/M
3300009177|Ga0105248_10040582All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia5217Open in IMG/M
3300009177|Ga0105248_10543081All Organisms → cellular organisms → Bacteria → Acidobacteria1311Open in IMG/M
3300009524|Ga0116225_1064120All Organisms → cellular organisms → Bacteria → Acidobacteria1742Open in IMG/M
3300009545|Ga0105237_11529417All Organisms → cellular organisms → Bacteria → Acidobacteria674Open in IMG/M
3300009545|Ga0105237_11684449All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii641Open in IMG/M
3300009551|Ga0105238_10042569All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4598Open in IMG/M
3300010371|Ga0134125_11485551Not Available738Open in IMG/M
3300010373|Ga0134128_10079423All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus3747Open in IMG/M
3300010397|Ga0134124_12852946All Organisms → cellular organisms → Bacteria → Acidobacteria527Open in IMG/M
3300010401|Ga0134121_11664571All Organisms → cellular organisms → Bacteria → Acidobacteria660Open in IMG/M
3300011270|Ga0137391_10620878Not Available904Open in IMG/M
3300011271|Ga0137393_10802345All Organisms → cellular organisms → Bacteria → Acidobacteria804Open in IMG/M
3300011271|Ga0137393_11193485All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii646Open in IMG/M
3300012210|Ga0137378_10913518All Organisms → cellular organisms → Bacteria791Open in IMG/M
3300012917|Ga0137395_10940757Not Available623Open in IMG/M
3300012971|Ga0126369_12267595All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300013296|Ga0157374_12250967Not Available572Open in IMG/M
3300014325|Ga0163163_10402315All Organisms → cellular organisms → Bacteria → Acidobacteria1427Open in IMG/M
3300014501|Ga0182024_10543983All Organisms → cellular organisms → Bacteria → Acidobacteria1467Open in IMG/M
3300014501|Ga0182024_12727098Not Available528Open in IMG/M
3300014968|Ga0157379_10264871All Organisms → cellular organisms → Bacteria → Acidobacteria1562Open in IMG/M
3300017972|Ga0187781_10304354All Organisms → cellular organisms → Bacteria1131Open in IMG/M
3300018047|Ga0187859_10429006All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae728Open in IMG/M
3300018062|Ga0187784_10219004All Organisms → cellular organisms → Bacteria1552Open in IMG/M
3300021168|Ga0210406_10534557All Organisms → cellular organisms → Bacteria → Acidobacteria923Open in IMG/M
3300021170|Ga0210400_10002568All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales16682Open in IMG/M
3300021181|Ga0210388_10239624All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1591Open in IMG/M
3300021405|Ga0210387_10657159All Organisms → cellular organisms → Bacteria → Acidobacteria930Open in IMG/M
3300021432|Ga0210384_10019085All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria6653Open in IMG/M
3300021432|Ga0210384_11141595Not Available683Open in IMG/M
3300021477|Ga0210398_10456592All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1041Open in IMG/M
3300021559|Ga0210409_10614758All Organisms → cellular organisms → Bacteria956Open in IMG/M
3300021559|Ga0210409_10620464All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium950Open in IMG/M
