NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F094541

Metagenome Family F094541

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F094541
Family Type Metagenome
Number of Sequences 106
Average Sequence Length 81 residues
Representative Sequence MRHKTITLCPTTYEIARKMDNFSAWIRQELMKKQATQYKAKPEIKEKYGAYCEPCDVTFLDSDPVLLQGRMPCKKCGKGTTYLGLIE
Number of Associated Samples 71
Number of Associated Scaffolds 105

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Viruses
% of genes with valid RBS motifs 11.76 %
% of genes near scaffold ends (potentially truncated) 49.06 %
% of genes from short scaffolds (< 2000 bps) 72.64 %
Associated GOLD sequencing projects 65
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group unclassified viruses (80.189 % of family members)
NCBI Taxonomy ID 12429
Taxonomy All Organisms → Viruses → unclassified viruses

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Strait → Unclassified → Seawater
(49.057 % of family members)
Environment Ontology (ENVO) Unclassified
(81.132 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(73.585 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 29.89%    β-sheet: 10.34%    Coil/Unstructured: 59.77%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.40 %
UnclassifiedrootN/A6.60 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000116|DelMOSpr2010_c10033907All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium2362Open in IMG/M
3300001450|JGI24006J15134_10025113All Organisms → Viruses → unclassified viruses → Circular genetic element sp.2684Open in IMG/M
3300004097|Ga0055584_100252696All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1800Open in IMG/M
3300004097|Ga0055584_101977993All Organisms → Viruses → unclassified viruses → Circular genetic element sp.598Open in IMG/M
3300004097|Ga0055584_102528184All Organisms → Viruses → unclassified viruses → Circular genetic element sp.518Open in IMG/M
3300005588|Ga0070728_10559530All Organisms → Viruses → unclassified viruses → Circular genetic element sp.594Open in IMG/M
3300005600|Ga0070726_10104916Not Available1485Open in IMG/M
3300006916|Ga0070750_10032164All Organisms → Viruses → unclassified viruses → Circular genetic element sp.2603Open in IMG/M
3300006919|Ga0070746_10157818All Organisms → Viruses → Predicted Viral1101Open in IMG/M
3300007863|Ga0105744_1007606All Organisms → Viruses → unclassified viruses → Circular genetic element sp.2833Open in IMG/M
3300007992|Ga0105748_10394336All Organisms → Viruses → unclassified viruses → Circular genetic element sp.597Open in IMG/M
3300007992|Ga0105748_10431786All Organisms → Viruses → unclassified viruses → Circular genetic element sp.571Open in IMG/M
3300008218|Ga0114904_1019534All Organisms → Viruses → unclassified viruses → Circular genetic element sp.2011Open in IMG/M
3300008220|Ga0114910_1117425All Organisms → Viruses → unclassified viruses → Circular genetic element sp.780Open in IMG/M
3300009136|Ga0118735_10052072All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1252Open in IMG/M
3300009412|Ga0114903_1108495All Organisms → Viruses → unclassified viruses → Circular genetic element sp.613Open in IMG/M
3300009433|Ga0115545_1227885All Organisms → Viruses → unclassified viruses → Circular genetic element sp.630Open in IMG/M
3300009593|Ga0115011_10049206All Organisms → Viruses → Predicted Viral2877Open in IMG/M
3300012953|Ga0163179_10030100All Organisms → Viruses → unclassified viruses → Circular genetic element sp.3648Open in IMG/M
3300012953|Ga0163179_10286961All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1296Open in IMG/M
3300017709|Ga0181387_1010121All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1826Open in IMG/M
3300017709|Ga0181387_1070340All Organisms → Viruses → unclassified viruses → Circular genetic element sp.704Open in IMG/M
3300017710|Ga0181403_1018326All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1491Open in IMG/M
3300017719|Ga0181390_1058039All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1118Open in IMG/M
3300017720|Ga0181383_1058345All Organisms → Viruses → Predicted Viral1036Open in IMG/M
