Metagenome / Metatranscriptome Family F094121

Basic Information
Family ID	F094121
Family Type	Metagenome / Metatranscriptome
Number of Sequences	106
Average Sequence Length	40 residues
Representative Sequence	MKTIASALIALSVLAGVAAPANAAWDTKAFWENLARSAQ
Number of Associated Samples	77
Number of Associated Scaffolds	105

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	0.00 %
% of genes from short scaffolds (< 2000 bps)	0.00 %
Associated GOLD sequencing projects	66
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.34

Most Common Taxonomy
Group	Unclassified (100.000 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (17.924 % of family members)
Environment Ontology (ENVO)	Unclassified (35.849 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (61.321 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	Yes	Secondary Structure distribution:	α-helix: 49.25% β-sheet: 0.00% Coil/Unstructured: 50.75%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 105 Family Scaffolds
PF04519	Bactofilin	2.86
PF16138	DUF4846	1.90
PF01177	Asp_Glu_race	1.90
PF01575	MaoC_dehydratas	0.95
PF10907	DUF2749	0.95
PF13340	DUF4096	0.95
PF00239	Resolvase	0.95
PF13561	adh_short_C2	0.95
PF00665	rve	0.95
PF00561	Abhydrolase_1	0.95
PF13827	DUF4189	0.95
PF03237	Terminase_6N	0.95
PF01068	DNA_ligase_A_M	0.95
PF01266	DAO	0.95
PF01527	HTH_Tnp_1	0.95
PF01471	PG_binding_1	0.95
PF00300	His_Phos_1	0.95

COG ID	Name	Functional Category	% Frequency in 105 Family Scaffolds
COG1664	Cytoskeletal protein CcmA, bactofilin family	Cytoskeleton [Z]	2.86
COG1423	ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family	Replication, recombination and repair [L]	0.95
COG1793	ATP-dependent DNA ligase	Replication, recombination and repair [L]	0.95
COG1961	Site-specific DNA recombinase SpoIVCA/DNA invertase PinE	Replication, recombination and repair [L]	0.95
COG2452	Predicted site-specific integrase-resolvase	Mobilome: prophages, transposons [X]	0.95
COG2801	Transposase InsO and inactivated derivatives	Mobilome: prophages, transposons [X]	0.95
COG2826	Transposase and inactivated derivatives, IS30 family	Mobilome: prophages, transposons [X]	0.95
COG3316	Transposase (or an inactivated derivative), DDE domain	Mobilome: prophages, transposons [X]	0.95
COG4584	Transposase	Mobilome: prophages, transposons [X]	0.95

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	100.00 %

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	53.77%
Environmental	Environmental	46.23%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	53.77%
Terrestrial	Environmental → Terrestrial	43.40%
Aquatic	Environmental → Aquatic	2.83%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	40.57%
Rhizosphere	Host-Associated → Plants → Rhizosphere	27.36%
Rhizoplane	Host-Associated → Plants → Rhizoplane	16.04%
Roots	Host-Associated → Plants → Roots	10.38%
Freshwater	Environmental → Aquatic → Freshwater	1.89%
Cave	Environmental → Terrestrial → Cave	1.89%
Sediment	Environmental → Aquatic → Sediment	0.94%
Floodplain	Environmental → Terrestrial → Floodplain	0.94%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	33.02%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	21.70%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	13.21%
Bulk Soil	Host-Associated → Plants → Roots → Bulk Soil	9.43%
Loam	Environmental → Terrestrial → Soil → Loam	7.55%
Soil	Host-Associated → Plants → Rhizosphere → Soil	5.66%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	2.83%
