NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F094240

Metagenome Family F094240

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F094240
Family Type Metagenome
Number of Sequences 106
Average Sequence Length 39 residues
Representative Sequence MRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKVSTVA
Number of Associated Samples 83
Number of Associated Scaffolds 106

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 22.77 %
% of genes near scaffold ends (potentially truncated) 93.40 %
% of genes from short scaffolds (< 2000 bps) 74.53 %
Associated GOLD sequencing projects 76
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (67.925 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil
(11.321 % of family members)
Environment Ontology (ENVO) Unclassified
(27.358 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(37.736 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 72.22%    β-sheet: 0.00%    Coil/Unstructured: 27.78%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 106 Family Scaffolds
PF02371Transposase_20 5.66
PF03743TrbI 1.89
PF09346SMI1_KNR4 1.89
PF03544TonB_C 1.89
PF07676PD40 1.89
PF01548DEDD_Tnp_IS110 1.89
PF14520HHH_5 0.94
PF08238Sel1 0.94
PF05532CsbD 0.94
PF05117DUF695 0.94
PF00860Xan_ur_permease 0.94
PF13847Methyltransf_31 0.94
PF13637Ank_4 0.94
PF13426PAS_9 0.94
PF01979Amidohydro_1 0.94
PF06245DUF1015 0.94
PF16326ABC_tran_CTD 0.94
PF07228SpoIIE 0.94
PF00155Aminotran_1_2 0.94
PF00578AhpC-TSA 0.94
PF13545HTH_Crp_2 0.94
PF16653Sacchrp_dh_C 0.94
PF13620CarboxypepD_reg 0.94
PF08818DUF1801 0.94
PF07238PilZ 0.94
PF14559TPR_19 0.94
PF00180Iso_dh 0.94
PF03372Exo_endo_phos 0.94
PF00664ABC_membrane 0.94
PF01833TIG 0.94
PF13427DUF4111 0.94
PF00330Aconitase 0.94
PF13229Beta_helix 0.94
PF00685Sulfotransfer_1 0.94
PF00484Pro_CA 0.94
PF07730HisKA_3 0.94
PF05960DUF885 0.94
PF13669Glyoxalase_4 0.94
PF13557Phenol_MetA_deg 0.94
PF10502Peptidase_S26 0.94
PF06826Asp-Al_Ex 0.94
PF02838Glyco_hydro_20b 0.94
PF07366SnoaL 0.94
PF13407Peripla_BP_4 0.94
PF08282Hydrolase_3 0.94

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 106 Family Scaffolds
COG3547TransposaseMobilome: prophages, transposons [X] 7.55
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 1.89
COG2948Type IV secretory pathway, VirB10 componentIntracellular trafficking, secretion, and vesicular transport [U] 1.89
COG0288Carbonic anhydraseInorganic ion transport and metabolism [P] 0.94
COG0560Phosphoserine phosphataseAmino acid transport and metabolism [E] 0.94
COG0561Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatasesCoenzyme transport and metabolism [H] 0.94
COG1877Trehalose-6-phosphate phosphataseCarbohydrate transport and metabolism [G] 0.94
COG2217Cation-transporting P-type ATPaseInorganic ion transport and metabolism [P] 0.94
COG2985Uncharacterized membrane protein YbjL, putative transporterGeneral function prediction only [R] 0.94
COG3237Uncharacterized conserved protein YjbJ, UPF0337 familyFunction unknown [S] 0.94
COG3525N-acetyl-beta-hexosaminidaseCarbohydrate transport and metabolism [G] 0.94
COG3769Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamilyCarbohydrate transport and metabolism [G] 0.94
COG3850Signal transduction histidine kinase NarQ, nitrate/nitrite-specificSignal transduction mechanisms [T] 0.94
COG3851Signal transduction histidine kinase UhpB, glucose-6-phosphate specificSignal transduction mechanisms [T] 0.94
COG4198Uncharacterized conserved protein, DUF1015 familyFunction unknown [S] 0.94
COG4430Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 familyFunction unknown [S] 0.94
COG4564Signal transduction histidine kinaseSignal transduction mechanisms [T] 0.94
