Basic Information | |
---|---|
Family ID | F094260 |
Family Type | Metagenome |
Number of Sequences | 106 |
Average Sequence Length | 41 residues |
Representative Sequence | MVNWPEMLRHAEDWANGFWTGAATASVIGIVAAAAALISRAI |
Number of Associated Samples | 57 |
Number of Associated Scaffolds | 106 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 74.53 % |
% of genes near scaffold ends (potentially truncated) | 23.58 % |
% of genes from short scaffolds (< 2000 bps) | 92.45 % |
Associated GOLD sequencing projects | 55 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.60 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (64.151 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (43.396 % of family members) |
Environment Ontology (ENVO) | Unclassified (54.717 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (69.811 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.29% β-sheet: 0.00% Coil/Unstructured: 45.71% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.60 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 106 Family Scaffolds |
---|---|---|
PF00202 | Aminotran_3 | 2.83 |
PF04134 | DCC1-like | 1.89 |
PF04828 | GFA | 1.89 |
PF05721 | PhyH | 1.89 |
PF02771 | Acyl-CoA_dh_N | 0.94 |
PF00313 | CSD | 0.94 |
PF12697 | Abhydrolase_6 | 0.94 |
PF03729 | DUF308 | 0.94 |
PF01266 | DAO | 0.94 |
PF02719 | Polysacc_synt_2 | 0.94 |
PF04909 | Amidohydro_2 | 0.94 |
PF00083 | Sugar_tr | 0.94 |
PF00211 | Guanylate_cyc | 0.94 |
PF00903 | Glyoxalase | 0.94 |
PF00156 | Pribosyltran | 0.94 |
COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
---|---|---|---|
COG0451 | Nucleoside-diphosphate-sugar epimerase | Cell wall/membrane/envelope biogenesis [M] | 1.89 |
COG0702 | Uncharacterized conserved protein YbjT, contains NAD(P)-binding and DUF2867 domains | General function prediction only [R] | 1.89 |
COG1086 | NDP-sugar epimerase, includes UDP-GlcNAc-inverting 4,6-dehydratase FlaA1 and capsular polysaccharide biosynthesis protein EpsC | Cell wall/membrane/envelope biogenesis [M] | 1.89 |
COG3011 | Predicted thiol-disulfide oxidoreductase YuxK, DCC family | General function prediction only [R] | 1.89 |
COG3791 | Uncharacterized conserved protein | Function unknown [S] | 1.89 |
COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.89 |
COG1087 | UDP-glucose 4-epimerase | Cell wall/membrane/envelope biogenesis [M] | 0.94 |
COG1088 | dTDP-D-glucose 4,6-dehydratase | Cell wall/membrane/envelope biogenesis [M] | 0.94 |
COG1089 | GDP-D-mannose dehydratase | Cell wall/membrane/envelope biogenesis [M] | 0.94 |
COG1091 | dTDP-4-dehydrorhamnose reductase | Cell wall/membrane/envelope biogenesis [M] | 0.94 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.94 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.94 |
COG3247 | Acid resistance membrane protein HdeD, DUF308 family | General function prediction only [R] | 0.94 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 64.15 % |
All Organisms | root | All Organisms | 35.85 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300003505|JGIcombinedJ51221_10241436 | Not Available | 734 | Open in IMG/M |
3300004633|Ga0066395_10776343 | Not Available | 574 | Open in IMG/M |
3300005332|Ga0066388_102964825 | Not Available | 867 | Open in IMG/M |