3300021559|Ga0210409_11719593All Organisms → cellular organisms → Bacteria → Acidobacteria504Open in IMG/M
3300025506|Ga0208937_1145325All Organisms → cellular organisms → Bacteria → Acidobacteria502Open in IMG/M
3300025899|Ga0207642_10742582All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300025913|Ga0207695_10871623All Organisms → cellular organisms → Bacteria780Open in IMG/M
3300025914|Ga0207671_10346298All Organisms → cellular organisms → Bacteria → Acidobacteria1178Open in IMG/M
3300025916|Ga0207663_11727010All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia503Open in IMG/M
3300025924|Ga0207694_10052757Not Available3152Open in IMG/M
3300025934|Ga0207686_10244522All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1307Open in IMG/M
3300025934|Ga0207686_10518573All Organisms → cellular organisms → Bacteria → Acidobacteria927Open in IMG/M
3300025934|Ga0207686_10666616Not Available824Open in IMG/M
3300025937|Ga0207669_10918876All Organisms → cellular organisms → Bacteria → Acidobacteria732Open in IMG/M
3300025938|Ga0207704_10927600All Organisms → cellular organisms → Bacteria733Open in IMG/M
3300025942|Ga0207689_11535895All Organisms → cellular organisms → Bacteria → Acidobacteria555Open in IMG/M
3300025944|Ga0207661_11368172All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300025945|Ga0207679_10106034All Organisms → cellular organisms → Bacteria → Acidobacteria2208Open in IMG/M
3300025949|Ga0207667_10635797All Organisms → cellular organisms → Bacteria1074Open in IMG/M
3300026035|Ga0207703_10957501All Organisms → cellular organisms → Bacteria821Open in IMG/M
3300026088|Ga0207641_11204747All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium757Open in IMG/M
3300026088|Ga0207641_12244932All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales546Open in IMG/M
3300026089|Ga0207648_10647748All Organisms → cellular organisms → Bacteria → Proteobacteria976Open in IMG/M
3300026095|Ga0207676_10027250All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales4255Open in IMG/M
3300026095|Ga0207676_11733408All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales623Open in IMG/M
3300027641|Ga0208827_1040799All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1602Open in IMG/M
3300027754|Ga0209596_1156736All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1008Open in IMG/M
3300027765|Ga0209073_10089730All Organisms → cellular organisms → Bacteria → Acidobacteria1071Open in IMG/M
3300027826|Ga0209060_10010975All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5343Open in IMG/M
3300028381|Ga0268264_11671256All Organisms → cellular organisms → Bacteria → Acidobacteria647Open in IMG/M
3300029908|Ga0311341_10845983Not Available504Open in IMG/M
3300030045|Ga0302282_1337526All Organisms → cellular organisms → Bacteria → Acidobacteria539Open in IMG/M
3300030520|Ga0311372_12762382All Organisms → cellular organisms → Bacteria → Acidobacteria541Open in IMG/M
3300031057|Ga0170834_109872709All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300031057|Ga0170834_112455542Not Available1125Open in IMG/M
3300031234|Ga0302325_11149332All Organisms → cellular organisms → Bacteria1040Open in IMG/M