3300017724|Ga0181388_1059989All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium913Open in IMG/M
3300017724|Ga0181388_1159043All Organisms → Viruses → unclassified viruses → Circular genetic element sp.536Open in IMG/M
3300017728|Ga0181419_1012144All Organisms → Viruses → unclassified viruses → Circular genetic element sp.2509Open in IMG/M
3300017728|Ga0181419_1062641All Organisms → Viruses → unclassified viruses → Circular genetic element sp.952Open in IMG/M
3300017729|Ga0181396_1004811All Organisms → Viruses → unclassified viruses → Circular genetic element sp.2767Open in IMG/M
3300017729|Ga0181396_1031504All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1056Open in IMG/M
3300017729|Ga0181396_1046667All Organisms → Viruses → unclassified viruses → Circular genetic element sp.862Open in IMG/M
3300017730|Ga0181417_1016013All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1898Open in IMG/M
3300017735|Ga0181431_1142224All Organisms → Viruses → unclassified viruses → Circular genetic element sp.533Open in IMG/M
3300017742|Ga0181399_1143546All Organisms → Viruses → unclassified viruses → Circular genetic element sp.576Open in IMG/M
3300017743|Ga0181402_1032816All Organisms → Viruses → Predicted Viral1442Open in IMG/M
3300017752|Ga0181400_1221878All Organisms → Viruses → unclassified viruses → Circular genetic element sp.516Open in IMG/M
3300017752|Ga0181400_1221880All Organisms → Viruses → unclassified viruses → Circular genetic element sp.516Open in IMG/M
3300017757|Ga0181420_1252210All Organisms → Viruses → unclassified viruses → Circular genetic element sp.501Open in IMG/M
3300017759|Ga0181414_1184993All Organisms → Viruses → unclassified viruses → Circular genetic element sp.540Open in IMG/M
3300017760|Ga0181408_1042762All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1223Open in IMG/M
3300017760|Ga0181408_1075431All Organisms → Viruses → unclassified viruses → Circular genetic element sp.886Open in IMG/M
3300017762|Ga0181422_1014303All Organisms → Viruses → unclassified viruses → Circular genetic element sp.2633Open in IMG/M
3300017762|Ga0181422_1032908All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1689Open in IMG/M
3300017764|Ga0181385_1011996All Organisms → Viruses → unclassified viruses → Circular genetic element sp.2788Open in IMG/M
3300017764|Ga0181385_1074691All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1045Open in IMG/M
3300017765|Ga0181413_1143396All Organisms → Viruses → unclassified viruses → Circular genetic element sp.721Open in IMG/M
3300017767|Ga0181406_1008435All Organisms → Viruses → unclassified viruses → Circular genetic element sp.3387Open in IMG/M
3300017768|Ga0187220_1173119All Organisms → Viruses → unclassified viruses → Circular genetic element sp.651Open in IMG/M
3300017769|Ga0187221_1189665All Organisms → Viruses → unclassified viruses → Circular genetic element sp.596Open in IMG/M
3300017770|Ga0187217_1018126All Organisms → Viruses → unclassified viruses → Circular genetic element sp.2535Open in IMG/M
3300017770|Ga0187217_1035395All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1762Open in IMG/M
3300017772|Ga0181430_1108931All Organisms → Viruses → unclassified viruses → Circular genetic element sp.820Open in IMG/M
3300017773|Ga0181386_1013545All Organisms → Viruses → unclassified viruses → Circular genetic element sp.2745Open in IMG/M
3300017773|Ga0181386_1137063All Organisms → Viruses → unclassified viruses → Circular genetic element sp.752Open in IMG/M
3300017776|Ga0181394_1034862All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1749Open in IMG/M
3300017776|Ga0181394_1185483All Organisms → Viruses → unclassified viruses → Circular genetic element sp.638Open in IMG/M
3300017779|Ga0181395_1085882All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1014Open in IMG/M
3300017779|Ga0181395_1247607All Organisms → Viruses → unclassified viruses → Circular genetic element sp.545Open in IMG/M
3300017781|Ga0181423_1016519All Organisms → Viruses → unclassified viruses → Circular genetic element sp.3048Open in IMG/M