3300005332|Ga0066388_103003442 | Not Available | 862 | Open in IMG/M |
3300005434|Ga0070709_10712692 | Not Available | 781 | Open in IMG/M |
3300005602|Ga0070762_11125159 | Not Available | 542 | Open in IMG/M |
3300005764|Ga0066903_100854506 | Not Available | 1638 | Open in IMG/M |
3300005764|Ga0066903_102614822 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
3300005764|Ga0066903_105048648 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
3300005764|Ga0066903_106668762 | Not Available | 601 | Open in IMG/M |
3300005764|Ga0066903_107984727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 543 | Open in IMG/M |
3300006173|Ga0070716_101581021 | Not Available | 538 | Open in IMG/M |
3300006755|Ga0079222_10817247 | Not Available | 764 | Open in IMG/M |
3300006806|Ga0079220_11338231 | Not Available | 603 | Open in IMG/M |
3300006904|Ga0075424_100927234 | Not Available | 929 | Open in IMG/M |
3300006954|Ga0079219_11053253 | Not Available | 683 | Open in IMG/M |
3300009792|Ga0126374_10666411 | Not Available | 778 | Open in IMG/M |
3300009792|Ga0126374_10725503 | Not Available | 750 | Open in IMG/M |
3300009792|Ga0126374_11526871 | Not Available | 549 | Open in IMG/M |
3300010043|Ga0126380_11681378 | Not Available | 570 | Open in IMG/M |
3300010046|Ga0126384_12233142 | Not Available | 527 | Open in IMG/M |
3300010047|Ga0126382_11629197 | Not Available | 599 | Open in IMG/M |
3300010048|Ga0126373_10378812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1434 | Open in IMG/M |
3300010048|Ga0126373_10867423 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
3300010048|Ga0126373_12534017 | Not Available | 572 | Open in IMG/M |
3300010048|Ga0126373_12908696 | Not Available | 534 | Open in IMG/M |
3300010361|Ga0126378_10931174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 975 | Open in IMG/M |
3300010361|Ga0126378_11362540 | Not Available | 803 | Open in IMG/M |
3300010361|Ga0126378_12063213 | Not Available | 650 | Open in IMG/M |
3300010361|Ga0126378_12349049 | Not Available | 609 | Open in IMG/M |
3300010362|Ga0126377_12260455 | Not Available | 620 | Open in IMG/M |
3300010366|Ga0126379_10171259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2052 | Open in IMG/M |
3300010376|Ga0126381_100343463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS188 | 2061 | Open in IMG/M |
3300010376|Ga0126381_100711824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → unclassified Roseomonas → Roseomonas sp. AR75 | 1437 | Open in IMG/M |
3300010376|Ga0126381_100862559 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1302 | Open in IMG/M |
3300010376|Ga0126381_100914534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1263 | Open in IMG/M |
3300010376|Ga0126381_101030585 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
3300010376|Ga0126381_101313741 | Not Available | 1045 | Open in IMG/M |
3300010376|Ga0126381_102756560 | Not Available | 702 | Open in IMG/M |
3300010376|Ga0126381_102780387 | Not Available | 699 | Open in IMG/M |
3300010376|Ga0126381_102919542 | Not Available | 680 | Open in IMG/M |
3300010376|Ga0126381_104436369 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 542 | Open in IMG/M |
3300012971|Ga0126369_10811102 | Not Available | 1019 | Open in IMG/M |
3300012971|Ga0126369_13580161 | Not Available | 509 | Open in IMG/M |