3300031236|Ga0302324_101365986All Organisms → cellular organisms → Bacteria → Acidobacteria930Open in IMG/M
3300031525|Ga0302326_11145001All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium1076Open in IMG/M
3300031715|Ga0307476_11109260All Organisms → cellular organisms → Bacteria → Acidobacteria581Open in IMG/M
3300031754|Ga0307475_11287180All Organisms → cellular organisms → Bacteria → Acidobacteria567Open in IMG/M
3300032180|Ga0307471_101931124All Organisms → cellular organisms → Bacteria → Acidobacteria739Open in IMG/M
3300032421|Ga0310812_10200173All Organisms → cellular organisms → Bacteria → Acidobacteria866Open in IMG/M
3300032805|Ga0335078_10540366Not Available1486Open in IMG/M
3300032954|Ga0335083_10258935All Organisms → cellular organisms → Bacteria → Acidobacteria1551Open in IMG/M
3300033412|Ga0310810_10095418All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia3553Open in IMG/M
3300033475|Ga0310811_10360561All Organisms → cellular organisms → Bacteria1622Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil9.43%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere7.55%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.60%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere6.60%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere6.60%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere6.60%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere4.72%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.77%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa3.77%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.83%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.83%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.89%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.89%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.89%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.89%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.89%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost1.89%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.89%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.89%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.89%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.94%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.94%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.94%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.94%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.94%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.94%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.94%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.94%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.94%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.94%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300025506Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027641Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027754Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027826Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300029908II_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300030045Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_3EnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032421Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0070690_10071260413300005330Switchgrass RhizosphereNARLSDLRAHMDSRFDDMKDMWRGELRRVEEVLDARLKHLEERTS*