Unclassified	Environmental → Terrestrial → Cave → Unclassified	1.89%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.94%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.94%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.94%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.94%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.94%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	21.70%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	15.09%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	13.21%
Unclassified	Host-Associated → Plants → Roots → Bulk Soil → Unclassified	9.43%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	8.49%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	5.66%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	4.72%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	4.72%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	3.77%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	2.83%
Unclassified	Environmental → Terrestrial → Soil → Loam → Unclassified	1.89%
Unclassified	Environmental → Terrestrial → Cave → Unclassified → Unclassified	1.89%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.94%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	0.94%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.94%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.94%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	0.94%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.94%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.94%

Habitat	Taxonomy	Distribution
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	17.92%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	14.15%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	10.38%
Populus Endosphere	Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere	9.43%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	8.49%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	4.72%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	4.72%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	4.72%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	2.83%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	2.83%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	2.83%
Soil	Environmental → Terrestrial → Soil → Loam → Unclassified → Soil	1.89%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.94%
Soil	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil	0.94%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.94%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	0.94%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.94%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.94%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.94%
Microbial Mat On Rocks	Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks	0.94%
Biofilm	Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm	0.94%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.94%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.94%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.94%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.94%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.94%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.94%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.94%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2140918013	Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies)	Environmental	Open in IMG/M