COG4585Signal transduction histidine kinase ComPSignal transduction mechanisms [T] 0.94
COG4805Uncharacterized conserved protein, DUF885 familyFunction unknown [S] 0.94
COG5646Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis)Posttranslational modification, protein turnover, chaperones [O] 0.94
COG5649Uncharacterized conserved protein, DUF1801 domainFunction unknown [S] 0.94

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms67.92 %
UnclassifiedrootN/A32.08 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005366|Ga0070659_100149705All Organisms → cellular organisms → Bacteria → Acidobacteria1903Open in IMG/M
3300005434|Ga0070709_11255872Not Available596Open in IMG/M
3300005526|Ga0073909_10415250All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium636Open in IMG/M
3300005529|Ga0070741_10000917All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae97387Open in IMG/M
3300005529|Ga0070741_10268413Not Available1616Open in IMG/M
3300005534|Ga0070735_10002819All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae15486Open in IMG/M
3300005534|Ga0070735_10290025All Organisms → cellular organisms → Bacteria987Open in IMG/M
3300005568|Ga0066703_10759726Not Available555Open in IMG/M
3300005575|Ga0066702_10996120Not Available501Open in IMG/M
3300005586|Ga0066691_10594041All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium658Open in IMG/M
3300005614|Ga0068856_100523109All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1207Open in IMG/M
3300005887|Ga0075292_1052734All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium592Open in IMG/M
3300006028|Ga0070717_10013182All Organisms → cellular organisms → Bacteria → Acidobacteria6323Open in IMG/M
3300006059|Ga0075017_100098623All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium2032Open in IMG/M
3300006162|Ga0075030_100384602Not Available1118Open in IMG/M
3300006162|Ga0075030_100417705Not Available1068Open in IMG/M
3300006174|Ga0075014_100245393Not Available922Open in IMG/M
3300006354|Ga0075021_10259170All Organisms → cellular organisms → Bacteria1071Open in IMG/M
3300006358|Ga0068871_100115116All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium2266Open in IMG/M
3300006358|Ga0068871_101024672All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae769Open in IMG/M
3300006755|Ga0079222_12294349All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300006797|Ga0066659_10561740Not Available923Open in IMG/M
3300007982|Ga0102924_1284569All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium664Open in IMG/M
3300009093|Ga0105240_10215693All Organisms → cellular organisms → Bacteria2239Open in IMG/M
3300009093|Ga0105240_10551475Not Available1275Open in IMG/M
3300009098|Ga0105245_10135606All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2313Open in IMG/M
3300009098|Ga0105245_12708488Not Available549Open in IMG/M
3300009551|Ga0105238_11078115Not Available826Open in IMG/M
3300009553|Ga0105249_10953842All Organisms → cellular organisms → Bacteria → Acidobacteria926Open in IMG/M
3300009644|Ga0116121_1057178All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales1223Open in IMG/M
3300010339|Ga0074046_10149463All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1490Open in IMG/M
3300010341|Ga0074045_10013108All Organisms → cellular organisms → Bacteria6777Open in IMG/M
3300010343|Ga0074044_10617246All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium708Open in IMG/M
3300010360|Ga0126372_12357525All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300010373|Ga0134128_10894990All Organisms → cellular organisms → Bacteria983Open in IMG/M
