NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F094258

Metagenome Family F094258

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F094258
Family Type Metagenome
Number of Sequences 106
Average Sequence Length 47 residues
Representative Sequence KNNYTKNGMVEESMLNSLVTTMLAEAGIKNVAPTQLVDFSLLQQALK
Number of Associated Samples 95
Number of Associated Scaffolds 106

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 98.11 %
% of genes from short scaffolds (< 2000 bps) 89.62 %
Associated GOLD sequencing projects 89
AlphaFold2 3D model prediction Yes
3D model pTM-score0.53

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (83.019 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(12.264 % of family members)
Environment Ontology (ENVO) Unclassified
(30.189 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(46.226 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 36.00%    β-sheet: 2.67%    Coil/Unstructured: 61.33%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.53
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 106 Family Scaffolds
PF03781FGE-sulfatase 49.06
PF02776TPP_enzyme_N 19.81
PF04828GFA 2.83
PF13711DUF4160 1.89
PF13343SBP_bac_6 1.89
PF00210Ferritin 1.89
PF09084NMT1 0.94
PF02540NAD_synthase 0.94
PF04909Amidohydro_2 0.94
PF00211Guanylate_cyc 0.94
PF07687M20_dimer 0.94
PF13744HTH_37 0.94
PF00903Glyoxalase 0.94
PF03241HpaB 0.94

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 106 Family Scaffolds
COG1262Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domainPosttranslational modification, protein turnover, chaperones [O] 49.06
COG3791Uncharacterized conserved proteinFunction unknown [S] 2.83
COG0171NH3-dependent NAD+ synthetaseCoenzyme transport and metabolism [H] 0.94
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.94
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 0.94
COG2368Aromatic ring hydroxylaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.94
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.94

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms83.02 %
UnclassifiedrootN/A16.98 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000550|F24TB_10439952All Organisms → cellular organisms → Bacteria1125Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10161013Not Available537Open in IMG/M
3300000787|JGI11643J11755_11022552Not Available512Open in IMG/M
3300000955|JGI1027J12803_106632840All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium514Open in IMG/M
3300003324|soilH2_10155040All Organisms → cellular organisms → Bacteria → Proteobacteria2458Open in IMG/M
3300003998|Ga0055472_10056077All Organisms → cellular organisms → Bacteria1009Open in IMG/M
3300004268|Ga0066398_10079525All Organisms → cellular organisms → Bacteria → Acidobacteria725Open in IMG/M
3300005289|Ga0065704_10142337All Organisms → cellular organisms → Bacteria1506Open in IMG/M
3300005332|Ga0066388_104186718All Organisms → cellular organisms → Bacteria → Acidobacteria735Open in IMG/M
3300005332|Ga0066388_106145544Not Available606Open in IMG/M
3300005336|Ga0070680_101198728All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium657Open in IMG/M
3300005339|Ga0070660_100208408All Organisms → cellular organisms → Bacteria1586Open in IMG/M
3300005354|Ga0070675_100332393All Organisms → cellular organisms → Bacteria1344Open in IMG/M
3300005355|Ga0070671_100257787All Organisms → cellular organisms → Bacteria1482Open in IMG/M
3300005364|Ga0070673_101465969Not Available643Open in IMG/M
3300005458|Ga0070681_11166129Not Available692Open in IMG/M
3300005536|Ga0070697_100824658All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium821Open in IMG/M
3300005536|Ga0070697_101817606All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium545Open in IMG/M