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000787	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000789	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000890	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000955	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300002503	Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3	Environmental	Open in IMG/M
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental	Open in IMG/M
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated	Open in IMG/M
3300004480	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4	Environmental	Open in IMG/M
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental	Open in IMG/M
3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Host-Associated	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Host-Associated	Open in IMG/M
3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Environmental	Open in IMG/M
3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Environmental	Open in IMG/M
3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Host-Associated	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Host-Associated	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300006042	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Host-Associated	Open in IMG/M
3300006178	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Host-Associated	Open in IMG/M
3300006196	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1	Host-Associated	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated	Open in IMG/M
3300006853	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Host-Associated	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300010147	Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300012951	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG	Environmental	Open in IMG/M
3300012955	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG	Environmental	Open in IMG/M
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental	Open in IMG/M
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental	Open in IMG/M
3300012986	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG	Environmental	Open in IMG/M
3300012987	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG	Environmental	Open in IMG/M
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300018028	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex	Environmental	Open in IMG/M
3300018422	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T	Environmental	Open in IMG/M
3300018466	Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T	Environmental	Open in IMG/M
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental	Open in IMG/M
3300019263	Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019360	White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG	Environmental	Open in IMG/M
3300023261	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S166-409R-6	Environmental	Open in IMG/M
3300025313	Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes)	Environmental	Open in IMG/M
3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300027866	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes)	Host-Associated	Open in IMG/M
3300027873	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028802	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S	Environmental	Open in IMG/M
3300031199	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S	Environmental	Open in IMG/M