Ga0068869_10029508533300005334Miscanthus RhizosphereLVNNARLSDLRSHLDVRFEEMKDLWRSELHRVEEVLDARLKHLEER*
Ga0068869_10119156313300005334Miscanthus RhizosphereLIGILINNARLSDLRAHMDSRFDDMKDMWRGELRRVEEVLDARLKHLEERTS*
Ga0070680_10052171823300005336Corn RhizosphereMNSRINDLRSHMDSRFEEMRATWHSELRRVEEVLDARLKHLEER*
Ga0070675_10167283723300005354Miscanthus RhizosphereGDNNTRIAELRTHMDNRFDDMKDMWRSELHRVEEVLDARLRHLEER*
Ga0070671_10165343513300005355Switchgrass RhizosphereNTRIGETNIRIGELRSHMDVRFEEMKDLWRSELHRVEEVIDARLKHIER*
Ga0070709_1167005713300005434Corn, Switchgrass And Miscanthus RhizosphereETNSRIGELRSHMDARFEEMKDLWRSELHRVEEVIDARLRHIEGR*
Ga0070681_1174030623300005458Corn RhizosphereMNSRINDLRSHMDSCFDEMRATWHSELRRVEEVLDARLKHLEER*
Ga0070681_1174030633300005458Corn RhizosphereNNSRLSDLRSHMDSRFDDMRATWHSELRRVEEVLDARLKHLEER*
Ga0070732_1064596513300005542Surface SoilSRMADIRVHFDQRIDEVKETWRSELRRVEEVLDARLNHLEERLR*
Ga0070686_10084861213300005544Switchgrass RhizosphereLSDLRAHMDSRFDDMKDMWRGELRRVEEVLDARLKHLEERTS*
Ga0070664_10012643033300005564Corn RhizosphereSRIGDLRSHIDSRFDEMRSTWQSELRRVEEVLDARLKHLEER*
Ga0070664_10200225513300005564Corn RhizosphereRLGDLRSHMDSRFDDMRTHWQSELRRVEEVLDARLRHLEEH*
Ga0068856_10005185113300005614Corn RhizosphereGDLRSHIDSRFDEMRSTWQSELRRVEEVLDARLKHLEER*
Ga0068864_10001143863300005618Switchgrass RhizosphereLAKQTGRIGNNDAKIGELRSHMDVRFEEMKDLWRSELHRVEEVIDARLKHIER*
Ga0074470_1145711513300005836Sediment (Intertidal)THMDARFDEMRDTWRAELRRIEETIDARLKRLEQS*
Ga0068860_10160121813300005843Switchgrass RhizosphereHMDSRFDDIRATWHSELRRVEGVLDARLKHLEER*
Ga0075028_10037354313300006050WatershedsLRSHMDVPFEEMKDPWRSELHRVREVIVARLKHIKGR*
Ga0075015_10004745113300006102WatershedsMHMNARFDAVNQRLNDLRDLWSTELHRVEEVLDARLKHLEER*
Ga0097621_10041286413300006237Miscanthus RhizosphereRIDDLRSNVDTRIDDLRSHMDSRFDEMRSTWTSELRRVKEVLDARLKHLEER*
Ga0075021_1006010913300006354WatershedsLMHMNARFDAVNQRLNDLRDLWSTELHRVEEVLDARLKHLEER*
Ga0068865_10101146933300006881Miscanthus RhizosphereAHMDSRFDDMKDMWRGELRRVEEVLDARLKHLEERTS*
Ga0099794_1079161433300007265Vadose Zone SoilRLAEIDRGLNARIDDLRSHMDARFDDMRTTWQSELRRVEEVLDAA*
Ga0099829_1169525423300009038Vadose Zone SoilMDSRFEDIKDTWRAELRRVEEVIDARLKHLEERG*
Ga0105241_1222138813300009174Corn RhizosphereRLSDLKSHVDSRFDDMKDMSRSELHRVEEVLDARLKHLEERT*
Ga0105242_1035621243300009176Miscanthus RhizosphereGDVNSRIDDLRGHMDSRFDEMRATWHSELRRVEEVLDARLKHLEER*
Ga0105242_1108275923300009176Miscanthus RhizosphereGDLNARVGETNARIAELRSHMDSRFEEMKDLWRSELHRVEEVIDARLRHIEGR*
Ga0105242_1195740623300009176Miscanthus RhizosphereADGAHMDSRFDDMRATWHSELRRVEEVLDARLKHLEER*
Ga0105242_1210189513300009176Miscanthus RhizosphereELRSHMDGRFDEMRATWQAELHRVEEVLDARLKHLEER*
Ga0105248_1004058283300009177Switchgrass RhizosphereTRIGETNTRIGELRSHMDVRFEEMKDLWRSELHRVEEVIDARLKHIER*
Ga0105248_1054308143300009177Switchgrass RhizosphereGDLRSHMDSRFDDMRTHWQSELRRVEEVLDARLRHLEEH*
Ga0116225_106412013300009524Peatlands SoilIDDFRLHVDSRFSATDALFTERLRRVEEVMDARLKHLEES*
Ga0105237_1152941713300009545Corn RhizosphereRIGDLRSHMDSRFDDMRATWHSELRRVEEVLDARLKHLEER*