3300012971|Ga0126369_13583368 | Not Available | 509 | Open in IMG/M |
3300016294|Ga0182041_11671301 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
3300016357|Ga0182032_10844923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 776 | Open in IMG/M |
3300017974|Ga0187777_11395005 | Not Available | 517 | Open in IMG/M |
3300020580|Ga0210403_10015049 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6221 | Open in IMG/M |
3300020583|Ga0210401_10176878 | All Organisms → cellular organisms → Bacteria | 1989 | Open in IMG/M |
3300020583|Ga0210401_11045173 | Not Available | 675 | Open in IMG/M |
3300020583|Ga0210401_11316941 | Not Available | 580 | Open in IMG/M |
3300021358|Ga0213873_10034180 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1280 | Open in IMG/M |
3300021358|Ga0213873_10061578 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1017 | Open in IMG/M |
3300021444|Ga0213878_10160488 | Not Available | 935 | Open in IMG/M |
3300021560|Ga0126371_10158254 | Not Available | 2333 | Open in IMG/M |
3300021560|Ga0126371_10176042 | Not Available | 2220 | Open in IMG/M |
3300021560|Ga0126371_10499957 | Not Available | 1364 | Open in IMG/M |
3300021560|Ga0126371_10567369 | Not Available | 1284 | Open in IMG/M |
3300021560|Ga0126371_10651854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 1201 | Open in IMG/M |
3300021560|Ga0126371_10775491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1105 | Open in IMG/M |
3300021560|Ga0126371_10912737 | Not Available | 1022 | Open in IMG/M |
3300021560|Ga0126371_11224491 | Not Available | 886 | Open in IMG/M |
3300021560|Ga0126371_11304428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Moritellaceae → Moritella → unclassified Moritella → Moritella sp. Urea-trap-13 | 859 | Open in IMG/M |
3300021560|Ga0126371_11316438 | Not Available | 856 | Open in IMG/M |
3300021560|Ga0126371_11532745 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
3300021560|Ga0126371_11540472 | Not Available | 792 | Open in IMG/M |
3300021560|Ga0126371_11641156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 768 | Open in IMG/M |
3300021560|Ga0126371_11877390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 719 | Open in IMG/M |
3300021560|Ga0126371_11924895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 710 | Open in IMG/M |
3300021560|Ga0126371_11957061 | Not Available | 704 | Open in IMG/M |
3300021560|Ga0126371_13838561 | Not Available | 506 | Open in IMG/M |
3300027874|Ga0209465_10391913 | Not Available | 695 | Open in IMG/M |
3300031543|Ga0318516_10376745 | Not Available | 818 | Open in IMG/M |
3300031543|Ga0318516_10631122 | Not Available | 611 | Open in IMG/M |
3300031545|Ga0318541_10041906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2320 | Open in IMG/M |
3300031561|Ga0318528_10100206 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1520 | Open in IMG/M |
3300031573|Ga0310915_10160645 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1558 | Open in IMG/M |
3300031573|Ga0310915_10494413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 869 | Open in IMG/M |
3300031668|Ga0318542_10218681 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
3300031679|Ga0318561_10460837 | Not Available | 700 | Open in IMG/M |