3300005545|Ga0070695_100925962All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300005764|Ga0066903_105704692Not Available654Open in IMG/M
3300006173|Ga0070716_101723963All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium517Open in IMG/M
3300006175|Ga0070712_100226269All Organisms → cellular organisms → Bacteria1483Open in IMG/M
3300006358|Ga0068871_101888406Not Available568Open in IMG/M
3300006806|Ga0079220_12021693All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium514Open in IMG/M
3300006852|Ga0075433_10741177All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium860Open in IMG/M
3300006871|Ga0075434_101406676Not Available707Open in IMG/M
3300006914|Ga0075436_101426430Not Available525Open in IMG/M
3300006969|Ga0075419_10302927All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1078Open in IMG/M
3300006969|Ga0075419_11451538All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300009098|Ga0105245_13015582Not Available522Open in IMG/M
3300009100|Ga0075418_10325559All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1640Open in IMG/M
3300009111|Ga0115026_10930167All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium690Open in IMG/M
3300009147|Ga0114129_10188096All Organisms → cellular organisms → Bacteria2805Open in IMG/M
3300009147|Ga0114129_10521306All Organisms → cellular organisms → Bacteria1549Open in IMG/M
3300009147|Ga0114129_10688519All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1315Open in IMG/M
3300009147|Ga0114129_12431594All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium627Open in IMG/M
3300009162|Ga0075423_11429264All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium741Open in IMG/M
3300009174|Ga0105241_10365959Not Available1256Open in IMG/M
3300009815|Ga0105070_1109307All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium550Open in IMG/M
3300010046|Ga0126384_10248709All Organisms → cellular organisms → Bacteria → Acidobacteria1436Open in IMG/M
3300010047|Ga0126382_12366289All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria515Open in IMG/M
3300010360|Ga0126372_11515290All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium707Open in IMG/M
3300010361|Ga0126378_12571118All Organisms → cellular organisms → Bacteria → Acidobacteria581Open in IMG/M
3300010362|Ga0126377_11988971Not Available657Open in IMG/M
3300010396|Ga0134126_10211356All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2315Open in IMG/M
3300010397|Ga0134124_10574394Not Available1101Open in IMG/M
3300010399|Ga0134127_11317523All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium791Open in IMG/M
3300011435|Ga0137426_1055974All Organisms → cellular organisms → Bacteria1044Open in IMG/M
3300011441|Ga0137452_1112443All Organisms → cellular organisms → Bacteria903Open in IMG/M
3300011445|Ga0137427_10028464All Organisms → cellular organisms → Bacteria2196Open in IMG/M
3300012173|Ga0137327_1116847All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium591Open in IMG/M
3300012493|Ga0157355_1047811All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium500Open in IMG/M
3300012501|Ga0157351_1029128All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium633Open in IMG/M
3300012532|Ga0137373_11218424All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium530Open in IMG/M
3300012582|Ga0137358_10766082All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium643Open in IMG/M
3300012908|Ga0157286_10052705All Organisms → cellular organisms → Bacteria1050Open in IMG/M
3300012922|Ga0137394_10468443All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1071Open in IMG/M
3300012922|Ga0137394_11387380All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300012948|Ga0126375_11977175All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium514Open in IMG/M