3300017781|Ga0181423_1016519All Organisms → Viruses → unclassified viruses → Circular genetic element sp.3048Open in IMG/M
3300017782|Ga0181380_1018531Not Available2611Open in IMG/M
3300017782|Ga0181380_1019895All Organisms → Viruses → unclassified viruses → Circular genetic element sp.2508Open in IMG/M
3300017782|Ga0181380_1029179All Organisms → Viruses → Predicted Viral2026Open in IMG/M
3300017782|Ga0181380_1036008All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1802Open in IMG/M
3300017782|Ga0181380_1152160All Organisms → Viruses → unclassified viruses → Circular genetic element sp.787Open in IMG/M
3300017782|Ga0181380_1324249All Organisms → Viruses → unclassified viruses → Circular genetic element sp.501Open in IMG/M
3300017783|Ga0181379_1020148All Organisms → Viruses → Predicted Viral2701Open in IMG/M
3300017783|Ga0181379_1263469All Organisms → Viruses → unclassified viruses → Circular genetic element sp.592Open in IMG/M
3300017786|Ga0181424_10444040All Organisms → Viruses → unclassified viruses → Circular genetic element sp.524Open in IMG/M
3300020472|Ga0211579_10303021All Organisms → Viruses → unclassified viruses → Circular genetic element sp.913Open in IMG/M
3300021389|Ga0213868_10568967All Organisms → Viruses → unclassified viruses → Circular genetic element sp.598Open in IMG/M
(restricted) 3300022913|Ga0233404_10031096All Organisms → Viruses → Predicted Viral1211Open in IMG/M
(restricted) 3300022938|Ga0233409_10237025All Organisms → Viruses → unclassified viruses → Circular genetic element sp.624Open in IMG/M
(restricted) 3300023085|Ga0233406_10089926All Organisms → Viruses → unclassified viruses → Circular genetic element sp.521Open in IMG/M
(restricted) 3300024062|Ga0255039_10391239All Organisms → Viruses → unclassified viruses → Circular genetic element sp.600Open in IMG/M
(restricted) 3300024264|Ga0233444_10077249All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1832Open in IMG/M
3300025168|Ga0209337_1034924All Organisms → Viruses → unclassified viruses → Circular genetic element sp.2746Open in IMG/M
3300025277|Ga0208180_1079442All Organisms → Viruses → unclassified viruses → Circular genetic element sp.768Open in IMG/M
3300025293|Ga0208934_1071684All Organisms → Viruses → unclassified viruses → Circular genetic element sp.607Open in IMG/M
3300025769|Ga0208767_1105535All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium1117Open in IMG/M
3300027790|Ga0209273_10350867Not Available593Open in IMG/M
3300027820|Ga0209578_10036042All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium2590Open in IMG/M
(restricted) 3300027856|Ga0255054_10647946All Organisms → Viruses → unclassified viruses → Circular genetic element sp.510Open in IMG/M
(restricted) 3300027861|Ga0233415_10018212All Organisms → Viruses → Predicted Viral2782Open in IMG/M
(restricted) 3300027861|Ga0233415_10144146All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1076Open in IMG/M
(restricted) 3300027861|Ga0233415_10302715All Organisms → Viruses → unclassified viruses → Circular genetic element sp.754Open in IMG/M
(restricted) 3300027865|Ga0255052_10056171All Organisms → Viruses → Predicted Viral1942Open in IMG/M
(restricted) 3300027865|Ga0255052_10428420All Organisms → Viruses → unclassified viruses → Circular genetic element sp.648Open in IMG/M
(restricted) 3300027868|Ga0255053_10286557All Organisms → Viruses → unclassified viruses → Circular genetic element sp.795Open in IMG/M
(restricted) 3300027868|Ga0255053_10387979All Organisms → Viruses → unclassified viruses → Circular genetic element sp.675Open in IMG/M
(restricted) 3300027881|Ga0255055_10086217All Organisms → Viruses → unclassified viruses → Circular genetic element sp.1734Open in IMG/M
(restricted) 3300027881|Ga0255055_10329598All Organisms → Viruses → unclassified viruses → Circular genetic element sp.824Open in IMG/M
(restricted) 3300027881|Ga0255055_10481677All Organisms → Viruses → unclassified viruses → Circular genetic element sp.666Open in IMG/M
3300027906|Ga0209404_10587953All Organisms → Viruses → unclassified viruses → Circular genetic element sp.744Open in IMG/M