3300031576	Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300033815	Sediment microbial communities from East River floodplain, Colorado, United States - 31_s17	Environmental	Open in IMG/M
3300034662	Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R4 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Iowa-Corn-GraphCirc_01890620	2140918013	Soil	MKTIISTLIALSVLAAVAAPANAAWDTKAFWAELARSAT
INPhiseqgaiiFebDRAFT_1011898461	3300000364	Soil	SALLALTVLTGIAVAPASAAWDTKAFWENLERTQGGGGN*
INPhiseqgaiiFebDRAFT_1014875761	3300000364	Soil	MLLCHPQFGSSLMKIIASALIALSILAGLVAPANAAWDTQSFWEGLARSAQ*
JGI11643J11755_111505651	3300000787	Soil	MKTILTALLALSILGSAAVPVSAAWDTRAFWENLERQAGG
JGI1027J11758_121993092	3300000789	Soil	ASALIALSILAGLVAPANAAWDTQSFWEGLARSAQ*
JGI11643J12802_103084741	3300000890	Soil	RGVHLMKTIISTLIALSVLAAVAAPANAAWDTKAFWAELDRSRT*
JGI1027J12803_1015021302	3300000955	Soil	MKTIVSALLALTVLTGVAASASAAWDTKAFWDNLERTQGGGGN*
JGI1027J12803_1026539832	3300000955	Soil	MKIIASALIALSILAGLVAPANAAWDTQSFWEGLARSAQ*
JGI1027J12803_1051774661	3300000955	Soil	MKIIASALIALSVLTSVAAPANAAWDTKAFWEGLARSAQ*
C687J35164_102279702	3300002503	Soil	MKTILSALLALSFLTAVAAPASAAWDVKTFWDQLDRSSY*
Ga0062593_1007678472	3300004114	Soil	MKTIVSALLALTVLTGVAVAPASAAWDTKAFWENLERVAGGGN*
Ga0063356_1016961541	3300004463	Arabidopsis Thaliana Rhizosphere	MKTIISTLIALSVLAAVAAPANAAWDTKAFWAELDRSRT*
Ga0062592_1026202441	3300004480	Soil	MKTLISALIALSLVASVAAPANAAWDAKTFWDELARTAM*
Ga0062594_1007349321	3300005093	Soil	MKTIISTLIALSVLTAVAAPANAAWDTKAFWADLARSAT*
Ga0070670_1021988152	3300005331	Switchgrass Rhizosphere	MKTIASALIALSVLTTVAAPANAAWDTKAFWEGLARSAQ*
Ga0066388_1018116502	3300005332	Tropical Forest Soil	MKTIVSALLALTVLTGVAVAPASAAWDTKAFWENLERTQGGGN*
Ga0070668_1005204821	3300005347	Switchgrass Rhizosphere	MKTIVSALLALSVLAGIAAPASAAWDTKAFWEELDRTRM*
Ga0070701_103580513	3300005438	Corn, Switchgrass And Miscanthus Rhizosphere	MKTLVSALIALSLVASVAAPANAAWDAKTFWDELARTAM*
Ga0070700_1010959271	3300005441	Corn, Switchgrass And Miscanthus Rhizosphere	MKTIISTLIALSVLTAVAAPANAAWDTKAFWAEQARSAT*
Ga0070700_1019621411	3300005441	Corn, Switchgrass And Miscanthus Rhizosphere	MIMKTIASALLALSVLTSIAAPASAAWDTKAFWENLERQAGGGN*
Ga0068854_1016209112	3300005578	Corn Rhizosphere	LVSALIALSLVASVAAPANAAWDAKTFWDELARTAM*
Ga0068859_1013907622	3300005617	Switchgrass Rhizosphere	MKTIISTLIALSVLTAVAAPANAAWDTKAFWAELSRSAT*
Ga0068861_1013577471	3300005719	Switchgrass Rhizosphere	MKTIASALIALSVLAGIAAPANAAWDTKAFWEQQERART*
Ga0068861_1015171421	3300005719	Switchgrass Rhizosphere	MKTIASALLALSVLTSIAAPASAAWDTKAFWENLERQAGGGN*
Ga0068861_1024369551	3300005719	Switchgrass Rhizosphere	QLRSSLMKTIASALIALSILAAVAAPANAAWDTKAFWEDLARTAQ*
Ga0068870_104946732	3300005840	Miscanthus Rhizosphere	MKTIVSALLALTVLTGVAVAPASAAWDTKAFWENLERVAG
Ga0068863_1009077222	3300005841	Switchgrass Rhizosphere	LCDHHSYGVLLMKTIVSALIALSVLASVSAPASAAWDTKAFWEDLARSAQ*
Ga0068863_1015159242	3300005841	Switchgrass Rhizosphere	MKTIVSALLALTVLTGVAIAPASAAWDTKAFWDNLERTQGGGGN*
Ga0068862_1000750796	3300005844	Switchgrass Rhizosphere	MKIIASALIALSVLTIVAAPANAAWDTKDFWESLARSA
Ga0075368_100612852	3300006042	Populus Endosphere	MKTIASALIALSILAAVAAPANAAWDTKAFWEDLARTAQ*
Ga0075368_102986241	3300006042	Populus Endosphere	MNTIISTLIALSVVVAVAAPANAAWDTKAFWAELAQSAT*
Ga0075367_102225672	3300006178	Populus Endosphere	MKAIVSALLALTVLTGVAVAPASAAWDTKAFWDNLERTQGGGGN*
Ga0075367_102582491	3300006178	Populus Endosphere	MKTIVSALLALTVLTGVAVAPASAAWDTKAFWENLERVAGG