3300014265|Ga0075314_1130044Not Available569Open in IMG/M
3300014300|Ga0075321_1064582All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300014325|Ga0163163_13157145Not Available514Open in IMG/M
3300014877|Ga0180074_1067052All Organisms → cellular organisms → Bacteria780Open in IMG/M
3300014969|Ga0157376_10076969All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2852Open in IMG/M
3300015241|Ga0137418_10228525All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1592Open in IMG/M
3300015371|Ga0132258_11665032All Organisms → cellular organisms → Bacteria1610Open in IMG/M
3300015374|Ga0132255_103481367All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium670Open in IMG/M
3300015374|Ga0132255_104323502All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium602Open in IMG/M
3300018075|Ga0184632_10336795All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium649Open in IMG/M
3300018076|Ga0184609_10429515All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium610Open in IMG/M
3300018077|Ga0184633_10055617All Organisms → cellular organisms → Bacteria2017Open in IMG/M
3300018082|Ga0184639_10015244All Organisms → cellular organisms → Bacteria3767Open in IMG/M
3300018089|Ga0187774_10504844All Organisms → cellular organisms → Bacteria762Open in IMG/M
3300018476|Ga0190274_12333218All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium632Open in IMG/M
3300021051|Ga0206224_1013608All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium921Open in IMG/M
3300021090|Ga0210377_10674084All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300021560|Ga0126371_10198994All Organisms → cellular organisms → Bacteria2098Open in IMG/M
3300022694|Ga0222623_10178995All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium824Open in IMG/M
3300025915|Ga0207693_10232029All Organisms → cellular organisms → Bacteria1449Open in IMG/M
3300025917|Ga0207660_11091740All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium650Open in IMG/M
3300025920|Ga0207649_10640746All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium820Open in IMG/M
3300025930|Ga0207701_10937603All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium724Open in IMG/M
3300025931|Ga0207644_10541178All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium963Open in IMG/M
3300025938|Ga0207704_11045704All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium692Open in IMG/M
3300025960|Ga0207651_10910356All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium783Open in IMG/M
3300025986|Ga0207658_11413831All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium636Open in IMG/M
3300026325|Ga0209152_10254429All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium653Open in IMG/M
3300026492|Ga0256802_1028607All Organisms → cellular organisms → Bacteria → Proteobacteria716Open in IMG/M
3300027765|Ga0209073_10495053All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium514Open in IMG/M
3300027840|Ga0209683_10017512All Organisms → cellular organisms → Bacteria2945Open in IMG/M
3300027873|Ga0209814_10192446All Organisms → cellular organisms → Bacteria880Open in IMG/M
3300027909|Ga0209382_11814653All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium593Open in IMG/M
3300031731|Ga0307405_10354476All Organisms → cellular organisms → Bacteria → Proteobacteria1133Open in IMG/M
3300031753|Ga0307477_10454374All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium874Open in IMG/M
3300031854|Ga0310904_10095222All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1621Open in IMG/M
3300031854|Ga0310904_11189316All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300031908|Ga0310900_11020830Not Available681Open in IMG/M
3300031912|Ga0306921_10327253All Organisms → cellular organisms → Bacteria1793Open in IMG/M