Ga0105237_1168444913300009545Corn RhizosphereNSRLSDLKSHVDSRFDDMKDMWRSELHRVEEVLDARLKHMEERR*
Ga0105238_1004256913300009551Corn RhizosphereMNSRINDLRSHMDSRFDEMRATWHSELRRVEEVLDARLKHLEER*
Ga0134125_1148555113300010371Terrestrial SoilMDRKMDHRFDDMKDMWRSELHRVEEVLDARLKHLEERA*
Ga0134128_1007942323300010373Terrestrial SoilVAETNTRIGELRSHMDVRFEEMKDLWRSELHRVEEVIDARLKHIEER*
Ga0134124_1285294623300010397Terrestrial SoilACGPMDSRFDDMRATWHSELRRVEEVLDARLKHLEER*
Ga0134121_1166457113300010401Terrestrial SoilTNTRIGETNIRIGELRSHMDVRFEEMKGLWRSELHRVEEVIDARLKHIER*
Ga0137391_1062087813300011270Vadose Zone SoilNSRLTHLRIHVDRRFDELRDLWRAELRRVGGVIDARLKHLQDRV*
Ga0137393_1080234513300011271Vadose Zone SoilIGELRSHMDARFDDMRETWRSELHRVEEVIDARLKHLEER*
Ga0137393_1119348543300011271Vadose Zone SoilRSHMDVRFDDMRTTWQSELQRVEEVLDARLKHLEAR*
Ga0137378_1091351813300012210Vadose Zone SoilRFSRIDQQFADSREMWRSELRRVEEVLDARLKHLEER*
Ga0137395_1094075723300012917Vadose Zone SoilDHRFDDMRDMWRSELHRVEEVLDARLKHLEEGFR*
Ga0126369_1226759513300012971Tropical Forest SoilINNARLSDLRSHIDHRFDDMKDLWRSELHRVEEVLDARLKHLEER*
Ga0157374_1225096713300013296Miscanthus RhizosphereNDRGSHMDSRFDEMRAAWHSELRRVEEVLDARLKHLEER*
Ga0163163_1040231513300014325Switchgrass RhizosphereDVNSRIDDLRGHMDSRFDEMRATWHSELRRVEEVLDARLKHLEER*
Ga0182024_1054398313300014501PermafrostDSRINDLRSHMDSRFDEMRSTWTSELRRVGEILDARLKHLEER*
Ga0182024_1272709833300014501PermafrostHMDNRFDDMKETWRAELQRVEGVLDARLKHFEDS*
Ga0157379_1026487113300014968Switchgrass RhizosphereDDLRSHMDSRFDEMRSAWTSELRRVKEVLDARLKHLEER*
Ga0187781_1030435413300017972Tropical PeatlandARFADLSSHIDARFDDMRSTWKSELHRVEEVLDARLKHLEER
Ga0187859_1042900623300018047PeatlandLVGILVNNSRLNDLRGHMDARFADMRETWRSDLRRVEEVLDARLKHLEAR
Ga0187784_1021900443300018062Tropical PeatlandSHIDARFDDMRSTWKSELHRVEEVLDARLKHLEER
Ga0210406_1053455713300021168SoilMDKKMDQRFIDAKDMWRSELHRVEEVLDARLKHLEER
Ga0210400_10002568103300021170SoilMNGRLGDVNARLGDLRHHIDSQFDEVGRRFDDMKDVWRSELHRVEEMLDAKLKHLEERA
Ga0210388_1023962433300021181SoilMNSRLDDLRSHMDARFDGLKDMWRSELHRVEEVLDARLRHLEER
Ga0210387_1065715933300021405SoilLTRLSDLGSHMDIRFNEMRDLWRSELYRVEQVIDARLKHLE
Ga0210384_1001908533300021432SoilLINNSRLTGLRVHVDGRFDEMRDLWRAELRRVEEVIDARLKHLEERG
Ga0210384_1114159523300021432SoilGELRSDMNARFAEMRDASRADLRRVEEVIDARLKHLEER
Ga0210398_1045659213300021477SoilLSERMEPDDMRDLWRAELRRVEEVLDARLKHLEERG
Ga0210409_1061475833300021559SoilAHMDTRFDDMRDTWRSELHRVEEVLDARLRHLAERG
Ga0210409_1062046413300021559SoilTELRSHMDARFDDMRVTWQAALRRVEEVLDARLKHLEER
Ga0210409_1171959313300021559SoilRFNAMDVRFEEVKDLWRSELHRVEEVLDARLKHLEER
Ga0208937_114532523300025506PeatlandARIAELRGHMDIRFDEMRDLWRSELYRVEQAIDARLKHLEERG
Ga0207642_1074258213300025899Miscanthus RhizosphereRNHVDSRFDDMKDMWRSELHRVEEVLDARLKHLEERI
Ga0207707_1057612133300025912Corn RhizosphereRIGELRSHMDVRFEEMKDLWRSELHRVEEVIDARLKHIER
Ga0207695_1087162313300025913Corn RhizosphereIGDLRSHIDSRFDEIRSTWQSELRRVEEVLDARLKHLEER
Ga0207671_1034629813300025914Corn RhizosphereIGELRSHMDVRFEEMKDLWRSELHRVEEVIDARLKHIEH
Ga0207663_1172701023300025916Corn, Switchgrass And Miscanthus RhizosphereDLRSHMDSRFDEMRSTWTSELRRVEEVLDARLKHLEER
Ga0207694_1005275713300025924Corn RhizosphereSHVDSRFDDMKDMSRSELHRVEEVLDARLKHLEERT