(restricted) 3300027996|Ga0233413_10259848All Organisms → Viruses → unclassified viruses → Circular genetic element sp.740Open in IMG/M
(restricted) 3300028045|Ga0233414_10018423All Organisms → Viruses → Predicted Viral2719Open in IMG/M
(restricted) 3300028045|Ga0233414_10232501All Organisms → Viruses → unclassified viruses → Circular genetic element sp.834Open in IMG/M
3300028132|Ga0228649_1094131All Organisms → Viruses → unclassified viruses → Circular genetic element sp.752Open in IMG/M
3300028598|Ga0265306_10028739All Organisms → Viruses → unclassified viruses → Circular genetic element sp.2698Open in IMG/M
3300028600|Ga0265303_10776401All Organisms → Viruses → unclassified viruses → Circular genetic element sp.785Open in IMG/M
3300031774|Ga0315331_11164440All Organisms → Viruses → unclassified viruses → Circular genetic element sp.515Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater49.06%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater19.81%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean4.72%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine3.77%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment3.77%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous2.83%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water2.83%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine2.83%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.89%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater1.89%
SedimentEnvironmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment1.89%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.94%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.94%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine0.94%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.94%
Marine SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment0.94%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300005588Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.1EnvironmentalOpen in IMG/M
3300005600Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1EnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300007863Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459B_0.2umEnvironmentalOpen in IMG/M
3300007992Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2umEnvironmentalOpen in IMG/M
3300008218Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s6EnvironmentalOpen in IMG/M
3300008220Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908EnvironmentalOpen in IMG/M
3300009136Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 82 cmbsfEnvironmentalOpen in IMG/M
3300009412Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s2EnvironmentalOpen in IMG/M
3300009433Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330EnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300017709Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27EnvironmentalOpen in IMG/M
3300017710Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017720Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23EnvironmentalOpen in IMG/M
3300017724Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17EnvironmentalOpen in IMG/M
3300017728Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24EnvironmentalOpen in IMG/M
3300017729Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11EnvironmentalOpen in IMG/M
3300017730Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13EnvironmentalOpen in IMG/M
3300017735Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017743Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17EnvironmentalOpen in IMG/M
3300017752Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22EnvironmentalOpen in IMG/M
3300017757Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22EnvironmentalOpen in IMG/M
3300017759Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28EnvironmentalOpen in IMG/M
3300017760Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16EnvironmentalOpen in IMG/M
3300017762Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18EnvironmentalOpen in IMG/M