3300031954|Ga0306926_10301050All Organisms → cellular organisms → Bacteria1985Open in IMG/M
3300032017|Ga0310899_10350706Not Available697Open in IMG/M
3300032205|Ga0307472_100046609All Organisms → cellular organisms → Bacteria2667Open in IMG/M
3300032205|Ga0307472_100396596All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1152Open in IMG/M
3300032205|Ga0307472_101873465All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium597Open in IMG/M
3300032211|Ga0310896_10374178Not Available755Open in IMG/M
3300034115|Ga0364945_0082833All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium926Open in IMG/M
3300034148|Ga0364927_0003349All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2926Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere12.26%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.60%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.66%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil4.72%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere4.72%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.77%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.77%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.77%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.83%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.83%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.89%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil1.89%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.89%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.89%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.89%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.89%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.94%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.94%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.94%
SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment0.94%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.94%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.94%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.94%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.94%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.94%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.94%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.94%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.94%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment0.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.94%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.94%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.94%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.94%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.94%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000597Forest soil microbial communities from Amazon forest - 2010 replicate II A1EnvironmentalOpen in IMG/M
3300000787Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300003324Sugarcane bulk soil Sample H2EnvironmentalOpen in IMG/M
3300003998Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2EnvironmentalOpen in IMG/M
3300004268Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBioEnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009111Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009815Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300011435Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2EnvironmentalOpen in IMG/M
3300011441Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2EnvironmentalOpen in IMG/M
3300011445Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2EnvironmentalOpen in IMG/M
3300012173Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT517_2EnvironmentalOpen in IMG/M
3300012493Unplanted soil (control) microbial communities from North Carolina - M.Soil.10.yng.090610EnvironmentalOpen in IMG/M