3300031680|Ga0318574_10052561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2148 | Open in IMG/M |
3300031723|Ga0318493_10508371 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
3300031747|Ga0318502_10171001 | Not Available | 1247 | Open in IMG/M |
3300031747|Ga0318502_10763185 | Not Available | 585 | Open in IMG/M |
3300031770|Ga0318521_10753115 | Not Available | 593 | Open in IMG/M |
3300031777|Ga0318543_10132228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1089 | Open in IMG/M |
3300031793|Ga0318548_10440164 | Not Available | 638 | Open in IMG/M |
3300031805|Ga0318497_10502572 | Not Available | 679 | Open in IMG/M |
3300031805|Ga0318497_10681851 | Not Available | 576 | Open in IMG/M |
3300031833|Ga0310917_10006585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6125 | Open in IMG/M |
3300031890|Ga0306925_11030516 | Not Available | 837 | Open in IMG/M |
3300031896|Ga0318551_10934707 | Not Available | 507 | Open in IMG/M |
3300031910|Ga0306923_11043372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 885 | Open in IMG/M |
3300031910|Ga0306923_12237434 | Not Available | 547 | Open in IMG/M |
3300031912|Ga0306921_10364442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 1689 | Open in IMG/M |
3300031912|Ga0306921_11088945 | Not Available | 896 | Open in IMG/M |
3300031941|Ga0310912_10145174 | Not Available | 1787 | Open in IMG/M |
3300031945|Ga0310913_10943424 | Not Available | 606 | Open in IMG/M |
3300031954|Ga0306926_10456570 | Not Available | 1574 | Open in IMG/M |
3300031962|Ga0307479_10376511 | Not Available | 1404 | Open in IMG/M |
3300032089|Ga0318525_10464739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 648 | Open in IMG/M |
3300032090|Ga0318518_10538181 | Not Available | 597 | Open in IMG/M |
3300032261|Ga0306920_102434405 | Not Available | 722 | Open in IMG/M |
3300033289|Ga0310914_10907682 | Not Available | 780 | Open in IMG/M |
3300033290|Ga0318519_10883782 | Not Available | 552 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 43.40% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 27.36% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.49% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 8.49% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.83% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.89% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.89% |
Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.94% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.94% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.94% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.94% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.94% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.94% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Host-Associated | Open in IMG/M |
3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGIcombinedJ51221_102414361 | 3300003505 | Forest Soil | MINWPEMLHHAEDWANGFWAGAASASIVGIVAAAVALISHAI* |
Ga0066395_107763431 | 3300004633 | Tropical Forest Soil | MVNWPEMLRHAEDWANGFWTGAATASVIGIVAAAAALISRAV* |
Ga0066388_1029648252 | 3300005332 | Tropical Forest Soil | MVNWPEMLRHAEDWANGFWTGAATASVIGIVAAAAALISRAI* |
Ga0066388_1030034421 | 3300005332 | Tropical Forest Soil | MVNWPEMLRHAEDWANGFWTAAATASVIGIVAAAAALISRAI* |