3300017764Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11EnvironmentalOpen in IMG/M
3300017765Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28EnvironmentalOpen in IMG/M
3300017767Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20EnvironmentalOpen in IMG/M
3300017768Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2)EnvironmentalOpen in IMG/M
3300017769Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2)EnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017773Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24EnvironmentalOpen in IMG/M
3300017776Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23EnvironmentalOpen in IMG/M
3300017779Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300017786Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18EnvironmentalOpen in IMG/M
3300020472Marine microbial communities from Tara Oceans - TARA_B100001250 (ERX556017-ERR598995)EnvironmentalOpen in IMG/M
3300021389Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127EnvironmentalOpen in IMG/M
3300022913 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_2_MGEnvironmentalOpen in IMG/M
3300022938 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_13_MGEnvironmentalOpen in IMG/M
3300023085 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_5_MGEnvironmentalOpen in IMG/M
3300024062 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1EnvironmentalOpen in IMG/M
3300024264 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MGEnvironmentalOpen in IMG/M
3300025168Marine viral communities from the Pacific Ocean - LP-53 (SPAdes)EnvironmentalOpen in IMG/M
3300025277Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 (SPAdes)EnvironmentalOpen in IMG/M
3300025293Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s2 (SPAdes)EnvironmentalOpen in IMG/M
3300025769Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes)EnvironmentalOpen in IMG/M
3300027790Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1 (SPAdes)EnvironmentalOpen in IMG/M
3300027820Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 (SPAdes)EnvironmentalOpen in IMG/M
3300027856 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_23EnvironmentalOpen in IMG/M
3300027861 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MGEnvironmentalOpen in IMG/M
3300027865 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_21EnvironmentalOpen in IMG/M
3300027868 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_22EnvironmentalOpen in IMG/M
3300027881 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_27EnvironmentalOpen in IMG/M
3300027906Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027996 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MGEnvironmentalOpen in IMG/M
3300028045 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MGEnvironmentalOpen in IMG/M
3300028132Seawater microbial communities from Monterey Bay, California, United States - 61DEnvironmentalOpen in IMG/M
3300028598Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160420 (Illumina Assembly)EnvironmentalOpen in IMG/M
3300028600Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly)EnvironmentalOpen in IMG/M
3300031774Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSpr2010_1003390733300000116MarineMRHKTITLCPTTYEIARKMDNFSAFVRQELMKKQATQYKAKPDVVAKYGAYCNPCDLTHLHTDPNMLKGSMPCQECGKATVYVGLIE*
JGI24006J15134_1002511363300001450MarineMRNKMITLCPTTYEIASNMDNFSGWIRQELMKKQATQYKAKPEIDPKYGAYCSPCDLTHLHTDPSMLQGSMPCQQCGKATVYVGLIE*
Ga0055584_10025269613300004097Pelagic MarineEIARKMDNFSAWIRQELMKKQATQYKAKPEINEKYQAYCNPCDLSYLNNDPDMIKGMPCKECGKKTFYLGLIE*
Ga0055584_10197799333300004097Pelagic MarineDNFSAWIRQELMKKQATQYKTKPEIKEKYGAYCEPCDVTFLDSDPSLLQGRMPCKKCGKGTSYLGLIE*
Ga0055584_10252818423300004097Pelagic MarinePTTYEIARKMDNFSAWIRQELMKKQATQYKAKPEIKEKYGAYCEPCDVTFLDSDPSLLQGRMPCKKCGKGTSYLGLIE*
Ga0070728_1055953023300005588Marine SedimentMVFFYLIHTYTSYKIISLEGNMRHKTITLCPTTYEIARKMDNFSAFVRQELMKKQATQYKAKPDVVAKYGAYCNPCDLTHLHTDPNMLKGSMPCQECGKATVYVGLIE*
Ga0070726_1010491613300005600Marine SedimentPTTYEIARKMDNFSAFVRQELMKKQATQYKAKPDVVAKYGAYCNPCDLTHLHTDPNMLKGSMPCQECGKATVYVGLIE*