3300010375|Ga0105239_12527770All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300010396|Ga0134126_10193017All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2441Open in IMG/M
3300010396|Ga0134126_10846996All Organisms → cellular organisms → Bacteria1031Open in IMG/M
3300012205|Ga0137362_10331899All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1317Open in IMG/M
3300012206|Ga0137380_10288957All Organisms → cellular organisms → Bacteria → Acidobacteria1471Open in IMG/M
3300012989|Ga0164305_11693163All Organisms → cellular organisms → Bacteria → Acidobacteria567Open in IMG/M
3300013100|Ga0157373_10134483All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1738Open in IMG/M
3300013297|Ga0157378_10254357All Organisms → cellular organisms → Bacteria1683Open in IMG/M
3300014325|Ga0163163_10279881All Organisms → cellular organisms → Bacteria → Acidobacteria1720Open in IMG/M
3300014498|Ga0182019_10097166All Organisms → cellular organisms → Bacteria1797Open in IMG/M
3300015372|Ga0132256_100056562All Organisms → cellular organisms → Bacteria3665Open in IMG/M
3300015372|Ga0132256_101710198All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCGC AG-212-P17738Open in IMG/M
3300015372|Ga0132256_101822903All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium716Open in IMG/M
3300015374|Ga0132255_101274973All Organisms → cellular organisms → Bacteria1108Open in IMG/M
3300016294|Ga0182041_10117980All Organisms → cellular organisms → Bacteria → Acidobacteria1986Open in IMG/M
3300016404|Ga0182037_10239902All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1429Open in IMG/M
3300017934|Ga0187803_10060783Not Available1487Open in IMG/M
3300017934|Ga0187803_10075944All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1322Open in IMG/M
3300017955|Ga0187817_10614752Not Available693Open in IMG/M
3300018012|Ga0187810_10540517Not Available500Open in IMG/M
3300018025|Ga0187885_10250306Not Available810Open in IMG/M
3300018033|Ga0187867_10703426All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Gemmata → Gemmata massiliana550Open in IMG/M
3300018468|Ga0066662_11153874Not Available779Open in IMG/M
3300021171|Ga0210405_11265992Not Available543Open in IMG/M
3300021420|Ga0210394_10000081All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae229344Open in IMG/M
3300021420|Ga0210394_10004610All Organisms → cellular organisms → Bacteria15957Open in IMG/M
3300021420|Ga0210394_11502938Not Available569Open in IMG/M
3300022557|Ga0212123_10000033All Organisms → cellular organisms → Bacteria453233Open in IMG/M
3300022557|Ga0212123_10628843All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium672Open in IMG/M
3300025320|Ga0209171_10018330All Organisms → cellular organisms → Bacteria → Acidobacteria5714Open in IMG/M
3300025906|Ga0207699_11290322Not Available540Open in IMG/M
3300025912|Ga0207707_10038282All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4191Open in IMG/M
3300025928|Ga0207700_10790017All Organisms → cellular organisms → Bacteria849Open in IMG/M
3300025931|Ga0207644_10173976All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1683Open in IMG/M
3300025934|Ga0207686_10715816Not Available797Open in IMG/M
3300025937|Ga0207669_11812396All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium521Open in IMG/M
3300026041|Ga0207639_10156014All Organisms → cellular organisms → Bacteria → Acidobacteria1918Open in IMG/M
3300026360|Ga0257173_1007882All Organisms → cellular organisms → Bacteria → Acidobacteria1160Open in IMG/M
3300026916|Ga0208066_103825Not Available508Open in IMG/M
3300027432|Ga0209421_1031695All Organisms → cellular organisms → Bacteria1035Open in IMG/M
3300027821|Ga0209811_10005690All Organisms → cellular organisms → Bacteria → Acidobacteria4000Open in IMG/M