3300012501Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.170610EnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300014265Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D2EnvironmentalOpen in IMG/M
3300014300Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D1EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014877Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10DEnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300021051Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos A1EnvironmentalOpen in IMG/M
3300021090Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redoEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300026492Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 CS5EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027840Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032017Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300034115Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17EnvironmentalOpen in IMG/M
3300034148Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F24TB_1043995213300000550SoilDIYQMARNNYTTNGMVDEPTLNSLVTTMLAEAGIKGVTPSQLTDFSLLHQALK*
AF_2010_repII_A1DRAFT_1016101323300000597Forest SoilKNGMVEESMLNSLVTAMLAEAGIKNISPSQLVDFSLLQQVLK*
JGI11643J11755_1102255223300000787SoilMAADIYQMAINNYTRNGMVEEATMNSLVTSMLAEAGIKGVAPSQLTDFTLLQQALK*
JGI1027J12803_10663284013300000955SoilYQMAKNNYTKNGMVEESMLNSLVTTMLAEAGIKNVAPTQLVDFTLTQQVLK*
soilH2_1015504013300003324Sugarcane Root And Bulk SoilMAKNNYTKNGMMDEATMDPLIATMLAEAGIKNVAPSQLVDFTLLREVLR*
Ga0055472_1005607733300003998Natural And Restored WetlandsIYQMARNNYTKNGTVEEATMNSLVSAMLAEAGIKNVAPSQLVDFALLQQVLK*
Ga0066398_1007952523300004268Tropical Forest SoilMAADIYQMAKNNYTKNGMVEESMLNSLVTTMLAEAGIKNVTPSQLVDFSLLQQALK*
Ga0065704_1014233713300005289Switchgrass RhizosphereNYTKTGMVDEPTLNSLVTTMLAEAGIKNAAPSQLVDFSLLQQVLK*
Ga0066388_10418671823300005332Tropical Forest SoilMVEESMLNSLVTTMLAEAGIKNVTPSQLVDFSLLQQVLK*
Ga0066388_10614554423300005332Tropical Forest SoilNGMVEESMLNSLVTTMLAEAGIKGVNVSQLTDYSLLHQVLK*
Ga0070680_10119872813300005336Corn RhizosphereEMAADIYQMAKNNYTKNGMVEESMLNSLVTTMLAEAGNVAPTQLVDFTLLQQVLK*
Ga0070660_10020840833300005339Corn RhizosphereGMVDEPTLNSLVGAMLAEAGIKNVAPTQLVDFSLLQQTLK*
Ga0070675_10033239313300005354Miscanthus RhizosphereTKNGMVDEPTLNSLVGAMLAEAGIKNVAPTQLVDFSLLQQTLK*
Ga0070671_10025778713300005355Switchgrass RhizosphereKNNYTKTGMVDEPTLNLLVTTMLAEAGIKNAAPSQLVDFSLLQQVLK*
Ga0070673_10146596923300005364Switchgrass RhizosphereDIYQMAKNNYTKTGMVDEPTLNSLVTTMLAEAGIKNAAPSQLVDFSLLQQVLK*
Ga0070681_1116612913300005458Corn RhizosphereDREMAADIYQMAKNNYTKNGMVDEPTLNSLVTTMLAEAGIKNAAPSQLVDFSLLQQVLK*
Ga0070697_10082465823300005536Corn, Switchgrass And Miscanthus RhizosphereDIYQMAINNYTRNGMVEDSMLNSLVTSMLAEAGIKGVAASQLTDFTLLQQVLK*
Ga0070697_10181760613300005536Corn, Switchgrass And Miscanthus RhizosphereMVEESMLNSLVTTMLAEAGIKNVAPTQLVDFTLLQQALKQER*
Ga0070695_10092596213300005545Corn, Switchgrass And Miscanthus RhizosphereKNNYTKNGMMDEATVDPLVAPMLAEAGIKNVAPSQLVDFTLLREVVK*
Ga0066903_10570469223300005764Tropical Forest SoilIYQMAKNNYTKNGMVEESMLNSLVTTMLAEAGIKNVTPSQLVDFSLLQQALK*
Ga0070716_10172396313300006173Corn, Switchgrass And Miscanthus RhizosphereREMAADIYQMAKNNYTKNGMVEESMLNSLVTTMLAEAGIKNVAPTQLVDFTLLQQALKQER*
Ga0070712_10022626913300006175Corn, Switchgrass And Miscanthus RhizosphereEMAADIYQMAKNNYTKNGMVDEPTLNSLVTTMLAEAGIKNAAPSQLVDFSLLQQVLK*
Ga0068871_10188840613300006358Miscanthus RhizosphereKQLHEMAKNNYTKTGMVDEPTFNLLVTTMLAEAGIKNAAPSQLVDFSLLQQVLK*
Ga0079220_1202169323300006806Agricultural SoilMVDEPTLNSLVGTMLAEAGIKNVPPSQLVDFTLLQQALK*
Ga0075433_1074117713300006852Populus RhizosphereNGMVEESTLNSLVTTMLAEAGIKNVTPSQLVDFSLLPQALK*
Ga0075434_10140667613300006871Populus RhizosphereIYQMARNNYTKNGMVEESTLNSLVTTMLAEAGIKNVTPSQLTDFSLLNQALK*