Ga0070750_1003216413300006916AqueousMRHKTITLCPTTYEIARKMDNFSGWIRQELMKKQATQYKAKPEIEEKYQAYCNPCDISYLNTDPDMIKGMPCKECGKKTFF
Ga0070746_1015781833300006919AqueousMRHKTITLCPTTYEIARKMDNFSGWIRQELMKKQATQYKAKPEIEEKYQAYCNPCDISYLNTDPDMIKGMPCKECGKKTFFLGLVE*
Ga0105744_100760643300007863Estuary WaterMRHKTITLCPTTYEIARKMDNFSAWIRQELMKKQATQYKAKPEIKEKYGAYCEPCDVTFLDSDPVLLQGRMPCKKCGKGTTYLGLID*
Ga0105748_1039433613300007992Estuary WaterSAWIRQELMKKQATQYKAKPEIKEKYGAYCEPCDVTFLDSDPVLLQGRMPCKKCGKGTTYLGLIE*
Ga0105748_1043178613300007992Estuary WaterIARKMDNFSAWIRQELMKKQATQYKAKPEIKEKYGAYCEPCDVTFLDSDPVLLQGRMPCKKCGKGTTYLGLIE*
Ga0114904_101953443300008218Deep OceanMRHKTITLCPTTYEIARKMDNFSAWIRQELMKKQATQYKAKPEIKEKYAAYCNPCDLTHLNTNPDLLKGSMPCHECGKATVYLGLIE*
Ga0114910_111742533300008220Deep OceanMDNFSAWIRQELMKKQATQYKAKPEIKEKYAAYCNPCDLTHLNTNPDLLKGSMPCHECGKATVYLGLIE*
Ga0118735_1005207233300009136Marine SedimentMDNFSGWIRQELMKKQATQYKAKPETEERYQAFCNPCDLSYLDTDPDMLKGLPCKECGKKTFYLGLIE*
Ga0114903_110849513300009412Deep OceanTTYEIARKMDNFSAWIRQELMKKQATQYKAKPEIKEKYAAYCNPCDLTHLNTNPDLLKGSMPCHECGKATVYLGLIE*
Ga0115545_122788513300009433Pelagic MarineMRHKTITLCPTTYEIARKMDNFSAWIRQELMKKQATQYKAKPEIKEKYGAYCEPCDVTFLDSDPSLLQGRMPCKKCGKGTSYLGLIE*
Ga0115011_1004920673300009593MarineMRHKTITLCPTTYEIARKMDNFSAWIRQELMKKQATQFKAKPEIDEKYGAYCHRCDLTMLNTYPDMLKGGLPCKECGKKTIFVGLIE*
Ga0163179_1003010093300012953SeawaterMDNFSAWIRQELMKKQATQFKAKPEITEKYGAYCHRCDLTMLNTDPDMLKGGLPCKECGKKTIFVGLIE*
Ga0163179_1028696123300012953SeawaterMRHKTITLCLTTYEIARKMDNFSGWIRQELMKKQAKQYKAKPEKEEMHYAYCSPCDLSEFNKDPDMLKGGHRCKECGKKTIFVGLIE*
Ga0181387_101012113300017709SeawaterMRHKTITLCPTTYEIARKMNNFSGWIRQELMKKQATQYKAKPETDEKYGAYCHRCDLTMLNTDPDMLRGGLPCKECGKKTIFVGLIE
Ga0181387_107034033300017709SeawaterMRHKTITLCPTTYEIARKMDNFSAWIRQELMKKQATEYKAKPEPIQERQKYGAYCDSCDVTFLDSDPVLLQGRMPCKKCGKGTTYLGLIEXMNMFVLT
Ga0181403_101832613300017710SeawaterRKMDNFSAWIRQELMKKQATQYKAKPEIKEKYGAYCEPCDVTFLDSDPVLLQGRMPCKKCGKGTTYLGLIE
Ga0181390_105803913300017719SeawaterNCQCNMRHKTITLCPTTYEIARKMDNFSAWIRQELMKKQATQYKAKPEIDEKYQAYCNPCDISYLNTDKDLIKGMPCKECGKKTFYLGLVE
Ga0181383_105834523300017720SeawaterMRHKTITLCPTTYEIARKMDNFSAWIRQELMKKQATQFKAKPEIEEKYQAYCNPCDLSYLNIDPDMIKGMPCKECGKKTFYLGLVE
Ga0181388_105998913300017724SeawaterMRHKTITLCPTTYEIARKMDNFSAWIRQELMKKQATQYKAKPEIDEKYQAYCNPCDISYLNTDKDLIKGMPCKECGKKTFYLGLVE
Ga0181388_115904313300017724SeawaterRQELMKKQATQYKAKPETDEKYGAYCHRCDLTMLNTDPDMLKGGLPCKECGKKTIFVGLI
Ga0181419_101214473300017728SeawaterRHKTITLCPTTYEIARKMDNFSAWIRQELMKKQATQYKAKPEINEKYGAYCHRCNLTMLNTDPDMLRGGLPCKECGKKTIFVGLIE
Ga0181419_106264123300017728SeawaterRHKTITLCPTTYEIARKMDNFSAWIRQELMKKQATQYKAKPEITEKYQAYCNPCDKSFLNTDPDLIKGIPCDVCGKKTFFLGLVE
Ga0181396_100481173300017729SeawaterMRHKTITLCPTTYEIARKMDNFSAWIRQELMKKQATQYKAKPEITEKYQAYCNPCDKSFLNTDPDLIKGIPCDVCGKKTFFLGLVE
Ga0181396_103150443300017729SeawaterMRHKTITLCPTTYEIARKMDNFSAWIRQELMKKQATQYKAKPEIREKYQAYCNPCDKSFLNTDPDLIKGIPCNVCGKKTFFLGLVE
Ga0181396_104666723300017729SeawaterMRHKTITLCPTTYEIARKMDNFSGWIRQELMKKQATQYKAKPEIDEKYGAYCHRCDLTMLNTDPDMLKGGLPCKECGKKTIFVGLIE
Ga0181417_101601313300017730SeawaterMRHKTITLCPTTYEIARKMNNFSGWIRQELMKKQATQYKAKPEINEKYGAYCHRCNLTMLNTDPDMLRGGLPCKECGKKTIFVGLIE
Ga0181431_110295033300017735SeawaterATQYKAKPEIKEKYGAYCEPCDVTFLDSDPVLLRGRMPCKKCGKGTTYLGLIE
Ga0181431_114222433300017735SeawaterFSAWIRQELMKKQATQYKAKPEIDEKYQAYCNPCDLSYLNIDPDMIKGMPCKECGKKTFYLGLVE
Ga0181399_114354613300017742SeawaterTITLCPTTYEIARKMDNFSAWIRQELMKKQATQYKAKPEIKEKYGAYCEPCDVTFLDSDPVLLQGRMPCKKCGKGTTYLGLIE
Ga0181402_103281613300017743SeawaterMRHKTITLCPTTYEIARKMDNFSAWIRQELMKKQATQYKAKPEIKEKYGAYCEPCDVTFLDSDPVLLQGRMPCKKCGKGTT
Ga0181400_122187813300017752SeawaterKIINCQCNMRHKTITLCPTTYEIARKMDNFSAWIRQELMKKQATQYKAKPEIKEKYGAYCEPCDVTFLDSDPVLLQGRMPCKKCGKGTTYLGLIE
Ga0181400_122188013300017752SeawaterKIINCQCNMRHKTITLCPTTYEIARKMDNFSAWIRQELMKKHATQYKAKPEIKEKYGAYCEPCDVTFLDSDPVLLQGRMPCKKCGKGTTYLGLIE
Ga0181420_125221013300017757SeawaterTITLCPTTYEIARKMNNFSGWIRQELMKKQATQYKAKPEINEKYGAYCHRCNLTMLNTDPDMLRGGLPCKECGKKTIFVGLIE
Ga0181414_118499313300017759SeawaterRHKTITLCPTTYEIARKMDNFSAWIRQELMKKQASQFKAKPENDKNKYQAYCNPCDLSYLNTDPDIVKGMPCKECGKKTFYLGLIE