Ga0070709_107126922 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MVNWPEMLRHAEGWANGFWTGAATASVIGIVAVAAALISHAI* |
Ga0070762_111251593 | 3300005602 | Soil | MVNWPEMLRHAEDWANGFWNGAATASVIGIVAVAAALISHAI* |
Ga0066903_1008545063 | 3300005764 | Tropical Forest Soil | MVNWPEILRHAEDWANGFWIGAATASVIGIVVAAAALISRAI* |
Ga0066903_1026148223 | 3300005764 | Tropical Forest Soil | MVNWPEMLRHAEDWANAFWTGAATASVIGIVAAAAALISRAI* |
Ga0066903_1050486481 | 3300005764 | Tropical Forest Soil | LRHAEDWTNGFWTGAATASVIGIVAASAALISHAV* |
Ga0066903_1066687621 | 3300005764 | Tropical Forest Soil | MVNWPEMLRHAEDWANRFWTAAATTSVIGIVAAAAALISRAI* |
Ga0066903_1079847271 | 3300005764 | Tropical Forest Soil | MHPEQWRLHMINWPEMLRYAEGWANGFWTGAATVSVIGIVAAAAALISGAI* |
Ga0070716_1015810212 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MVNWPEMLRHAEGWANGFWTGAATASVIGIVAVAAAL |
Ga0079222_108172471 | 3300006755 | Agricultural Soil | MELQMVKWPELLRHAEDWANGFWSGAATASVIAIVAAAAALISHAI* |
Ga0079220_113382312 | 3300006806 | Agricultural Soil | VLNWPEMLRPAEDWANGFWTGAVTTFAIGTVAVAAALLSYAI* |
Ga0075424_1009272342 | 3300006904 | Populus Rhizosphere | MVKWPELLRHAEDWANGFWSGAATASVIAIVAAAAALISHAI* |
Ga0079219_110532532 | 3300006954 | Agricultural Soil | MELQMVKWPELLRHAEDWANGFWSGAATASVITIVAAAAALISHAI* |
Ga0126374_106664111 | 3300009792 | Tropical Forest Soil | LRMVNWPEMLRHAEDWANGFWTGAATASVIGIVAAAAALISRAI* |
Ga0126374_107255031 | 3300009792 | Tropical Forest Soil | MVNWPEMLRHAEDWANAFWTGAVTASVIGIVAAAAALISRAI* |
Ga0126374_115268712 | 3300009792 | Tropical Forest Soil | MVNWPEMLRHAEDWANGFWTGAATASVIGIVATAAALISRAI* |
Ga0126380_116813781 | 3300010043 | Tropical Forest Soil | MITWPEVLVHAEDWANGFWTGAAAASIIGIVAAAVVVVRLAI* |
Ga0126384_122331421 | 3300010046 | Tropical Forest Soil | MEIAMVNWPEMLSHAEDWANGFWTGAATASVIAIVSAAATLISHAI* |
Ga0126382_116291972 | 3300010047 | Tropical Forest Soil | MLNWPEMLTDAEDWANSFWTGAATTSVIAIVAAAAALISHAI* |
Ga0126373_103788123 | 3300010048 | Tropical Forest Soil | MVNWPEMLRHAEDWANRFWTGAAIASVIGIVGAAAALISHAI* |
Ga0126373_108674233 | 3300010048 | Tropical Forest Soil | MVNWPEMLRHAEDWASGFWTGAATASVIGIVAAAA |
Ga0126373_125340172 | 3300010048 | Tropical Forest Soil | MVNWPEMLRHAEDWADCFWTVAGTASVLAIVAATAALISRAI* |
Ga0126373_129086961 | 3300010048 | Tropical Forest Soil | MVNWPEMLRHVEDWANGFWTGAGTASVLAIVAAAVALISHAI* |
Ga0126378_109311743 | 3300010361 | Tropical Forest Soil | VNWPEMLRHAEDWAYAFWPGAATASVIGIVAAAAALISRAI* |
Ga0126378_113625401 | 3300010361 | Tropical Forest Soil | MINWPEMLRHAEDWANGFWAGAVTTFAIGIVAAAAALLGHVI* |
Ga0126378_120632132 | 3300010361 | Tropical Forest Soil | MITWPEVLVHAEDWANGFWTGAAAALIIGIVAAAVVVVRLAI* |
Ga0126378_123490491 | 3300010361 | Tropical Forest Soil | MEIAMVNWPEMLRHAEDWANRFWTGTATASAIAIVAAAAALISRAI* |
Ga0126377_122604552 | 3300010362 | Tropical Forest Soil | MINWPEMLRHAEDWANAFWTGAATASVIGIVAAAAALISRAI* |
Ga0126379_101712593 | 3300010366 | Tropical Forest Soil | MVNWPEMLRHAEDWANRFWTGAAIASVVGIVGAAAALISHAI* |
Ga0126381_1003434632 | 3300010376 | Tropical Forest Soil | MVNWPEMLRHAEDWANGFWTGAATTSVIGVVAAAAALISRAI* |
Ga0126381_1007118242 | 3300010376 | Tropical Forest Soil | MVNWPEMLRHAEDWASGFWTGAAAASVIGIVAAAAALISRAI* |
Ga0126381_1008625591 | 3300010376 | Tropical Forest Soil | MVNWPEMQHAEHWANGLWTGAATASVIGIVAATAALISRAI* |
Ga0126381_1009145343 | 3300010376 | Tropical Forest Soil | MINWPEMLRHAEDWANGFWAGAVTTFAIGIVAAAAALLSHVI* |