Ga0075436_10142643013300006914Populus RhizosphereDREMAADIYQMARNNYTKNGMVEESTLNSLVTAMLAEAGIKNVSPSQLVDFSLLQQVLK*
Ga0075419_1030292733300006969Populus RhizosphereIYQMAINNYTRNGMVEESMLNSLVTTMLAEAGIKGVAPSQLTDFTLLQQALK*
Ga0075419_1145153823300006969Populus RhizosphereDIYQMAKNNYTKNGMVDEPTLNSLVGTMLAEAGIKNVAPSQLVDFTLLQQALK*
Ga0105245_1301558223300009098Miscanthus RhizospherePTLNSLVTTMLAEAGIKNAAPSQLVDFSLLQQVLK*
Ga0075418_1032555913300009100Populus RhizosphereNYTKNGMVEESTLNSLVTTMLAEAGIKNVTPSQLVDFSLLPQALK*
Ga0115026_1093016723300009111WetlandRNGMVEESMLNSLVTTMLAEAGIKGVAPSQLTDFTLLQQVLK*
Ga0114129_1018809613300009147Populus RhizosphereQMAKNNYTKNGMVDEPTLNSLVGTMLAEAGIKNVAPSQLVDFTLLQQVLK*
Ga0114129_1052130633300009147Populus RhizosphereAADIYQMARNNYTKNGMVEESTLNSLVTTMLAEAGIKNVTPSQLVDFSLLQQALK*
Ga0114129_1068851913300009147Populus RhizosphereIYQMARNNYTKNGMVEESTLNSLVTTMLAEAGIKNVTPSQLVDFSLLQQALK*
Ga0114129_1243159423300009147Populus RhizosphereEESMLNSLVTTMLAEAGIKNVAPTQLVDFTLLQQALKQER*
Ga0075423_1142926413300009162Populus RhizosphereKNNYTKNGMVEESMLNSLVTTMLAEAGIKNVAPTQLVDFSLLQQALK*
Ga0105241_1036595913300009174Corn RhizosphereYQMAKNNYTKTGMVDEPTLNLLVTTMLAEAGIKNAAPSQLVDFSLLQQVLK*
Ga0105070_110930713300009815Groundwater SandNGMVDEPTLNSLVTTMLAEAGIKAVTPSQLTDFSLLHQALK*
Ga0126384_1024870913300010046Tropical Forest SoilIDREMAADIYQMAKNNYTKNGMVEESMLNSLVTTMLAEAGIKNVTPSQLVDFSLLQQALK
Ga0126382_1236628913300010047Tropical Forest SoilKNGMVEESTLNLLETTMLAEAGIKNVTPSQLVDFSLLQQALK*
Ga0126372_1151529013300010360Tropical Forest SoilMVDEPTLNALVTAMLAEAGIKNVAPSQLVDFTLLQQALK*
Ga0126378_1257111813300010361Tropical Forest SoilQMAKNNYTKNGMVEESTLNSLVTTMLAEAGIKNVTPSQLVDFFLLQQTLK*
Ga0126377_1198897113300010362Tropical Forest SoilTLNSLVTTMLAEAGIKGITPSQLVDFSLLQQALK*
Ga0134126_1021135633300010396Terrestrial SoilDIYQMAKDNYTKNGMVDEPTLNSLVGAMLAEAGIKNVAPTQLVDFSLLQQTLK*
Ga0134124_1057439413300010397Terrestrial SoilIYQMAKNNYTKTGMVDEPTLNSLVTTMLAEAGIKNAAPSQLVDFSLLQQVLK*
Ga0134127_1131752313300010399Terrestrial SoilDNYTKNGMVDEPTLNSLVGAMLAEAGIKNVAPTQLVDFSLLQQALK*
Ga0137426_105597433300011435SoilAINNYTRNGMVEESMLNSLVTTMLAEAGIKGVAPSQLTDFTLLQQALK*
Ga0137452_111244333300011441SoilAINNYTRNGMVEESMLNSLVTAMLAEAGIKGVAPSQLTDFTLLQQALK*
Ga0137427_1002846433300011445SoilATMNSLVTAMLAEAGIKNVPPSQLVDFTLLQQALK*
Ga0137327_111684713300012173SoilINSYTKNGMVEESMLNALVTSMLAEAGIKGVNVSQLTDFTLLQQVLK*
Ga0157355_104781113300012493Unplanted SoilIYQMAKNNYTKNGLVEESMLNSLVTTMLAEAGIKNVAPTQLVDFTLLQQVLK*
Ga0157351_102912813300012501Unplanted SoilEESMLNSLVTTMLAEAGIKNVAPTQLVDFSLLQQALK*
Ga0137373_1121842413300012532Vadose Zone SoilPTLNSLVTTMLAEAGIKNVNVSQLVDFSLLQQVLK*
Ga0137358_1076608213300012582Vadose Zone SoilYQMAKNNYTKNGIVEEPMLSSLVTTMLAEAGIKNVAPSQLVDFSLLQQALK*
Ga0157286_1005270513300012908SoilKDNYTKNGMVDEPTLNSLVGAMLAEAGIKNVAPTQLVDFSLLQQTLK*
Ga0137394_1046844333300012922Vadose Zone SoilAADIYQMAKNNYTKNGMVEESMLNSLVTTMLAEAGIKNVAPTQLVDFTLLQQVLK*
Ga0137394_1138738023300012922Vadose Zone SoilAADIYQMAKNNYTKNGMVEESMLNSLVTTMLAEAGIKNVAPTQLVDFSLLQQALK*
Ga0126375_1197717523300012948Tropical Forest SoilMAVNNYTKNGMIEEANLNPLVTTMLAEAGIKNVVPSQLVDFTLLQQALK*
Ga0075314_113004413300014265Natural And Restored WetlandsMAADIYQMARNNYTKNGTVEEATMNSLVSAMLAEAGIKNVAPSQLVDFTLLQQVLK*
Ga0075321_106458213300014300Natural And Restored WetlandsMSKNNFTKDGMVDETMLNDLVKIMLAEAGIKNVEPTHLVDFSLLQQVLK*
Ga0163163_1315714513300014325Switchgrass RhizosphereNGMMDEATMDPLVATMLAEAGIKNVAPSQLVDFTLLREVLR*
Ga0180074_106705213300014877SoilTLNTLVTSMLAEAGIKNVVPSQLTDFSLLQQALR*
Ga0157376_1007696943300014969Miscanthus RhizosphereGMVDEPTLNSLVGAMLAEAGIKNVAPTQLVDFSLLQQALK*
Ga0137418_1022852533300015241Vadose Zone SoilYTKNGVVEESMLNSLVTTMLAEAGIKNVAPTQLVDFTLLQQALK*
Ga0132258_1166503213300015371Arabidopsis RhizosphereDIYQMAKNNYTKNGMVEESMLNSLVTTMLAEAGIKNVAPTQLVDFTLLQQVLK*