Ga0075367_106699382	3300006178	Populus Endosphere	MKTIASVLIALSILTTVAAPANAAWDTKAFWESLARSAQ*
Ga0075367_108875622	3300006178	Populus Endosphere	TIVSALLALTVLTGVAVAPASAAWDTKAFWENLERVAGGGN*
Ga0075422_105843201	3300006196	Populus Rhizosphere	MKTIVSALLALTVLTGVAVAPASAAWDTKKFWEDQANSQGGGG*
Ga0075428_1000872016	3300006844	Populus Rhizosphere	MKTILSALIALSVLGSVAVPASAAWDTKKFWENLENSQGGGN*
Ga0075428_1001941514	3300006844	Populus Rhizosphere	MKTIISTLIALSVLAAVAAPANAAWDTKTFWENLARSAQ*
Ga0075428_1002439374	3300006844	Populus Rhizosphere	MKTIVSALLALTVLTGFAVAPASAAWDTKKFWEDRERAQGGN*
Ga0075428_1018550711	3300006844	Populus Rhizosphere	MKTIASALIALSVLAGVAAPANAAWDTKTFWENLARSAQ*
Ga0075421_1006065413	3300006845	Populus Rhizosphere	MKTIISTLIALSVLVAVAAPANAAWDTKAFWAELARSAT*
Ga0075431_1016900453	3300006847	Populus Rhizosphere	PLMKTIISTLIALSVLAAVAAPANAAWDTKTFWENLARSAQ*
Ga0075420_1003992361	3300006853	Populus Rhizosphere	MKTIVSALLALTVLTGFAVAPASAAWDTKKFWEDRERAQGGG
Ga0075425_1005068661	3300006854	Populus Rhizosphere	MKMIVAALIAMSAIAAVAAPANAAWDAKTFWEKLDQSRT*
Ga0075425_1005578002	3300006854	Populus Rhizosphere	MKTIVSALIALSVLASVSAPASAAWDTKAFWEDLARSAQ*
Ga0075425_1012490913	3300006854	Populus Rhizosphere	MKAIVSALLALTVLTGVAVAPASAAWDTKAFWDNLERTQ
Ga0105251_103938671	3300009011	Switchgrass Rhizosphere	MKTIAFALIALSVLAGIAAPASAAWDTKAFWEQQEQSRT*
Ga0075418_102941422	3300009100	Populus Rhizosphere	MKTIASALVALSVLAGVAAPANAAWDTKVFWENLARSAQ*
Ga0105247_115684891	3300009101	Switchgrass Rhizosphere	MKTIASALIALSVLAGVAAPANAAWDTKAFWENLARSAQ*
Ga0111538_122187372	3300009156	Populus Rhizosphere	MKTIISTLMALSVLAAVAAPANAAWDTKAFWAELARSAT*
Ga0105249_124436352	3300009553	Switchgrass Rhizosphere	MKTIISTLIALSVLTAVAAPANAAWDTKAFWAELAQSAT*
Ga0126319_13714212	3300010147	Soil	MKTILSALIALSVLGSVAAPASAAWDTKAFWDNLERAQGGGGN*
Ga0126372_117817742	3300010360	Tropical Forest Soil	MKTIVSALIALSVLASVSAPASAAWDTKTFWDDLARSAQ*
Ga0164300_110817661	3300012951	Soil	MIMKTIASALLALSVLTSIAAPASAAWDTKAFWENLERQATGGN*
Ga0164298_105302592	3300012955	Soil	MKTIISTLIALSVVVAVAAPANAAWDTKAFWAELAQSAT*
Ga0164298_109626181	3300012955	Soil	MKTIVSALLALSVLTGFAASASAAWDTKAFWENLERTQGGGGN*
Ga0164299_113419201	3300012958	Soil	MKTIASALIALSVLTTVAAPANAAWDAKAFWEGLARSAQ*
Ga0164299_116227661	3300012958	Soil	MKTIVSALIALSVLAGIAAPANAAWDTKAFWEQQERART*
Ga0164301_117929262	3300012960	Soil	ISTLIALSVLAAVAAPANAAWDTKAFWAEQARSAT*
Ga0164304_117562821	3300012986	Soil	MKTIVSALLALTVLTGVAVAPASAAWDTKAFWENLERTQGGGGN*
Ga0164307_107128172	3300012987	Soil	MKAIVSTLLALTVLTGVAVAPASAAWDTKAFWDNLERTQGGGGN*
Ga0164305_115412132	3300012989	Soil	ESLMKTIASVLIALSILAGLAAPANAAWDTKAFWDELARYAQ*
Ga0157375_123452611	3300013308	Miscanthus Rhizosphere	KIIASALIALSVLTTVAAPANAAWDTKSFWEGLARSAQ*
Ga0163163_120864682	3300014325	Switchgrass Rhizosphere	MKTIASALIALSILAGLAAPANAAWDTQAFWQGLARSAQ*
Ga0132257_1021291701	3300015373	Arabidopsis Rhizosphere	IISTLIALSVLTAVAAPANAAWDTKAFWADLARSAT*
Ga0132255_1020623721	3300015374	Arabidopsis Rhizosphere	TIISTLIALSVLTAVAAPANAAWDTKAFWADLARSAT*
Ga0132255_1038247472	3300015374	Arabidopsis Rhizosphere	MKTIVSALIALSVLTTVAAPANAAWDTKAFWEGLARSAQ*
Ga0184608_101023734	3300018028	Groundwater Sediment	MKTIRPALLALSFLTAVAAPASAAWDAKTFWEQLDRS
Ga0190265_101398833	3300018422	Soil	MKTIVSALLALSVLAGTVGSASAASDWTKEFWAQHERNLP
Ga0190268_109752004	3300018466	Soil	VMKTIASALIALSVLAGIAAPASAAWDTKAFWEQVDRTGGQ
Ga0190274_122462081	3300018476	Soil	MKTIVSALLALSVLAGIAAPASAAWDTKAFWEELDRTRM