3300027842|Ga0209580_10175753All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1058Open in IMG/M
3300027842|Ga0209580_10563918All Organisms → cellular organisms → Bacteria → Acidobacteria566Open in IMG/M
3300027911|Ga0209698_10585769Not Available858Open in IMG/M
3300027911|Ga0209698_10936248Not Available648Open in IMG/M
3300027986|Ga0209168_10001191All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae21169Open in IMG/M
3300027986|Ga0209168_10022820All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3519Open in IMG/M
3300027986|Ga0209168_10099508All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin3451501Open in IMG/M
3300027986|Ga0209168_10197508All Organisms → cellular organisms → Bacteria1007Open in IMG/M
3300028800|Ga0265338_10251024All Organisms → cellular organisms → Bacteria1305Open in IMG/M
3300028800|Ga0265338_11165854Not Available517Open in IMG/M
3300031231|Ga0170824_104429116All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium889Open in IMG/M
3300031231|Ga0170824_122294744Not Available556Open in IMG/M
3300031344|Ga0265316_10131839All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1882Open in IMG/M
3300031640|Ga0318555_10606323All Organisms → cellular organisms → Bacteria → Acidobacteria593Open in IMG/M
3300031718|Ga0307474_10385901Not Available1088Open in IMG/M
3300031890|Ga0306925_10297509All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1736Open in IMG/M
3300031954|Ga0306926_10658773All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1273Open in IMG/M
3300032770|Ga0335085_10032101All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia7305Open in IMG/M
3300032770|Ga0335085_10449204Not Available1483Open in IMG/M
3300032782|Ga0335082_10825056Not Available789Open in IMG/M
3300032893|Ga0335069_10008986All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae14254Open in IMG/M
3300032893|Ga0335069_10475019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya → unclassified Leptolyngbya → Leptolyngbya sp. PCC 73751454Open in IMG/M
3300032893|Ga0335069_10876020Not Available1005Open in IMG/M
3300032955|Ga0335076_10148465All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2260Open in IMG/M
3300033433|Ga0326726_10073905All Organisms → cellular organisms → Bacteria3011Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil11.32%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds6.60%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil6.60%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.66%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.72%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.77%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring3.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.77%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.77%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.77%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.77%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.83%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil2.83%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere2.83%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere2.83%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.89%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.89%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.89%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.89%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.89%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.89%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.94%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.94%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.94%