Ga0207686_1024452233300025934Miscanthus RhizosphereGETNARIGELRSHMDSRFEEMKDLWRSELHRVEEVIDARLRHIEGR
Ga0207686_1051857323300025934Miscanthus RhizosphereLRSHLDVRFEEMKDLWRSELHRVGEVLDARLKHLEER
Ga0207686_1066661613300025934Miscanthus RhizosphereINNSRLSDLRSHMDVRLDELKEMWRSELHRVEEVLDARLKHLEER
Ga0207669_1091887623300025937Miscanthus RhizosphereISELRTHMDVRFEEMKDLWRSELHRVEEVIDARLKHIER
Ga0207704_1092760033300025938Miscanthus RhizosphereLRAHMDSRFDDMKDMWRGELRRVEEVLDARLKHLEERTS
Ga0207689_1153589523300025942Miscanthus RhizosphereILVNNARLSDLRSHLDVRFEEMKDLWRSELHRVEEVLDARLKHLEER
Ga0207661_1136817213300025944Corn RhizosphereDSRIGDLRSHMDFRFDEMRTTWKSELRRVEEVLDARLKHLEER
Ga0207679_1010603433300025945Corn RhizosphereSRIGDLRSHIDSRFDEMRSTWQSELRRVEEVLDARLKHLEER
Ga0207667_1063579713300025949Corn RhizosphereMNSRINDLRSHMDSRFEEMRATWHSELRRVEEVLD
Ga0207703_1095750113300026035Switchgrass RhizosphereINNARLSDLRAHMDSRFDDMKDMWRGELRRVEEVLDARLKHLEERTS
Ga0207641_1120474723300026088Switchgrass RhizosphereNGRIGELRSHFDHRFDDLKETWRSELRRVEEVLDARLSHLEERLR
Ga0207641_1224493213300026088Switchgrass RhizosphereMNSRINDLRSHMDSCFDEMRATWHSELRRVEEVLDARLKHL
Ga0207648_1064774813300026089Miscanthus RhizosphereMQAEMNRRFDESKDLWRSELHRVEEILDARLKHLEER
Ga0207676_1002725023300026095Switchgrass RhizosphereLAKQTGRIGNNDAKIGELRSHMDVRFEEMKDLWRSELHRVEEVIDARLKHIER
Ga0207676_1173340823300026095Switchgrass RhizosphereFDHRFDDLKETWRSELRRVEEVLDARLSHLEERLR
Ga0208827_104079913300027641Peatlands SoilDDLRSHMDTRFSATDALFTERLRRVEEVLDARLKHLEES
Ga0209596_115673633300027754Freshwater LakeAHMDHRFDDTRDMWRTELHRVEEILDARLKHIEERR
Ga0209073_1008973023300027765Agricultural SoilMNSRINDLRSHMDSCFDEMRATWHSELRRVEEVLDARLKHLEER
Ga0209060_1001097513300027826Surface SoilNSPLSDVNTRITELRSHLDDRFNVVDRRFEEMKDMWRSELRRVEEVLDARLRHLEER
Ga0268264_1167125613300028381Switchgrass RhizosphereTDLRSHMDSRFDDIRATWHSELRRVEGVLDARLKHLEER
Ga0311341_1084598313300029908BogSRLNDMNGRISDLRSHMDTRFDDMRVMWQSELHRVEEVLDARLRHLEEN
Ga0302282_133752613300030045FenFKGIDAPLDGMNQRFDDLRDLWRAELHRVEEVLGARLKHLEER
Ga0311372_1276238213300030520PalsaLNDLRRHMDARFDDMRETWRSELRRVEEVIDARLKRLEAR
Ga0170834_10987270933300031057Forest SoilMDRGLNARIDDLRSHMDTRFDDMRATWQSELRRVEGVLDARLKHLEAR
Ga0170834_11245554223300031057Forest SoilHVDGRFDEMRDLWRAELRRVEEVIDARLKHLEDRG
Ga0302325_1114933223300031234PalsaRLNDLRSHIDARFDEMRETWRAELRRVEEVLDARLKHIEKD
Ga0302324_10136598623300031236PalsaRLGAAIKESRDHMDTRFNEIRDLWRSELYRVEQVFDARLKHLEERGR
Ga0302326_1114500123300031525PalsaRSHMDNRFDDARDSWRAELRRVEEVIDARLKHIEDR
Ga0307476_1110926013300031715Hardwood Forest SoilLGDLSSSLNARFGDLRAHMDVRFEEMKDLWRSELHRVEEVIDARLKHIEER
Ga0307475_1128718013300031754Hardwood Forest SoilELRSHMDSRFDDIRATWQAELRRVEEVLDARLKHLEER
Ga0307471_10193112423300032180Hardwood Forest SoilTDLRSHMDSLFDDMRATWHSELRRVEEVLDARLKHLEER
Ga0310812_1020017313300032421SoilINDLRSHMDSCFDEMRATWHSELRRVEEVLDARLKHLEER
Ga0335078_1054036623300032805SoilLDLQRRMDQRFDEMKELWQSELRRVEEILDARLKHIEER
Ga0335083_1025893533300032954SoilMDARIDDLRTDLKDTWRAELRRVEEVLDARLKHLEER
Ga0310810_1009541813300033412SoilMNSRINDLRSHMDSRFDEMRATWHSELRRVEEVLDARLKHLEER
Ga0310811_1036056113300033475SoilVNSRINDLRSHMDSRFDEMRATWHSELRRVEEVLDARLKHLEER


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.