Ga0126381_1010305851 | 3300010376 | Tropical Forest Soil | MINWPEMLRHAEDWTNGFWTGAATASVIGIVAASAALISHAV* |
Ga0126381_1013137411 | 3300010376 | Tropical Forest Soil | MLRDAENWANSFWTGAATASVIGIVAAAAALISRA |
Ga0126381_1027565601 | 3300010376 | Tropical Forest Soil | MVNWPEMLRHAEDWAKGFWTGAATASVIGIVAAAAAMIGHAI* |
Ga0126381_1027803872 | 3300010376 | Tropical Forest Soil | MITWPEVLVHAEDWANGFWTGAAAASIIGIVAAAVVVRLAI* |
Ga0126381_1029195421 | 3300010376 | Tropical Forest Soil | MVNWPEMLRHAEDWASGFWTGAATASVIAIVAGAAALISRAI* |
Ga0126381_1044363691 | 3300010376 | Tropical Forest Soil | MINWPEMLRYAEGWANGFWTGAATVSVIGIVAAAAALISGAI* |
Ga0126369_108111021 | 3300012971 | Tropical Forest Soil | MVNWPEMLRHAEDWANGFWTGAVTASVIGIVAAAAALISRAI* |
Ga0126369_135801612 | 3300012971 | Tropical Forest Soil | MVNWSEMLRHVEDWANGFWTGAGTASVLAIVTAAVALISHAI* |
Ga0126369_135833681 | 3300012971 | Tropical Forest Soil | MVNWPEMLRYAEDWANGFWTGAATASVMGIVAAAAALISHAI* |
Ga0182041_116713012 | 3300016294 | Soil | LQMINWPEMLRHAEDWTNGFWAGAVTTFAIGVVAAGAVLLSHVI |
Ga0182032_108449231 | 3300016357 | Soil | MVNWPEMLSHAEDWANGFWTGAATASVIGIVAAAAALISRAI |
Ga0187777_113950052 | 3300017974 | Tropical Peatland | MINWPETLRHAEDWANGFWAGAVTTFAIGIVAAAAALLGHVI |
Ga0210403_100150494 | 3300020580 | Soil | MVNWPEMLRHAEDWANGFWNGAATASVIGIVAVAAALISHAI |
Ga0210401_101768782 | 3300020583 | Soil | MINWPEMLHHAEDWANGFWAGAASASIVGIVAAAVALISHAI |
Ga0210401_110451732 | 3300020583 | Soil | MINWPEMLHHAEDWAAGFWAGAATTFVMGIVAAAAALLSHAI |
Ga0210401_113169411 | 3300020583 | Soil | MFNWPEMLRHAEDWASGFWTGAAAASLTGIIVAAVALFAHTI |
Ga0213873_100341801 | 3300021358 | Rhizosphere | MINWPEMLRHAEDWANGFWTGAATTFALGIIAVAAALLTHVI |
Ga0213873_100615781 | 3300021358 | Rhizosphere | MINWPEMLRYAEDWANGFWTGAVTASMIGIVAAAAALISRAI |
Ga0213878_101604881 | 3300021444 | Bulk Soil | MLLHAEDWANGFWTGAATGFAIGIVAAAAALLSHVI |
Ga0126371_101582541 | 3300021560 | Tropical Forest Soil | MLRHAEDWANGFWTGAATTPVIGVVAAAAALISRAI |
Ga0126371_101760423 | 3300021560 | Tropical Forest Soil | MINWPEMLRHAEDWANGFWAGAVTTFAIGIVAAAAALLSHVI |
Ga0126371_104999572 | 3300021560 | Tropical Forest Soil | MVNWPEMLRDAEDWANSFWTGAATASVIGIVAVAAALISHAI |
Ga0126371_105673691 | 3300021560 | Tropical Forest Soil | MVNWPEMLRHAEDWANGFWTGAATASVIGIVATAAALISRAI |
Ga0126371_106518543 | 3300021560 | Tropical Forest Soil | MVNWPEMLRHAEDWANGFWSGAATASVIGIVAAVAVLISRAI |
Ga0126371_107754913 | 3300021560 | Tropical Forest Soil | MVNWPEMLRHAEDWAKGFWTGAATASVIGIVAAAAVLISRAI |
Ga0126371_109127372 | 3300021560 | Tropical Forest Soil | MVNWPEMLTDAEDWANSFWTGAATASVIGIVAVAAALISHAI |
Ga0126371_112244912 | 3300021560 | Tropical Forest Soil | MVNWPEMLRHAEDWANGFWTGAATASVIGIVATAA |
Ga0126371_113044281 | 3300021560 | Tropical Forest Soil | DMLRHAEGWANGFWTGAATASVMGIVAAAAALISHAI |
Ga0126371_113164382 | 3300021560 | Tropical Forest Soil | MITWPEVLVHAEDWANGFWTGAAAASIIGIVAAAVVVAI |
Ga0126371_115327452 | 3300021560 | Tropical Forest Soil | MVNWPEMLRHAEDWASGFWTGAATASVIAIVAGAAALISRAI |
Ga0126371_115404721 | 3300021560 | Tropical Forest Soil | MINWPEMLRHAEDWANGFWTGAATASMIGIVAAAVALISRAI |
Ga0126371_116411561 | 3300021560 | Tropical Forest Soil | MINWPETLSHAEDWANGFWAGAVTTFAIGIVAAAAALLGHVI |
Ga0126371_118773902 | 3300021560 | Tropical Forest Soil | WRLQMVNWPEMLRHAEDWASGFWTGAATALVMGVVAAAAALISRAI |