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.94%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.94%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.94%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.94%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.94%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.94%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.94%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.94%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.94%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.94%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.94%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.94%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005887Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007982Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaGEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009644Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300025320Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026360Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-BEnvironmentalOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300026916Forest soil microbial communities from Browns Valley, California, USA, that are Nitrogen fertilized - NN109 (SPAdes)EnvironmentalOpen in IMG/M
3300027432Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0070659_10014970543300005366Corn RhizosphereMRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKISTVATQQSRK
Ga0070709_1125587213300005434Corn, Switchgrass And Miscanthus RhizosphereMRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKVSTVAVRASRKIS
Ga0073909_1041525013300005526Surface SoilLRTDGMRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKGSTAA
Ga0070741_10000917843300005529Surface SoilMRRPVSGWDAVRSQVIDVLKAQIKRRPAMKKVSTAV
Ga0070741_1026841313300005529Surface SoilMRRPVSGWDAVRSQVIDVLKAQIKRRPAMKKVSTAVA
Ga0070735_10002819193300005534Surface SoilMQTDEMRRPVSGRDAVRSQVINVLEAQIKRRPAMKKVSTAA
Ga0070735_1029002513300005534Surface SoilMLTDEMRRPVSGRDAVRSQVINVLEAQIKRRPAMKKVSTAA
Ga0066703_1075972623300005568SoilMRRPVSGRDAVSSQVIDVLEAQIKRRPAMKKISIRA
Ga0066702_1099612013300005575SoilMRRPVSGRDAVSSQVIDVLEAQIKRRPAMKKISIRAA
Ga0066691_1059404123300005586SoilLAKSDGMRRPVSGRDAVSSQVIDVLEAQIKRRPAMKKISIRAA
Ga0068856_10052310923300005614Corn RhizosphereMRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKVSTV
Ga0075292_105273423300005887Rice Paddy SoilMSLSDGMRRPVSGRDAVRSQVIDVLKAQIKRRPAMKK
Ga0070717_10013182103300006028Corn, Switchgrass And Miscanthus RhizosphereMRRPVSGRDAVRSQVIDVLKAKIKRRPAMKKVSTAA
Ga0075017_10009862313300006059WatershedsMRRPVSGRDAVRSQVIDVLKAQIRRRPAMKKVSTV
Ga0075030_10038460223300006162WatershedsMKSDGMRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKISTAAA
Ga0075030_10041770513300006162WatershedsLLTKSDEMRRPVSRRDAVRSQVIDVLKAQIKRRPAMKKGS
Ga0075014_10024539333300006174WatershedsMRRPVSRRDAVRSQVIEVLEAQIKRRPAMKKVSTRAAAQSRNIS
Ga0075021_1025917033300006354WatershedsLQTDGMRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKIS
Ga0068871_10011511613300006358Miscanthus RhizosphereMRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKVSTVGA
Ga0068871_10102467223300006358Miscanthus RhizosphereMRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKVSTAGA
Ga0079222_1229434923300006755Agricultural SoilMRRPVSRRDALRSQVIDVLESTTDKRRPAMKKVSTVAAKE
Ga0066659_1056174033300006797SoilMTKSDGMRRPVSGRDAVSSQVIDVLEAQIKRRPAMKKISIRA
Ga0075433_1111323513300006852Populus RhizosphereLTKPDGMRRPVSGRDAVRSQVIDVLEAQIKRRPAM
Ga0079219_1242917423300006954Agricultural SoilMRRPVSGRDAERSQVIDVLKAQIKRRPARKKVSTVGTQQRRNIS
Ga0102924_128456913300007982Iron-Sulfur Acid SpringMRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKVSTRAA
Ga0105240_1021569313300009093Corn RhizosphereMRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKVSTVGAK
Ga0105240_1055147523300009093Corn RhizosphereMRRPVSGRDAARSQVIDVLEAQIKRRPAMKKVSTVGAKPSKKISQQ
Ga0105245_1013560613300009098Miscanthus RhizosphereMRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKISTVATQQSRKISEQ
Ga0105245_1270848823300009098Miscanthus RhizosphereMRRPASGRDAVRSQVIDVLEAQIKRRPAMKKISTVATQ
Ga0105242_1271064413300009176Miscanthus RhizosphereTDGMRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKVSTVGVKPSKKIRSRN*
Ga0105238_1107811533300009551Corn RhizosphereMITDGMRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKIST
Ga0105249_1095384223300009553Switchgrass RhizosphereMRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKISTV
Ga0116121_105717823300009644PeatlandMRRPVSGRDAIRSQVIDVLEAQIKRRPAMKKVSTRA
Ga0074046_1014946323300010339Bog Forest SoilMRRPVSGRDAVRSQVIDVLKAQIKRRPAMKKVSTRAA
Ga0074045_1001310813300010341Bog Forest SoilMRRPVSGRDAVRSQVIDVLKAQIKRRPAMKKVSTR
Ga0074044_1061724623300010343Bog Forest SoilMRRPVSGRDAVRSQVIDVLKAQIKRRPAMKKVSTRAAA
Ga0126372_1235752513300010360Tropical Forest SoilMRRPVSGRDAVRSQVSDVLEAQIKRRPAMKKGSTAA
Ga0134128_1089499013300010373Terrestrial SoilMRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKVSTAV
Ga0105239_1252777023300010375Corn RhizosphereMRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKISTVATQ
Ga0134126_1019301733300010396Terrestrial SoilMKRPVSGRDAVRSRVIDVLEAQIKRRPAMKKVSTVTAMQSRKIS
Ga0134126_1084699613300010396Terrestrial SoilMRRPVSGRDAERSQVIDVLKAQIKRRPARKKVSTV
Ga0137362_1033189943300012205Vadose Zone SoilMRRPVSGRDAVSSQVIDVLEAQIKRRPAMKKISSRAAA
Ga0137380_1028895723300012206Vadose Zone SoilMKTDGMRRPVSGRDAVSSQVIDVLEAQIKRRPAMKKV
Ga0164305_1169316323300012989SoilMRRPVSGRDVVRSQVIDVLEAQIKRRPAMKKISTV
Ga0157373_1013448353300013100Corn RhizosphereMRRPVSGRDAERSQVIDVLKAQIKRRPARKKVSTVGTQ
Ga0157378_1025435713300013297Miscanthus RhizosphereMRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKVSTVGAKPSK
Ga0163163_1027988123300014325Switchgrass RhizosphereMRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKVSTVGAKPSKKISQQ
Ga0182019_1009716623300014498FenMRGPVSGRDAVGSQVIDVLEAQIKRRPAMKKVSTVAAKQSRNFLNRS*
Ga0157376_1011651113300014969Miscanthus RhizosphereMRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKVSTVGAKPSKKISQQK
Ga0132256_10005656213300015372Arabidopsis RhizosphereMRRPVSGRDAVRSQVIDVLEAQIKRRPTMKKGSTAAKQRV
Ga0132256_10171019813300015372Arabidopsis RhizosphereMRRPVSVREAVRSQVIDVLEAQIKRRPAMKKGSTAAKQRVRN
Ga0132256_10182290333300015372Arabidopsis RhizosphereMRRPVSGRDAVRSQVIDVLEAQIKRRPATKKVSTVAT
Ga0132255_10127497323300015374Arabidopsis RhizosphereMRRPVSGRDAVRSQVIDVLEAQIKRRPDMKKGSTAAKQQ
Ga0182041_1011798013300016294SoilMRRPVSGRDAVRSQVIDVLKAQIKRRPAMKKVSTVA
Ga0182037_1023990213300016404SoilMRRPVSGRDAVRSQVIDVLKAQIKRRPAMKKVSTVAAKQAKNF
Ga0187803_1006078313300017934Freshwater SedimentMRRPVSGRDAVRSQVIDVLKAQIKRRPAMKKISTVAAK
Ga0187803_1007594433300017934Freshwater SedimentMRRPVSGRDAVRSQVIDVLKAQIKRRPAMKKISTVA
Ga0187817_1061475223300017955Freshwater SedimentMRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKVSTVA
Ga0187810_1054051723300018012Freshwater SedimentMRRPVSGRDAVRSQVIDVLKAQIKRRPAMKKISTV
Ga0187885_1025030623300018025PeatlandMRRPVSGQDAIRSQVIDVLEAQIKRRPAMKKVSTRAAAQSRNIS
Ga0187867_1070342613300018033PeatlandMRRPVSGQDAIRSQVIDVLEAQIKRRPAMKKVSTRAAGQSRN
Ga0066662_1115387413300018468Grasslands SoilMRRPVSGRDAVSSQVIDVLEAQIKRRPAMKKISIRAAA
Ga0210405_1126599223300021171SoilMRRPVSRRDAIRSQVIDVLEAQIKRRPAMKKVSTAVAKQS
Ga0210394_100000811983300021420SoilMRRPVSGRDAVRSQVIDVLKAQIKRRPAMKKISTAAVTQ
Ga0210394_1000461013300021420SoilMRRPVSGRDAVRSQVIDVLKAQIKRRPAMKKISTVAVKQ