Ga0181408_104276213300017760SeawaterCQCNMRHKTITLCPTTYEIARKMDNFSAWIRQELMKKQATQYKAKPEIKEKYGAYCEPCDVTFLDSDPVLLQGRMPCKKCGKGTTYLGLIE
Ga0181408_107543123300017760SeawaterRHKTITLCPTTYEIARKMDNFSAWIRQELMKKQATQYKAKPEIKEKYGAYCEPCDVTFLDSDPVLLQGRMPCKKCGKGTTYLGLIE
Ga0181422_101430373300017762SeawaterMRHKTITLCPTTYEIARKMNNFSAWIRQELMKKQATQYKAKPEITEKYQAYCNPCDKSFLNTDPDLIKGIPCDVCGKKTFFLGLVE
Ga0181422_103290863300017762SeawaterMRHKTITLCPTTYEIARKMDNFSAFVRQELMKKQATQYKSKPDIVAKFQAYCNPCDLSYLNTDPDMIKGMPCKECGKKTFYLGLVE
Ga0181385_101199633300017764SeawaterMRHKTITLCPTTYEIARKMDNFSAWIRQELMKKQATQYKAKPEVTEKYGAYCAPCDLTMLNTDPDMLKGGLPCKECGKGTVFVGLIE
Ga0181385_107469133300017764SeawaterMRHKTITLCPTTYEIARKMDNFSGWIRQELMKKQATQYKAKPEITEKYGAYCGTCDLTMLHTDPDMLKGGLPCKECGKGTIYVGMIE
Ga0181413_114339633300017765SeawaterMRHKTITLCPTTYEIARKMDNFSAWIRQELMKKQATQYKAKPEIKEKYGAYCEPCDVTFLDSDPVLLQGRMPCKKC
Ga0181406_100843573300017767SeawaterMRHKTITLCPTTYEIARKMDNFSAWIRQELMKKQASQFKAKPENDKNKYQAYCNPCDLSYLNTDPDLVKGIPCKECGKKTFYLGFVE
Ga0187220_117311923300017768SeawaterRHKTITLCPTTYEIARKMDNFSAWIRQELMKKQATQFKAKPEIEEKYQAYCNPCDLSYLNIDPDMIKGMPCKECGKKTFYLGLVE
Ga0187221_118966523300017769SeawaterMRHKTITLCPTTYEIARKMDNFSAWIRQELMKKQATEYKAKPEPIQERQKYGAYCDSCDVTFLDSDPTLLKGRMPCKKCGKSTTYLGLIEXEINSIVKLC
Ga0187217_101812673300017770SeawaterTLCPTTYEIARKMDNFSAWIRQELMKKQATQYKAKPEITEKYQAYCNPCDKSFLNTDPDLIKGIPCDVCGKKTFFLGLVE
Ga0187217_103539513300017770SeawaterKTITLCPTTYEIARKMDNFSAWIRQELMKKQATQYKAKPEIKEKYGAYCEPCDVTFLDSDPVLLQGRMPCKKCGKGTTYLGLIE
Ga0181430_110893123300017772SeawaterMRHKTITLCPTTYEIARKMDNFSAFVRQELMKKQATQYKSKPDIVAKFQAYCNPCDLSYLNTDPDMIKGMPCKECGKKTFYMGLVE
Ga0181386_101354513300017773SeawaterMRHKTITLCPTTYEIARKMNNFSAWIRQELMKKQATQYKAKPEVTEKYGAYCAPCDLTMLNTDPDMLKGGLPCKECGKGTVFVGLIE
Ga0181386_113706323300017773SeawaterMRHKTITLGPTTYEIARKMDNFSAWIRQELMKKQATQYKAKPEIDEKYGAYCHRCDLTMLNTDPDMLKGGLPCKECGKKTIFVGLIE
Ga0181394_103486213300017776SeawaterNCQCNMRHKTITLCPTTYEIARKMDNFSAWIRQELMKKQATQYKAKPEIKEKYGAYCEPCDVTFLDSDPVLLQGRMPCKKCGKGTTYLGLIE
Ga0181394_118548313300017776SeawaterTITLCPTTYEIARKMNNFSGWIRQELMKKQATQYKAKPEIIEKYQAYCNPCDKSFLNTDPDLIKGIPCDVCGKKTFYLGLVE
Ga0181395_108588243300017779SeawaterITLCPTTYEIARKMDNFSAWIRQELMKKQATQYKAKPEIKEKYGAYCEPCDVTFLDSDPVLLQGRMPCKKCGKGTTYLGLIE
Ga0181395_124760713300017779SeawaterMRHKTITLCPTTYEIARKMNNFSGWIRQELMKKQATQYKAKPEIDEKYGAYCHRCDLTMLNTDPDMLKGGLPCKECGKKTIFVGLIE
Ga0181423_101651913300017781SeawaterMRHKTITLCPTTYEIARKMDNFSAWIRQELMKKQATQYKAKPEIREKYQAYCNPCDKSFLNTDPDLIKGIPCDVCGKKTFFLGLVE
Ga0181423_101651993300017781SeawaterPTTYEIARKMDNFSAWIRQELMKKQATQYKAKPEIKEKYGAYCEPCDVTFLDSDPVLLQGRMPCKKCGKGTTYLGLIE
Ga0181380_101853113300017782SeawaterMKKQATQYKAKPEIDEKYQAYCNPCDLSYLNTDPDMIKGMPCKECGKKTFYLGLVE
Ga0181380_101989553300017782SeawaterMRHKTITLCPTTYEIARKMDNFSAWIRQELMKKQATEYKAKPEPIQERQKYGAYCDSCDVTFLDSDPTLLKGRMPCKKCGKSTTYLGLIE
Ga0181380_102917923300017782SeawaterMRHKTITLCPTTYEIARKMDNFSAWIRQELMKKQATQYKAKPDIEEKYQAYCNPCDLSYLNTDPDMIKGMPCKECGKKTFYLGLVE
Ga0181380_103600813300017782SeawaterMRHKTITLCPTTYEIARKMDNFSAWIRQELMKKQATQYKAKPEIDEKYQAYCNPCDLSYLNTDPDMIKGMPCKECGKKTFYLGLVE
Ga0181380_115216033300017782SeawaterMRHKTITLCPTTYEIARKMDNFSAWIRQELMKKQATQYKAKPEIKEKYGAFCEPCDVTFLDTDPSLLQGRMPCKKCGKGTTYLGLIE
Ga0181380_132424923300017782SeawaterMRHKTITLCPTTYEIARKMNNFSAWIRQELMKKQATQYKAKPEFKEKYQAYCNPCDKSFLNTDPDLIKGIPCDVCGKKTFYLGLVE
Ga0181379_102014813300017783SeawaterMDNFSAWIRQELMKKQATQYKAKPEIDEKYQAYCNPCDLSYLNTDPDMIKGMPCKECGKKTFYLGLVE
Ga0181379_126346913300017783SeawaterTLCPTTYEIARKMDNFSAWIRQELMKKQATQYKAKPEIKEKYGAYCEPCDVTFLDSDPVLLQGRMPCKKCGKGTTYLGLIE
Ga0181424_1044404033300017786SeawaterNMRHKTITLCPTTYEIARKMDNFSAWIRQELMKKQATQYKAKPEIKEKYGAYCEPCDVTFLDSDPVLLQGRMPCKKCGKGTTYLGLIE
Ga0211579_1030302133300020472MarineMRHKTITLCPTTYEIARKMDNFSAWIRQELMKKQATQYKAKPEIDEKYGAYCHRCDLTMLNTDPDMLKGGLPCKECGKKTIFVGLIE
Ga0213868_1056896723300021389SeawaterMRHKTITLCPTTYEIARKMDNFSAWIRQELMKKQATQYKAKPEIEEKYQAYCNPCDISYLNTDPDMIKGMPCKECGKKTFFLGLVE
(restricted) Ga0233404_1003109633300022913SeawaterMRHKTITLCPTTYEIARKMDNFSAWIRQELMKKQATQYKAKPEIKEKYGAYCEPCDVTFLDSDPVLLQGRMPCKKCGKGTTYLGLIE