Ga0132255_10348136713300015374Arabidopsis RhizosphereEESMLNSLVTTMLAEAGIKNVAPTQLVDFTLLQQALK*
Ga0132255_10432350213300015374Arabidopsis RhizosphereMAKNNYTKNGMVEESMLNSLVTTMLAEAGIKNVAPTQLVDFTLLQQVLK*
Ga0184632_1033679513300018075Groundwater SedimentDREMAADIYQMARNNYTKNGMVEESMLNSLVTAMLAEAGIKGITPSQLVDFSLLQQALK
Ga0184609_1042951513300018076Groundwater SedimentGMVEESMLNSLVTTMLAEAGIKNVVPTQLVDFSLLQQVLR
Ga0184633_1005561753300018077Groundwater SedimentDREMAAEIYQMAKNNYTKNGMVEESTLTTLVTTMLAEAGIKNVNVSQLVDFSLLQQALK
Ga0184639_1001524413300018082Groundwater SedimentEIYQMAKNNYTKNGMVEESTLTTLVTTMLAEAGIKNVAVPQLVDFSLLHQVLK
Ga0187774_1050484423300018089Tropical PeatlandMAADIYQMAVNNYTKNGMVEESTLNSLVTAMLAEAGIKGANISQLTDFALLQQVLK
Ga0190274_1233321813300018476SoilSMLNSLVTTMLAEAGIKGVAPSQLTDFTLLQQALK
Ga0206224_101360813300021051Deep Subsurface SedimentQMAINSYTKNGMVEESMLNSLVTTMLAEAGIKGVAPSQLTDFTLLQQALK
Ga0210377_1067408423300021090Groundwater SedimentVEEAMLNSLVTTMLAEAGIKNVAPTQLVDFTLLQQALK
Ga0126371_1019899413300021560Tropical Forest SoilNNYTKNGMVDEPTLNALVTAMLAEAGIKNVAPLQLVDFTLLQKALK
Ga0222623_1017899523300022694Groundwater SedimentNYTKNGMVEESMLNSLVTTMLAEAGIKGITVSQLVDFSLLQQALK
Ga0207693_1023202923300025915Corn, Switchgrass And Miscanthus RhizosphereGMVDEPTLNSLVTTMLAEAGIKNAAPSQLVDFSLLQQVLK
Ga0207660_1109174013300025917Corn RhizosphereYQMAKNNYTKNGMVEESMLNSLVTTMLAEAGIKNVAPTQLVDFTLLQQVLK
Ga0207649_1064074613300025920Corn RhizosphereTKNGMVDEPTLNSLVGAMLAEAGIKNVAPTQLVDFSLLQQALK
Ga0207701_1093760323300025930Corn, Switchgrass And Miscanthus RhizosphereNGIVEESMLNSLVTTMLAEAGIKNVAPTQLVDFTLLQQVLK
Ga0207644_1054117813300025931Switchgrass RhizosphereMAKDNYTKNGMVDEPTLNSLVGAMLAEAGIKNVAPTQLVDFSLLQQALK
Ga0207704_1104570413300025938Miscanthus RhizosphereAADIYQMAKDNYTKNGMVDEPTLNSLVGAMLAEAGIKNVAPTQLVDFSLLQQTLK
Ga0207651_1091035623300025960Switchgrass RhizosphereMVDEPTLNSLVGAMLAEAGIKNVAPTQLVDFSLLQQALK
Ga0207658_1141383123300025986Switchgrass RhizosphereDIYQMAKDNYTKNGMVDEPTLNSLVGAMLAEAGIKNVAPTQLVDFSLLQQTLK
Ga0209152_1025442923300026325SoilLDESTLNALVTSMLAEAGITNVNVSQLVDFSLLHQALK
Ga0256802_102860713300026492SedimentGMVEEAMLNSLVTAMLVDAGIKGVTPTQLTDFTLLQQALK
Ga0209073_1049505313300027765Agricultural SoilMVDEPTLNSLVGTMLAEAGIKNVPPSQLVDFTLLQQALK
Ga0209683_1001751213300027840Wetland SedimentLAINNYTRNGMVEESMLSSLVTNMLAEAGIKGVNVSQLVDFTLLQQALK
Ga0209814_1019244613300027873Populus RhizosphereVDEPTLNSLVGTMLAEAGIKNVAPSQLVDFTLLQQALK
Ga0209382_1181465323300027909Populus RhizosphereNNYTRNGMVEESMLNSLVTTMLAEAGINGVAPSQLTDFTLLQQALK
Ga0307405_1035447613300031731RhizosphereGMVEEAMLNSLVTNMLAEAGIKGVAPSQLTDFTLLQQALK
Ga0307477_1045437423300031753Hardwood Forest SoilESMLNSLVTSMLAEAGIKNVAPSQLVDFSLLQQTLK
Ga0310904_1009522223300031854SoilIYQMAKNNYTKNGLVEESMLDSLVTAMLAEAGIKGVNVSQLTDFSLLHQALK
Ga0310904_1118931613300031854SoilDREMAAEIYQMAINNYTRNGMVEESMLNSLVTTMLAEAGIKGVAPSQLTDFTLLQQALK
Ga0310900_1102083023300031908SoilNGMVEEAMLNSLVTNMLAEAGIKGVAPSQLTDFTLLQQALK
Ga0306921_1032725333300031912SoilDREMAADIYQMAKDNYTKNGMVDEPTLNSLVTAMLAEAGIKNVAPSQLVDFTLLQQALK
Ga0306926_1030105033300031954SoilGMVDEPTLNALVTAMLAEAGIKNMAPSQLVDFTLLQQALK
Ga0310899_1035070623300032017SoilEEAMLNSLVTNMLAEVGIKGVAPSQLTDFTLLQQALK
Ga0307472_10004660933300032205Hardwood Forest SoilNGMVEESMLNSLVTTMLAEAGIKNVAPTQLVDFTLLQQALK
Ga0307472_10039659623300032205Hardwood Forest SoilDIYQMAVNNYTKNGMVEEPMLNSLVTSMLAEAGIKNVAPSQLVDFTLLQQSLK
Ga0307472_10187346523300032205Hardwood Forest SoilAVNNYTKNGMVEEPMLNSLVTSMLAEAGIKNVTPSQLVDFTLLQQSLR
Ga0310896_1037417813300032211SoilLVEESMLDSLVTAMLAEAGIKGVNVSQLTDFSLLHQALK
Ga0364945_0082833_14_1633300034115SedimentMARNNYTKNGMVEESMLNSLVTAMLAEAGIKGVNVSQLTDFSLLQQALK
Ga0364927_0003349_7_1263300034148SedimentMVDEPTLNTLVTSMLAEAGIKNITVSQLVDFSLLQQALR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.