Ga0126371_119248952 | 3300021560 | Tropical Forest Soil | MVNWPEMLRHVEDWANGFWTGAGTASVLAIVAAAVALISRAI |
Ga0126371_119570611 | 3300021560 | Tropical Forest Soil | MVNWPEMLRHAEDWANRFWTGAAIASVVGIVGAAAALISHAI |
Ga0126371_138385611 | 3300021560 | Tropical Forest Soil | MVNWPEMLRYAEDWANGFWTGAATASVMGIVAAAAALISHAI |
Ga0209465_103919131 | 3300027874 | Tropical Forest Soil | MVNWPEMLRHAEDWADCFWTVAGTASVLAIVAATAALISRAI |
Ga0318516_103767452 | 3300031543 | Soil | MVNWPEMLRHAEDWAKGFWTGAAAASVIGIVAAAAALISRTI |
Ga0318516_106311221 | 3300031543 | Soil | MVNWPEMLRHAEDWANAFWTGAATASVIGIVAAAAALISRAI |
Ga0318541_100419062 | 3300031545 | Soil | MINWPEMLRHAEDWTNGFWAGAVTTFAIGVVAAGAVLLSHVI |
Ga0318528_101002062 | 3300031561 | Soil | MITWPEVLRHAEDWANGFWTGAVTTFAIGVVAAGAVLLSHVF |
Ga0310915_101606454 | 3300031573 | Soil | MINWPEIFRNAEPWANGFWTGAAAASVVGIIGAVGVLISHAI |
Ga0310915_104944132 | 3300031573 | Soil | MVNWPEMLRHAEDWANGFWTGAATASVIGIVTAAAALISRAI |
Ga0318542_102186812 | 3300031668 | Soil | MINWPEILRNAEPWANGFWTGAAAASVVGIMGAVAVLISHAI |
Ga0318561_104608371 | 3300031679 | Soil | MVNWPEMLRHAEDWANGFWTGAATASMLGIVAAAAALISRAI |
Ga0318574_100525613 | 3300031680 | Soil | MITWPEVLRHAEDWANGFWTGAVTTFAIGVAAAGAVLLSHVF |
Ga0318493_105083711 | 3300031723 | Soil | VLRHAEDWANGFWTGAVTTFAIGVAAAGAVLLSHVF |
Ga0318502_101710014 | 3300031747 | Soil | MVNWPEMLRHAEDWAKGFWTGAAAASVIGIVAAAAALISRT |
Ga0318502_107631852 | 3300031747 | Soil | EWRLKMVNWPEMLRHAEDWAKGFWTGAAAASVIGIVAAAAALISRTI |
Ga0318521_107531152 | 3300031770 | Soil | MINWPEMLRHAEDWANGFWTGAVTTFAIGIVAAAAALLTHVI |
Ga0318543_101322283 | 3300031777 | Soil | PEVLRHAEDWANGFWTGAVTTFAIGVAAAGAVLLSHVF |
Ga0318548_104401642 | 3300031793 | Soil | LKMVNWPEMLRHAEDWAKGFWTGAAAASVIGIVAAAAALISRTI |
Ga0318497_105025721 | 3300031805 | Soil | MINWPEIFRNAEPWANGFWTGAAAASVLGIMGAVAVLISHAI |
Ga0318497_106818511 | 3300031805 | Soil | PEMLRHADDWANGFWTGAATASVIGIVAAAAALISRAI |
Ga0310917_100065855 | 3300031833 | Soil | MVNWPEMLRHAEDWAKGFWTGAAAASVIGIVAAAAALISRAI |
Ga0306925_110305161 | 3300031890 | Soil | MINWPETLRHAEDWANGFWAGAVTTFAIGIVVAAAALLSHVI |
Ga0318551_109347072 | 3300031896 | Soil | MVNWPEMLRHAEDWANGFWTAAATASVIGIVAAAA |
Ga0306923_110433722 | 3300031910 | Soil | WRLQMINWPETLRHAEDWANGFWAGAVTTFAIGIVVAAAALLSHVI |
Ga0306923_122374342 | 3300031910 | Soil | MVNWPEMLRHAEDWANGFWTGAATASVIGIVAAAAALISRAI |
Ga0306921_103644421 | 3300031912 | Soil | MINWPEIFRNAEPWANGFWTGAAAASVVGIIGAVAVLISHAI |
Ga0306921_110889451 | 3300031912 | Soil | MINWPETLRHAEDWANGFWAGAVTTFAIGIVAAAAALLSHVI |
Ga0310912_101451742 | 3300031941 | Soil | MINWPEIFRNAEPWANGFWTGAAAASVVGIMGAVAVLISHAI |
Ga0310913_109434241 | 3300031945 | Soil | PEIFRNAEPWANGFWTGAAAASVVGIMGAVAVLISHAI |
Ga0306926_104565702 | 3300031954 | Soil | MINWPEMLRHAEDWTNGFWTGAITTFAIGVAAAGAVLLSHVI |
Ga0307479_103765111 | 3300031962 | Hardwood Forest Soil | MINWPEMLHHAEDWAAGFWAGAVTTFVMGIVAAAAA |
Ga0318525_104647393 | 3300032089 | Soil | PEMLRHAEDWASGFWTGAATASVIAIVAGAAALISRAI |
Ga0318518_105381812 | 3300032090 | Soil | PKRWRLKMVNWPEMLRHAEDWAKGFWTGAAAASVIGIVAAAAALISRTI |
Ga0306920_1024344051 | 3300032261 | Soil | MVNWPEMLRHVEDWANGFWTGAGTASVLAIAAAAVALTSRVI |
Ga0310914_109076821 | 3300033289 | Soil | MINWPEIFRNAEPWANGFWTGAAAASVVGIMGAVAVLI |
Ga0318519_108837821 | 3300033290 | Soil | MINWPEIFRNAEPWANGFWTGAAAASVVGIMGAVAVL |
⦗Top⦘ |