Ga0210394_1150293813300021420SoilMRRPVSGRDAVRSQVIDVLKAQIKRRPAMKKISTAAVT
Ga0212123_100000334453300022557Iron-Sulfur Acid SpringMRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKVSTRAAAQ
Ga0212123_1062884323300022557Iron-Sulfur Acid SpringMRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKVSTRAAA
Ga0209171_1001833013300025320Iron-Sulfur Acid SpringMRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKISTAVA
Ga0207699_1129032223300025906Corn, Switchgrass And Miscanthus RhizosphereMRRPVSGRDALRSQVIEVLEAQIKRRPAMKKVSTETAKQS
Ga0207707_1003828213300025912Corn RhizosphereMRRPVSGRDAVRSQVIDVLKAQIKRRPARKKVSTVG
Ga0207700_1079001723300025928Corn, Switchgrass And Miscanthus RhizosphereMRRPVSERDAVRSQVIDVLEAQEMRRPAMKKISTAAAKQSR
Ga0207644_1017397643300025931Switchgrass RhizosphereMRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKVSTVGAKP
Ga0207686_1071581623300025934Miscanthus RhizosphereMRRPVSGRDAVRSQVIDVLKAQIKRRPARKKVSTV
Ga0207669_1181239623300025937Miscanthus RhizosphereMRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKISTVAT
Ga0207639_1015601443300026041Corn RhizosphereMRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKISTVA
Ga0257173_100788213300026360SoilMRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKVSTVTAKQ
Ga0209805_130670623300026542SoilMAGSGRDAVSSQVIDVLEAQIKRRPAMKKISIRAAAQSRNISQQK
Ga0208066_10382513300026916SoilLTKTDGMRRPVSGRDAVRSQVIDVLKAQIKRRPAMKKVSI
Ga0209421_103169533300027432Forest SoilMRRPVSERDAVRSQVIDVLKAQIKRRPAMKKISTRAAAQ
Ga0209811_1000569013300027821Surface SoilMSTDGMRRPVSGRDAVRSQVIDVLEAQIKRRPAMK
Ga0209580_1017575313300027842Surface SoilVAKPDGMRRPISGRDAVRSQVIDVLEAQIKRRPAMKKVS
Ga0209580_1056391813300027842Surface SoilMRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKVSTVAAK
Ga0209698_1058576923300027911WatershedsMRRPVSRRDAVRSQVIEVLEAQIKRRPAMKKVSTRAAAQSRN
Ga0209698_1093624833300027911WatershedsMRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKVSTRAAAQS
Ga0209168_1000119113300027986Surface SoilMQTDEMRRPVSGRDAVRSQVINVLEAQIKRRPAMKKVSTAATEQ
Ga0209168_1002282013300027986Surface SoilMRRPVSGRDAVRSQVINVLEAQIKRRPAMKKVSTAATEQ
Ga0209168_1009950833300027986Surface SoilMRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKVSTAANK
Ga0209168_1019750813300027986Surface SoilMLTDEMRRPVSGRDAVRSQVINVLEAQIKRRPAMKKVSTAATEQ
Ga0265338_1025102413300028800RhizosphereMRRPVSGRDAVRSQVIDVLKAQIKRRPAMKKVSTAAAKQ
Ga0265338_1116585423300028800RhizosphereMRRPVSGRDAVRSQVIDVLKAQIKRRPAMKKISTRAAAQ
Ga0170824_10442911623300031231Forest SoilMRRPVSGRDAVGSQVIDVLKAQIKRRPAMKKVSTRAAAQSRNISQ
Ga0170824_12229474413300031231Forest SoilMRRPVSGRDAVRSQVIDVLKAQIKRRPAMKKVSTAAAK
Ga0265316_1013183913300031344RhizosphereMRRPVSGRDAVRSQVIDVLKAQIKRRPAMKKISTRA
Ga0318555_1060632313300031640SoilMRRPVSGRDAVRSQVIDVLKAQIKRRPAMKKVSTVAAKQA
Ga0307474_1038590113300031718Hardwood Forest SoilNWRETDEMRRPVSRRDAVRSQVIDVLEAQIKRRPA
Ga0306925_1029750923300031890SoilMRRPVSGRDAVRSQVIDVLKAQIKRRPAMKKVSTV
Ga0306926_1065877313300031954SoilMRRPVSGRDAVRSQVIDVLKAQIKRRPAMKKVSTVAAK
Ga0335085_1003210183300032770SoilMRRPVSERDAIRSQVIDALEAQEIRRPAMKKTITAAAA
Ga0335085_1044920413300032770SoilMRRPVSERDAIRSQVIDALEAQEIRRPAMKKTITAAAAN
Ga0335082_1082505623300032782SoilMSKSDGMRMPVSGRDAVRSQVIDVLEAQIKRRPAMKKSSTAAT
Ga0335069_1000898613300032893SoilMRRPVSGRDAIRSQVIDVLEAQIKRRPAMKKVSTVV
Ga0335069_1047501933300032893SoilMRRPVSGRDAVRSQVIDVLKAQIKRRPAMKKVSTAATK
Ga0335069_1087602013300032893SoilLKTDEMRRPVSGRDAVRSQVIDVLKAQIKRRPAMKKVSTAATKQ
Ga0335076_1014846513300032955SoilMRRPVSGRDAVRSQVIDVLRGTRDKRRPAMKKVSTVSAK
Ga0326726_1007390513300033433Peat SoilMRRPVSGRDAVRSQVIDVLEAQIKRRPAMKKISTEAAQQ

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.