Ga0184647_13404402	3300019263	Groundwater Sediment	MKTLVSALIALSLIASVAAPANAAWDAKTFWDELARTAM
Ga0187894_101048072	3300019360	Microbial Mat On Rocks	MKTIASALVALSILAGIAAPASAADRFNSKDFWAQQDRNLP
Ga0247796_11207011	3300023261	Soil	KTLVSALIALSLVASVAAPANAAWDAKTFWDELARTAM
Ga0209431_102853624	3300025313	Soil	MIMKTILSALLALSFLTAVAAPASAAWDVKTFWDQLDRSSY
Ga0207685_102136711	3300025905	Corn, Switchgrass And Miscanthus Rhizosphere	MKTIVSALLALTVLTGVAVAPASAAWDTKKFWENL
Ga0207685_102136712	3300025905	Corn, Switchgrass And Miscanthus Rhizosphere	MKTILSALIALSVLGSVAVPASAAWDTKKFWEDRAESQGGGG
Ga0207681_105197561	3300025923	Switchgrass Rhizosphere	MKTIVSALLALSVLAGIAAPASAAWDTKAFWEELD
Ga0207669_108683832	3300025937	Miscanthus Rhizosphere	MKTIISTLIALSVVAAVAAPANAAWDTKAFWAEQARSAT
Ga0207668_115678822	3300025972	Switchgrass Rhizosphere	MKTIISTLIALSVLTAVAAPANAAWDTKAFWAELARSAT
Ga0207658_101383241	3300025986	Switchgrass Rhizosphere	MKTIVSALLALTVLTGVAVAPASAAWDTKAFWENLERVAGGGN
Ga0207641_108056512	3300026088	Switchgrass Rhizosphere	MKTIVSALIALSVLASVSAPASAAWDTKAFWEDLARSAQ
Ga0207675_1009657231	3300026118	Switchgrass Rhizosphere	MKTIASALLALSVLTSIAAPASAAWDTKAFWENLERQAGGGN
Ga0207675_1014835732	3300026118	Switchgrass Rhizosphere	MKTIASALIALSVLTTVAAPANAAWDTKAFWEGLARSAQ
Ga0209813_100009337	3300027866	Populus Endosphere	MKTLVSALIALSLVASVAAPANAAWDAKTFWDELARTAM
Ga0209813_100737722	3300027866	Populus Endosphere	MKTIISTLIALSVLTAVAAPANAAWDTKAFWAELSRSAT
Ga0209813_102487022	3300027866	Populus Endosphere	MNTIISTLIALSVVVAVAAPANAAWDTKAFWAELAQSAT
Ga0209813_103349292	3300027866	Populus Endosphere	MKTIVSALLALTVLTGVAVAPASAAWDTKAFWENLE
Ga0209814_104043991	3300027873	Populus Rhizosphere	MKTIISTLIALSVLVAVAAPANAAWDTKAFWAELARSAT
Ga0207428_108178352	3300027907	Populus Rhizosphere	MKTIISTLIALSVLAAVAAPANAAWDTKAFWAELDRSRT
Ga0209382_101691315	3300027909	Populus Rhizosphere	MKTIISTLIALSVLAAVAAPANAAWDTKTFWENLARSAQ
Ga0209382_103014601	3300027909	Populus Rhizosphere	KTILAALLALSILGSAAVPVSAAWNTQAFWENLERQAGGGN
Ga0209382_104154332	3300027909	Populus Rhizosphere	MKTILSALIALSVLGSVAVPASAAWDTKKFWENLENSQGGGN
Ga0209382_115351861	3300027909	Populus Rhizosphere	MKTIVSALLALTVLTGFAVAPASAAWDTKKFWEDRERAQGGN
Ga0268265_126534632	3300028380	Switchgrass Rhizosphere	MKTIVSALLALTVLTGVAVAPASAAWDTKAFWENLERV
Ga0307503_106279611	3300028802	Soil	RGETSMKTIVSALIALSVLAGIAAPANAAWDTKAFWEQQERART
Ga0307503_107597421	3300028802	Soil	MKTIVSALLALTVLTGVAVAPASAAWDTKAFWENLDRQAGGGN
Ga0307495_101465452	3300031199	Soil	ALIALSVLGSVAAPASAAWDTKAFWDNLERTQGGGGN
Ga0247727_101852613	3300031576	Biofilm	MKTIASALVALSVIAGIAAPASAAWNPQEVFAQVERNLP
Ga0307469_116790971	3300031720	Hardwood Forest Soil	MKTIAFALIALSVLASIAAPASAAWDTKAFWEQQEQSRT
Ga0307469_118660281	3300031720	Hardwood Forest Soil	MKTILSALIALSVLGSVAVPASAAWDTKKFWENLENSQGGGG
Ga0307468_1011454772	3300031740	Hardwood Forest Soil	MKTIASALIALSVLTTVAAPANAAWDAKAFWEGLARSAQ
Ga0307470_107390931	3300032174	Hardwood Forest Soil	MKTIVSALLALTVLTGVAVAPASAAWDTKKFWENLENSQGGGG
Ga0307472_1022503162	3300032205	Hardwood Forest Soil	MKTILSALIALSVLGSVAVPASAAWDTKAFWDNLERTQGGGGN
Ga0364946_158158_132_257	3300033815	Sediment	MIMKTILSALLALSFLTAVAAPASAAWDTKAFWDQQDRSSY
Ga0314783_101847_19_141	3300034662	Soil	MKTIIISTLMALSVVAAVAAPANAAWDTKAFWAEQARSAT

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.34
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.34
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F094121

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign