NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F094581

Metagenome / Metatranscriptome Family F094581

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F094581
Family Type Metagenome / Metatranscriptome
Number of Sequences 106
Average Sequence Length 52 residues
Representative Sequence ADAIGLSRDDAERMLDTLWRRRLVIRYDSAYVAVGSATEPMRLDA
Number of Associated Samples 96
Number of Associated Scaffolds 106

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.06 %
% of genes from short scaffolds (< 2000 bps) 87.74 %
Associated GOLD sequencing projects 92
AlphaFold2 3D model prediction Yes
3D model pTM-score0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(22.642 % of family members)
Environment Ontology (ENVO) Unclassified
(33.962 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(48.113 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 17.81%    β-sheet: 10.96%    Coil/Unstructured: 71.23%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 106 Family Scaffolds
PF01568Molydop_binding 50.00
PF01053Cys_Met_Meta_PP 37.74
PF00005ABC_tran 6.60
PF02687FtsX 1.89
PF01769MgtE 0.94
PF01261AP_endonuc_2 0.94

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 106 Family Scaffolds
COG0075Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucGAmino acid transport and metabolism [E] 37.74
COG01567-keto-8-aminopelargonate synthetase or related enzymeCoenzyme transport and metabolism [H] 37.74
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 37.74
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 37.74
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 37.74
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 37.74
COG1921Seryl-tRNA(Sec) selenium transferaseTranslation, ribosomal structure and biogenesis [J] 37.74
COG1982Arginine/lysine/ornithine decarboxylaseAmino acid transport and metabolism [E] 37.74
COG2008Threonine aldolaseAmino acid transport and metabolism [E] 37.74
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 37.74
COG4100Cystathionine beta-lyase family protein involved in aluminum resistanceInorganic ion transport and metabolism [P] 37.74
COG1824Permease, similar to cation transportersInorganic ion transport and metabolism [P] 0.94
COG2239Mg/Co/Ni transporter MgtE (contains CBS domain)Inorganic ion transport and metabolism [P] 0.94

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000880|AL20A1W_1113437All Organisms → cellular organisms → Bacteria2127Open in IMG/M
3300000887|AL16A1W_10371814All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300001330|A305W6_1097228All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium524Open in IMG/M
3300001361|A30PFW6_1202182All Organisms → cellular organisms → Bacteria1242Open in IMG/M
3300001661|JGI12053J15887_10221729All Organisms → cellular organisms → Bacteria951Open in IMG/M
3300001664|P5cmW16_1033596All Organisms → cellular organisms → Bacteria950Open in IMG/M
3300001664|P5cmW16_1065846All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium607Open in IMG/M
3300004479|Ga0062595_102182223All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium542Open in IMG/M
3300005343|Ga0070687_100530460All Organisms → cellular organisms → Bacteria798Open in IMG/M
3300005364|Ga0070673_100340440All Organisms → cellular organisms → Bacteria1329Open in IMG/M
3300005434|Ga0070709_11485998All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium550Open in IMG/M
3300005439|Ga0070711_100863950All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes770Open in IMG/M
3300005536|Ga0070697_101382738All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes628Open in IMG/M
3300005539|Ga0068853_100034957All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp.4267Open in IMG/M
3300005545|Ga0070695_100154619All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1604Open in IMG/M
3300005546|Ga0070696_100882395All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes741Open in IMG/M
3300005560|Ga0066670_10792620All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium574Open in IMG/M
3300005568|Ga0066703_10756173All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300005616|Ga0068852_101792476All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium636Open in IMG/M
3300005719|Ga0068861_100225873All Organisms → cellular organisms → Bacteria1585Open in IMG/M
3300005887|Ga0075292_1006446All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1437Open in IMG/M
3300005938|Ga0066795_10054897All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1176Open in IMG/M
3300006034|Ga0066656_10079359All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1956Open in IMG/M
3300006173|Ga0070716_100473717All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes918Open in IMG/M
3300006800|Ga0066660_10395438All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1139Open in IMG/M
3300009012|Ga0066710_104638465All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium514Open in IMG/M
3300009029|Ga0066793_10566261All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium648Open in IMG/M
3300009098|Ga0105245_11738918All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae676Open in IMG/M
3300009137|Ga0066709_100983998All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae1234Open in IMG/M
3300009143|Ga0099792_10503629All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae759Open in IMG/M
3300009177|Ga0105248_12015314All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae656Open in IMG/M
3300010039|Ga0126309_10764021All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium627Open in IMG/M
3300010301|Ga0134070_10219711All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium702Open in IMG/M
3300010371|Ga0134125_10799167All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae1038Open in IMG/M
3300010396|Ga0134126_12854454All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium523Open in IMG/M
3300012010|Ga0120118_1121709All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium629Open in IMG/M
3300012203|Ga0137399_10292907All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae1343Open in IMG/M
3300012206|Ga0137380_10247355All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1608Open in IMG/M
3300012207|Ga0137381_10687619All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae889Open in IMG/M
3300012208|Ga0137376_11483653All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes569Open in IMG/M
3300012210|Ga0137378_11193964All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae676Open in IMG/M
3300012211|Ga0137377_11209963All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae685Open in IMG/M
3300012285|Ga0137370_11031093All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium506Open in IMG/M
3300012351|Ga0137386_10481390All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae894Open in IMG/M
3300012356|Ga0137371_10250495All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1383Open in IMG/M
3300012361|Ga0137360_10615535All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae930Open in IMG/M
3300012483|Ga0157337_1010913All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae710Open in IMG/M
3300012683|Ga0137398_10053729All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae2396Open in IMG/M
3300012685|Ga0137397_10252279All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae1314Open in IMG/M
3300012685|Ga0137397_10935295All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae641Open in IMG/M
3300012907|Ga0157283_10062778All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae892Open in IMG/M
3300012927|Ga0137416_10089902All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae2283Open in IMG/M
3300012929|Ga0137404_11127835All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae720Open in IMG/M
3300012930|Ga0137407_12382608All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium506Open in IMG/M
3300012944|Ga0137410_10632238All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae887Open in IMG/M
3300012955|Ga0164298_10932268All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium635Open in IMG/M
3300013105|Ga0157369_12431789All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium530Open in IMG/M
3300013307|Ga0157372_11211555All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium872Open in IMG/M
3300013765|Ga0120172_1002217All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis7385Open in IMG/M
3300013770|Ga0120123_1012562All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae1642Open in IMG/M
3300014058|Ga0120149_1001635All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae4318Open in IMG/M
3300014058|Ga0120149_1030133All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae1306Open in IMG/M
3300015241|Ga0137418_11097270All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium567Open in IMG/M
3300018027|Ga0184605_10004394All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas phototrophica4992Open in IMG/M
3300018054|Ga0184621_10170462All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae783Open in IMG/M
3300018061|Ga0184619_10193006All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae935Open in IMG/M
3300018066|Ga0184617_1043166All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae1120Open in IMG/M
3300018076|Ga0184609_10362714All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae676Open in IMG/M
3300020001|Ga0193731_1007078All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae2853Open in IMG/M
3300020018|Ga0193721_1069887All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae916Open in IMG/M
3300020070|Ga0206356_10068200All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae684Open in IMG/M
3300021344|Ga0193719_10116723All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae1160Open in IMG/M
3300021344|Ga0193719_10224879All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium798Open in IMG/M
3300021968|Ga0193698_1012709All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1073Open in IMG/M
3300022534|Ga0224452_1007084All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae2807Open in IMG/M
3300024249|Ga0247676_1033666All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium824Open in IMG/M
3300025918|Ga0207662_10762582All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes681Open in IMG/M
3300025920|Ga0207649_10747583All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium761Open in IMG/M
3300025922|Ga0207646_10155682All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium2061Open in IMG/M
3300025932|Ga0207690_11028132All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium686Open in IMG/M
3300026075|Ga0207708_10088405All Organisms → cellular organisms → Bacteria2387Open in IMG/M
3300026271|Ga0209880_1031790All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1227Open in IMG/M
3300026300|Ga0209027_1307903All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes511Open in IMG/M
3300026532|Ga0209160_1021423All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis4311Open in IMG/M
3300026552|Ga0209577_10497358All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium814Open in IMG/M
3300027591|Ga0209733_1081149All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium833Open in IMG/M
3300027886|Ga0209486_10980991All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes566Open in IMG/M
3300028536|Ga0137415_10057390All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis3760Open in IMG/M
3300028711|Ga0307293_10151929All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes737Open in IMG/M
3300028711|Ga0307293_10309527All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium501Open in IMG/M
3300028715|Ga0307313_10108040All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium847Open in IMG/M
3300028768|Ga0307280_10157483All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes787Open in IMG/M
3300028793|Ga0307299_10278084All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes629Open in IMG/M
3300028799|Ga0307284_10153661All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium889Open in IMG/M
3300028799|Ga0307284_10169293All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae849Open in IMG/M
3300028799|Ga0307284_10202703All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae780Open in IMG/M
3300028819|Ga0307296_10669698All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes567Open in IMG/M
3300028828|Ga0307312_10509912All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes794Open in IMG/M
3300028875|Ga0307289_10255305All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes721Open in IMG/M
3300028876|Ga0307286_10286912All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes607Open in IMG/M
3300028884|Ga0307308_10185885All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium995Open in IMG/M
3300028884|Ga0307308_10243833All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium861Open in IMG/M
3300028885|Ga0307304_10085412All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1237Open in IMG/M
3300028885|Ga0307304_10321669All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium687Open in IMG/M
3300028885|Ga0307304_10337923All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium671Open in IMG/M
3300030991|Ga0073994_10027907All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae964Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil22.64%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil18.87%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost10.38%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.66%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment4.72%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.83%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.89%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil1.89%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.89%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.89%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.89%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.89%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.89%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.94%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.94%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.94%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.94%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.94%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.94%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.94%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.94%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000880Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A35-65cm-20A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300000887Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-65cm-16A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001330Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A30-5cm)- 6 month illuminaEnvironmentalOpen in IMG/M
3300001361Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A30-PF)- 6 month illuminaEnvironmentalOpen in IMG/M
3300001661Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)EnvironmentalOpen in IMG/M
3300001664Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - 5cm_reassembledEnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005887Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403EnvironmentalOpen in IMG/M
3300005938Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300012010Permafrost microbial communities from Nunavut, Canada - A7_35cm_12MEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012483Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610Host-AssociatedOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013765Permafrost microbial communities from Nunavut, Canada - A30_80cm_6MEnvironmentalOpen in IMG/M
3300013770Permafrost microbial communities from Nunavut, Canada - A15_5cm_18MEnvironmentalOpen in IMG/M
3300014058Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25MEnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018066Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300020001Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2EnvironmentalOpen in IMG/M
3300020018Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021968Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c1EnvironmentalOpen in IMG/M
3300022534Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1EnvironmentalOpen in IMG/M
3300024249Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK17EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026271Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 (SPAdes)EnvironmentalOpen in IMG/M
3300026300Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026532Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027591Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300030991Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
AL20A1W_111343713300000880PermafrostEIISQLGAGVGADVADAIGLSSDDAERMLDTLWRRRLLIRYDNAYVAVGSATIPSQATRLDA*
AL16A1W_1037181413300000887PermafrostLSPEHAQRMLDTLWRRRLVIRHDNGYVAVGSAAAPVEPMRLDA*
A305W6_109722823300001330PermafrostISHLGAGVSADVAEVADATGLSREHAERMLDILWRRRLVIRHDNGYVAVGSATAAVGPMRVDA*
A30PFW6_120218213300001361PermafrostHAERMLDTLWRRRLVIRHDNGYVAVGGAAARVQPMRLDA*
JGI12053J15887_1022172933300001661Forest SoilGVSADVAEVADATGLSREHAERMLNILWRRRLVIRHENGYVAVGSATGAVEPMRLDA*
P5cmW16_103359643300001664PermafrostADATGLSREHAERMLDILWRRRLVIRHDNGYVAVGSATAAVGPMRADA*
P5cmW16_106584633300001664PermafrostADATGLSREHAERMLDILWRRRLVIRHDNGYVAVGSATVSPEPMRLDA*
Ga0062595_10218222313300004479SoilWEIISQLGTGVGADVADAIGLSRVDADRMLDTLWRRRLLIRYDNAYVAVGSATVESQPTRLDV*
Ga0070687_10053046013300005343Switchgrass RhizosphereAVADVAERTGLSRDVTERMLDMLWRRRLLIRYDDGYVAVGSATARPEPQLDA*
Ga0070673_10034044013300005364Switchgrass RhizosphereAGAVADIAEATGLSSDAAERMLDTLWRRRLLIRYDDGYVAVGSATTRAEPLRLDA*
Ga0070709_1148599813300005434Corn, Switchgrass And Miscanthus RhizosphereGTGVGADVADAIGLSRVDADRMLDTLWRRRLLIRYDNAYVAVGSATVESQPTRLDA*
Ga0070711_10086395033300005439Corn, Switchgrass And Miscanthus RhizosphereLSRVDADRMLDTLWRRRLLIRYDNAYVAVGSATVESQPTRLDV*
Ga0070697_10138273813300005536Corn, Switchgrass And Miscanthus RhizosphereADVADVIGLSRDAAERMLDTLWRRRLLIRYDNAYVAVGSATGASAPASLDT*
Ga0068853_10003495713300005539Corn RhizosphereSCEAADRMLDTLWRRRLVIRHDSAYVAVGSATTPAESARLDA*
Ga0070695_10015461933300005545Corn, Switchgrass And Miscanthus RhizosphereRKAWEIISQLGAGVGADVADATGLSCEAADRMLDTLWRRRLVIRHDSAYVAVGSATTPAESARLDA*
Ga0070696_10088239533300005546Corn, Switchgrass And Miscanthus RhizosphereEATGLSRDAAERMLDTLWRRRLLIRYDDGYVAVGSATIRTEPMRLDA*
Ga0066670_1079262013300005560SoilAAQRTLDLLWRRRLLIRYDDAYVAVGSATIRSEPMRLDA*
Ga0066703_1075617313300005568SoilRSAWEIISHLGAGVSADVIEVADATGLSLERAERMLDTLWRRRLVIRHDNGYVAVGSATAPVEPMRLDA*
Ga0068852_10179247633300005616Corn RhizosphereQLGAGVSADVADAIGLSPDAAERTLEKLWRRRLLIRHDHGYVAVGSASAPSQQMRLDA*
Ga0068861_10022587313300005719Switchgrass RhizosphereIISQLGAGAVADVAERTGLSRDVTERMLDMLWRRRLLIRYDDGYVAVGSATARPEPQLDA
Ga0075292_100644633300005887Rice Paddy SoilDVADAIGLSPDDAERMLEKLWRRRLLIRHDDGYVAVGCASTPAQQVRLDA*
Ga0066795_1005489733300005938SoilDDAERMLDTLWRRRLLIRYDNAYVAVGSASIPSPPTRLDP*
Ga0066656_1007935943300006034SoilDAAQRTLDLLWRRRLLIRYDDAYVAVGSATIRSEPMRLDA*
Ga0070716_10047371733300006173Corn, Switchgrass And Miscanthus RhizosphereAWEIISQLGTGVGADVADAIGLSRVDADRMLDTLWRRRLLIRYDNAYVAVGSATVESQPTRLDA*
Ga0066660_1039543813300006800SoilADATGLSRDAAERMLDTLWRRRLVIRYDDGYVAVGSATIRSEPLRLDA*
Ga0066710_10463846513300009012Grasslands SoilAGASSDVADAIGLSRDDAERTLDKLWRRRLLIRHENGYVAVGSASAPSEPMRLDA
Ga0066793_1056626113300009029Prmafrost SoilGIVDVDERRAWEIISQLGAGAGADVADGTGLSPEHAERMLDILWRRRLVIRHDDGYVAVSSATAPVQPMRLDA*
Ga0105245_1173891833300009098Miscanthus RhizosphereDIAEATGLSSDAAERMLDTLWRRRLLIRYDDGYVAVGSATTRAEPLRLDA*
Ga0066709_10098399833300009137Grasslands SoilSDVADAIGLSADDAERTLDKLWRRRLLIRHDNGYVAVGSASAASQPMRLDA*
Ga0099792_1050362913300009143Vadose Zone SoilEIISHLGAGVSADVAEVADATGLSRERAERMLNILWRRRLVIRHENGYVAVGSATAALEPMRLDA*
Ga0105248_1201531413300009177Switchgrass RhizosphereEATGLSSDAAERMLDTLWRRRLLIRYDDGYVAVGSATTRAEPLRLDA*
Ga0126309_1076402113300010039Serpentine SoilDAERMLDTLWRRRLVIRHDNGYVAVGNAVLPNEPARIDA*
Ga0134070_1021971133300010301Grasslands SoilQLGAGASSDVADVIGLSRDDAERTLDKLWRRRLLIRHDDGYVAVGSASAPSEPMRLDA*
Ga0134125_1079916713300010371Terrestrial SoilRMLDTLWRRRLLIRYDDGYVAVGSATVRAEPMRLDA*
Ga0134126_1285445413300010396Terrestrial SoilVDADRMLDTLWRRRLLIRYDNAYVAVGSATVESQPTRLDA*
Ga0120118_112170933300012010PermafrostADVADAIGLSSDDAERMLDTLWRRRLLIRYDNGYVAVGSATIPSQPTRLDA*
Ga0137399_1029290713300012203Vadose Zone SoilVADATGLSRGDAELMLDKLWRRRLLIRYDNAYVAVGSATITSAAMRLDA*
Ga0137380_1024735513300012206Vadose Zone SoilAERMLDTLWRRRLVIRYDDGYVAVGSATIRSEPMRLA*
Ga0137381_1068761913300012207Vadose Zone SoilRTLDKLWRRRLLIRHDNGYVAVGSASAPSEPMRLDA*
Ga0137376_1148365323300012208Vadose Zone SoilAWEIISQLGSGVSADVADAIGLSRDDAERMLDTLWRRRLVIRYDSAYVAVGSATEPMRLDA*
Ga0137378_1119396413300012210Vadose Zone SoilDALGHSPDAAERALDKLWRGRVPIRHKNAYVAVGSASAPSEPMRLDA*
Ga0137377_1120996333300012211Vadose Zone SoilRDAAELMLDTLWRRRLVIRYDNAYVAVGNATVGSEPMRLDA*
Ga0137370_1103109313300012285Vadose Zone SoilLGAGASADVADAIGLSPADAERMLDKLWRRRLLIRYDKGYVAVGSATVPSEPMRLDA*
Ga0137386_1048139013300012351Vadose Zone SoilLSRDDAERTLDKLWRRRLLIRHDNGYVAVGSASAPSEPMRLDA*
Ga0137371_1025049533300012356Vadose Zone SoilSSDVADAIGLSRDDAERTLDKLWRRRLLIRHENGYVAVGSASAPSEPMRLDA*
Ga0137360_1061553533300012361Vadose Zone SoilHLGAGVSADVADVIGLSRDAAERMLDTLWRRRLLIRYDNAYVAVGSATGASASTSLDT*
Ga0157337_101091313300012483Arabidopsis RhizosphereDIAEATGLSREAAERMLDTLWRRRLLIRYDDGYVAVGSATTRTEPLRLDA*
Ga0137398_1005372913300012683Vadose Zone SoilEIISQLGTGVGADDADAIGLSRVDADRMLDTLWRRRLLIRYDNAYVAVGSATVDSQPTRLDA*
Ga0137397_1025227913300012685Vadose Zone SoilIVGVNERKAWEIISQLGSGVSADVADAIGLSPADAETMLDTLWRRRLVIRYDSAYVAVGSAVEPMRLDA*
Ga0137397_1093529533300012685Vadose Zone SoilGLSRDDAELMLDTLWRRRLVIRYGSAYVAVGSATIVSQPMGLDA*
Ga0157283_1006277833300012907SoilLGAGAVADVAERTGLSRDVTERMLDMLWRRRLLIRYDDGYVAVGSTTARPEPRLDA*
Ga0137416_1008990243300012927Vadose Zone SoilATGLSRDDAEIMLDKLWRRRLLIRYDNAYVAVGSATITSAAMRLDA*
Ga0137404_1112783533300012929Vadose Zone SoilIGVSRVDAELMLDKLWRRRLLIRYDNAYVAVGSATISSPTMRLDA*
Ga0137407_1238260823300012930Vadose Zone SoilAAERMLDTLWRRRLLIRYDDGYVAVGSATARTEPMGLDA*
Ga0137410_1063223813300012944Vadose Zone SoilAGVGADVADATGLSRDDAEIMLDKLWRRRLLIRYDNAYVAVGSATITSAAMRLDA*
Ga0164298_1093226833300012955SoilAIGLSTDDTERTLEKLWRRRLLIRHDHGYVAVGSASAPVPEARLDA*
Ga0157369_1243178923300013105Corn RhizosphereMLDTLWRRRLVIRHDSAYVAVGSATTPAESARLDA*
Ga0157372_1121155513300013307Corn RhizosphereAERTLEKLWRRRLLIRHDHGYVAVGSASAPSQQMRLDA*
Ga0120172_100221713300013765PermafrostVADAIGLSSDDAERMLDTLWRRRLLIRYDNAYVAVGSATIPSQATRLDA*
Ga0120123_101256213300013770PermafrostLSREHAERMLDILWRRRLVIRHDNGYVAVGSATAAVGPMRVDA*
Ga0120149_100163513300014058PermafrostLGAGVGADVADAIGLSSDDAERMLDTLWRRRLLIRYDNAYVAVGSATIPSQATRLDA*
Ga0120149_103013333300014058PermafrostVSRLGAGASADVADATGLSREHAERMLDTLWRRRLLIRHDNGYVAVGSATAPVEPMRLDA
Ga0137418_1109727013300015241Vadose Zone SoilDAEIMLDKLWRRRLLIRYDNAYVAVGSATITSAAMRLDA*
Ga0184605_1000439413300018027Groundwater SedimentKAWEIISQLGSGVSADVADAIGLSRDDAERMLDTLWRRRLVIRYDSAYVAVGSATVPMRLDA
Ga0184621_1017046213300018054Groundwater SedimentVSADVADAIGLSRDDAERMLDTLWRRRLVIRYDSAYVAVGSATVPMRLDA
Ga0184619_1019300613300018061Groundwater SedimentADAIGLSRDDAERMLDTLWRRRLVIRYDSAYVAVGSATVPMRLDA
Ga0184617_104316633300018066Groundwater SedimentSQLGSGVSADVADAIGLSRDDAEQMLDTLWRRRLVIRYDSAYVAVGSATEPMRLDA
Ga0184609_1036271433300018076Groundwater SedimentAIGLSRDDAERMLDMLWRRRLVIRYDNGYVAVGSATGTTQPMRLDS
Ga0193731_100707813300020001SoilADGESRLVGIVGVKERKAWEIISQLGSGVSADVADAIGLSRDDAEQMLDTLWRRRLVIRYDSAYVAVGSATVPMRLDA
Ga0193721_106988733300020018SoilRMLDTLWRRRLLIRYDNAYVAVGSATGGSTQMRLDA
Ga0206356_1006820033300020070Corn, Switchgrass And Miscanthus RhizosphereVGADVADATGLSCEAADRMLDTLWRRRLVIRHDSAYVAVGSATTPAESARLDA
Ga0193719_1011672313300021344SoilGLEERQAWEIISQLGTGVGADVADAIGLSRVDADRMLDTLWRRRLLIRYDNAYVAVGSATVDSQPTRLDA
Ga0193719_1022487933300021344SoilAERMLDTLWRRRLLIRYDNGYVAVGSATIPSHPSSLDA
Ga0193698_101270913300021968SoilRAWEIISQLGAGVGADVADAIGLSSDAADRMLDMLWRRRLLIRYDNAYVAVGAAVVPTHPSSLGA
Ga0224452_100708413300022534Groundwater SedimentVADAIGLSRDDAERMLDTLWRRRLVIRYDSAYVAVGSATIPSHPIRLDS
Ga0247676_103366633300024249SoilADVADAIGLSRVDADRMLDTLWRRRLLIRYDNAYVAVGSATVESQPTRLDA
Ga0207662_1076258233300025918Switchgrass RhizosphereGAVADVAERTGLSRDVTERMLDMLWRRRLLIRYDDGYVAVGSATARPEPQLDA
Ga0207649_1074758313300025920Corn RhizosphereGVGADVADAAGISCEAADRTLDTLWRRRLVIRHDSGYVAVGSATAPAQSVRLDA
Ga0207646_1015568213300025922Corn, Switchgrass And Miscanthus RhizosphereSHLGAGVSADVADVIGLSRDAAERMLDTLWRRRLLIRYDNAYVAVGSATGASAPASLDT
Ga0207690_1102813233300025932Corn RhizosphereDVADAAGISCEAADRTLDTLWRRRLVIRHDSGYVAVGSATAPAQSVRLDA
Ga0207708_1008840513300026075Corn, Switchgrass And Miscanthus RhizosphereAGAVADVAEATGLSRDAAERMLDTLWRRRLLIRYDDGYVAVGSATTRTEPMRLDA
Ga0209880_103179033300026271SoilISQLGTGISADVADAIGLSRDDAERMLDTLWRRRLLIRYDNAYVAVGSASIPSQPTRLDP
Ga0209027_130790313300026300Grasslands SoilEATGLSSDAAERMLDTLWRRRLVIRYDDGYVAVGSATTRSEPQRLDA
Ga0209160_102142363300026532SoilGLSRDAAERMLDTLWRRRLLIRYDDGYVAVGSATTRSEPLRLDA
Ga0209577_1049735813300026552SoilTKATGLSKDAAERMLDTLWRRRLLIRYDDGYVAVGTATPRSESQRLDA
Ga0209733_108114933300027591Forest SoilMLDTLWRRRLLIRYDKGYVAVGSATGTSTPMRLDA
Ga0209486_1098099133300027886Agricultural SoilATAIGLSDDAAERMLDTLWRRRLVIRYDDGYVAVGSVTAPPQETRLDA
Ga0137415_1005739013300028536Vadose Zone SoilATGLSRDDAEIMLDKLWRRRLLIRYDNAYVAVGSATITSAAMRLDA
Ga0307293_1015192913300028711SoilISRLGSGVSADVAEAIGLSPADAESMLDTLWRRRLVIRYDSAYVAVGSAAEPSRLDA
Ga0307293_1030952723300028711SoilGSRLVGIVGVKERKAWEIISQLGSGVSADVADAIGLSRDDAEQMLDTLWRRRLVIRYDSAYVAVGSATEPMRLDA
Ga0307313_1010804013300028715SoilRKAWEIISQLGSGVSADVADAIGLSRDDAEQMLDTLWRRRLVIRYDSAYVAVGSATVPMRLDA
Ga0307280_1015748313300028768SoilSGVSADVADAIGLSRDDAERMLDTLWRRRLVIRYDSAYVAVGSATEPMRLDA
Ga0307299_1027808413300028793SoilGSGVSADVADAIGLSPADAERMLDTLWRRRLVIRYDSAYVAVGSAAEPSRLDA
Ga0307284_1015366113300028799SoilDAIGLSRDDAERMLDTLWRRRLVIRYDNGYVAVGSATIPSVPMRLDA
Ga0307284_1016929333300028799SoilSRLVGIVGVKERKAWEIISQLGSGVSADVADAIGLSRDDAERMLDTLWRRRLVIRYDSAYVAVGSATEPMRLDA
Ga0307284_1020270333300028799SoilAEVADATGLSREHAERMLNILWRRRLVIRHENGYIAVGSATGAVEPMRLDA
Ga0307296_1066969813300028819SoilEIISQLGSGVSADVAEAIGLSRDDAERMLDTLWRRRLVIRYDSAYVAVGSATEPMRLDA
Ga0307312_1050991233300028828SoilNISQLGSGVSADVADAIGLSPADAESMLDTLWRRRLVIRYDSAYVAVGSAAEPMRLDA
Ga0307289_1025530513300028875SoilIGLSRDDAERMLDTLWRRRLVIRYDSAYVAVGSATEPMRLDA
Ga0307286_1028691223300028876SoilRLVGIVGVKERKAWEIISQLGSGVSADVADAIGLSPADAESMLDTLWRRRLVIRYDSAYVAVGSAAEPMRLDA
Ga0307308_1018588513300028884SoilADAIGLSRDDAERMLDTLWRRRLVIRYDSAYVAVGSATEPMRLDA
Ga0307308_1024383333300028884SoilVEERKAWEIISQLGAGISADVADATGISRDDAERMLDTLWRRRLVIRYDNAYVAVGSASVGTDSMRLDA
Ga0307304_1008541213300028885SoilRRAWEIISQLGTGVGADVADAIGLSRVDADRMLDTLWRRRLLIRYDNAYVAVGSATVDSQPTRLDA
Ga0307304_1032166933300028885SoilADATGISCEAADRTLDTLWRRRLVIRHDSAYVAVGSATAPAESMRLDA
Ga0307304_1033792333300028885SoilRAWEIISHLGAGVSADVAEVIGLTSDAAERMLDTLWRRRLLIRYDNAYVAVGSATGGSTQMRLDA
Ga0073994_1002790733300030991SoilGLSRVDADRMLDTLWRRRLLIRYDNAYVAVGSATVDSQPTRLDA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.