(restricted) Ga0233409_1023702513300022938SeawaterNCQCNMRHKTITLCPTTYEIARKMDNFSAWIRQELMKKQATQYKAKPEIKEKYGAYCEPCDVTFLDSDPVLLQGRMPCKKCGKGTTYLGLIEXINMFVLTAELIGKMMDLWFSFAGYVVR
(restricted) Ga0233406_1008992623300023085SeawaterMRHKTITLCPTTYEIARKMDNFSAWIRQELMKKQATQYKAKPEIKEKYGAYCEPCDVTFLDSDPVLLQGRMPCKKCGKGTTYLGFIE
(restricted) Ga0255039_1039123923300024062SeawaterMRHKTITLCPTTYEIARKMDNFSAWIRQELMKKQATQYKAKPEIKEKYGAYCEPCDVTFLDSDPVLLQGRMPC
(restricted) Ga0233444_1004595283300024264SeawaterTQYKAKPEIKEKYGAYCEPCDVTFLDSDPVLLQGRMPCKKCGKGTTYLGLIE
(restricted) Ga0233444_1007724913300024264SeawaterPTTYEIARKMDNFSAWIRQELMKKQATQYKAKPEIKEKYGAYCEPCDVTFLDSDPVLLQGRMPCKKCGKGTTYLGLIG
Ga0209337_103492433300025168MarineMRNKMITLCPTTYEIASNMDNFSGWIRQELMKKQATQYKAKPEIDPKYGAYCSPCDLTHLHTDPSMLQGSMPCQQCGKATVYVGLIE
Ga0208180_107944213300025277Deep OceanMRHKTITLCPTTYEIARKMDNFSAWIRQELMKKQATQYKAKPEIKEKYAAYCNPCDLTHLNTNPDLLKGSMPCHECGKATVYLGLIE
Ga0208934_107168413300025293Deep OceanTTYEIARKMDNFSAWIRQELMKKQATQYKAKPEIKEKYAAYCNPCDLTHLNTNPDLLKGSMPCHECGKATVYLGLIE
Ga0208767_110553513300025769AqueousMRHKTITLCPTTYEIARKMDNFSGWIRQELMKKQATQYKAKPEIEEKYQAYCNPCDISYLNTDPDMIKGMPCKECGKKTFFLGLVE
Ga0209273_1035086713300027790Marine SedimentPTTYEIARKMDNFSAFVRQELMKKQATQYKAKPDVVAKYGAYCNPCDLTHLHTDPNMLKGSMPCQECGKATVYVGLIE
Ga0209578_1003604253300027820Marine SedimentMRHKTITLCPTTYEIARKMDNFSAFVRQELMKKQATQYKAKPDVVAKYGAYCNPCDLTHLHTDPNMLKGSMPCQECGKATVYVGLIE
(restricted) Ga0255054_1064794623300027856SeawaterMRHKTITLCPTTYEIARKMDNFSAWIRQELMKKQATQYKAKPEFKEKYGAYCEPCDVTFLDSDPVLLQGRMPCKKCGKGTTYLGLIE
(restricted) Ga0233415_1001821263300027861SeawaterMITLCPTTYELASNMDNFSAWIRQELMKKQATQYKAKPEIKEKYGAYCEPCDVTFLDSDPVLLQGRMPCKKCGKGTTYLGLIE
(restricted) Ga0233415_1014414613300027861SeawaterMRQKMITLCPTTYEMARKMDNFSAWIRQELMKKQATQYKAKPEIKEKYGAYCEPCDVTFLDSDPVLLQGRMPCKKCGKGTTYLGLIE
(restricted) Ga0233415_1030271523300027861SeawaterLCPTTYEIARKMDNFSAWIRQELMKKQATQYKAKPEIKEKYGAYCEPCDVTFLDSDPVLLQGRMPCKKCGKGTTYLGLIE
(restricted) Ga0255052_1005617163300027865SeawaterMDNCSAWIRQELMKKQATQYKAKPEIKEKYGAYCEPCDVTFLDSDPVLLQGRMPCKKCGKGTTYLGLIE
(restricted) Ga0255052_1025367913300027865SeawaterIRQELMKKQATQYKAKPEIKEKYGAYCEPCDVTFLDSDPVLLQGRMPCKKCGKGTTYLGLIE
(restricted) Ga0255052_1042842023300027865SeawaterAWIRQELMKKQATQYKAKPEIKEKYGAYCEPCDVTFLDSDPVLLQGRMPCKKCGKGTTYLGLIE
(restricted) Ga0255053_1028655733300027868SeawaterNFSAWIRQELMKKQATQYKAKPEIKEKYGAYCEPCDVTFLDSDPVLLQGRMPCKKCGKGTTYLGLIE
(restricted) Ga0255053_1038797913300027868SeawaterFSAWIRQELMKKQATQYKAKPEIKEKYGAYCEPCDVTFLDSDPVLLQGRMPCKKCGKGTTYLGLIE
(restricted) Ga0255055_1008621763300027881SeawaterWIRQELMKKQATQYKAKPEIKEKYGAYCEPCDVTFLDSDPVLLQGRMPCKKCGKGTTYLGLIE
(restricted) Ga0255055_1032959843300027881SeawaterRQELMKKQATQYKAKPEIKEKYGAYCEPCDVTFLDSDPVLLQGRMPCKKCGKGTTYLGLI
(restricted) Ga0255055_1043616113300027881SeawaterQYKAKPEIKEKYGAYCEPCDVTFLDSDPVLLQGRMPCKKCGKGTTYLGLIE
(restricted) Ga0255055_1048167713300027881SeawaterHKTITLCPTTYEIARKMDNFSAWIRQELMKKQATQYKAKPEIREKYGAYCEPCNVTFLDSDPVLLQGRMPCKKCGKGTTYLGLIE
Ga0209404_1058795323300027906MarineMRHKTITLCPTTYEIARKMDNFSAWIRQELMKKQATQFKAKPEIDEKYGAYCHRCDLTMLNTDPDMLKGGLPCKECGKKTIFVGLIE
(restricted) Ga0233413_1025984833300027996SeawaterCHCNMRHKTITLCPTTYEIARKMDNFSAWIRQELMKKQATQYKAKPEIKEKYGAYCEPCDVTFLDSDPVLLQGRMPCKKCGKGTTYLGLIE
(restricted) Ga0233414_1001842353300028045SeawaterMRHKTITLCPTTYEIARKMDNFSAWIRQELMKKQATEYKAKPESIQEHQKYGAYCDSCDVTFLDTDPVLLKGRMPCKKCGKGTTYLGLIE
(restricted) Ga0233414_1023250113300028045SeawaterCNMRHKTITLCPTTYEIARKMDNFSAWIRQELMKKQATQYKAKPEIKEKYGAYCEPCDVTFLDSDPVLLQGRMPCKKCGKGTTYLGLIE
Ga0228649_109413123300028132SeawaterMRHKTITLCPTTYEIARKMDNFSAWIRQELMKKHATQYKAKPEIDEKFQAYCNPCDLSYLNTDPDMIKGMPCKECGKRTFYLGLVE
Ga0265306_1002873923300028598SedimentMRHKTITLCPTTYEIARKMDNFSAWIRQELMKKQATQYKAKPEIKEKYGAYCEPCDVTFLDSDPSLLQGRMPCKKCGKGTSYLGLIE
Ga0265303_1077640113300028600SedimentMRHKTITLCPTTYEIARKMDNFSAFVRQELMKKQATQYKSKPEVVAKFQAYCNPCDLSYLNTDPDMIKGMPCKECGKKTFYLGLVE
Ga0315331_1116444013300031774SeawaterMRHKTITLCPTTYEIARKMDNFSAWIRQELMKKQATQYKAKPELDEKYGAYCHRCDLTMLNTDPDMLKGGLPCKECGKKTIFVGLIE

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.