NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metatranscriptome Family F094853

Metatranscriptome Family F094853

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F094853
Family Type Metatranscriptome
Number of Sequences 105
Average Sequence Length 105 residues
Representative Sequence MTAFLPSFDTLYSSAKDPAKAMANLQRMPADAKAQAVAFLTWRRKMEQDLGNRLVSISKGRERLEPQVVFGDPRVQAVLGLLGQRILWASTLFDGFMK
Number of Associated Samples 81
Number of Associated Scaffolds 105

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 22.86 %
% of genes near scaffold ends (potentially truncated) 73.33 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 68
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(95.238 % of family members)
Environment Ontology (ENVO) Unclassified
(99.048 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(97.143 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 64.29%    β-sheet: 0.00%    Coil/Unstructured: 35.71%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300008998|Ga0103502_10265471All Organisms → cellular organisms → Eukaryota631Open in IMG/M
3300009022|Ga0103706_10123843All Organisms → cellular organisms → Eukaryota618Open in IMG/M
3300009274|Ga0103878_1043360All Organisms → cellular organisms → Eukaryota528Open in IMG/M
3300018579|Ga0192922_1014110All Organisms → cellular organisms → Eukaryota580Open in IMG/M
3300018612|Ga0193121_1037752All Organisms → cellular organisms → Eukaryota613Open in IMG/M
3300018616|Ga0193064_1022450All Organisms → cellular organisms → Eukaryota581Open in IMG/M
3300018626|Ga0192863_1021456All Organisms → cellular organisms → Eukaryota827Open in IMG/M
3300018626|Ga0192863_1023795All Organisms → cellular organisms → Eukaryota779Open in IMG/M
3300018639|Ga0192864_1023325All Organisms → cellular organisms → Eukaryota883Open in IMG/M
3300018639|Ga0192864_1025929All Organisms → cellular organisms → Eukaryota846Open in IMG/M
3300018639|Ga0192864_1027308All Organisms → cellular organisms → Eukaryota828Open in IMG/M
3300018648|Ga0193445_1047561All Organisms → cellular organisms → Eukaryota544Open in IMG/M
3300018654|Ga0192918_1049487All Organisms → cellular organisms → Eukaryota631Open in IMG/M
3300018676|Ga0193137_1065087All Organisms → cellular organisms → Eukaryota523Open in IMG/M
3300018680|Ga0193263_1044475All Organisms → cellular organisms → Eukaryota597Open in IMG/M
3300018700|Ga0193403_1039576All Organisms → cellular organisms → Eukaryota707Open in IMG/M
3300018703|Ga0193274_1030867All Organisms → cellular organisms → Eukaryota567Open in IMG/M
3300018706|Ga0193539_1069980All Organisms → cellular organisms → Eukaryota542Open in IMG/M
3300018706|Ga0193539_1073808All Organisms → cellular organisms → Eukaryota521Open in IMG/M
3300018711|Ga0193069_1040205All Organisms → cellular organisms → Eukaryota564Open in IMG/M
3300018715|Ga0193537_1058454All Organisms → cellular organisms → Eukaryota795Open in IMG/M
3300018715|Ga0193537_1088148All Organisms → cellular organisms → Eukaryota588Open in IMG/M
3300018721|Ga0192904_1057290All Organisms → cellular organisms → Eukaryota591Open in IMG/M
3300018731|Ga0193529_1075828All Organisms → cellular organisms → Eukaryota586Open in IMG/M
3300018751|Ga0192938_1081010All Organisms → cellular organisms → Eukaryota615Open in IMG/M
3300018751|Ga0192938_1082625All Organisms → cellular organisms → Eukaryota606Open in IMG/M
3300018756|Ga0192931_1086524All Organisms → cellular organisms → Eukaryota585Open in IMG/M
3300018767|Ga0193212_1075578All Organisms → cellular organisms → Eukaryota505Open in IMG/M
3300018770|Ga0193530_1061315All Organisms → cellular organisms → Eukaryota727Open in IMG/M
3300018770|Ga0193530_1093340All Organisms → cellular organisms → Eukaryota553Open in IMG/M
3300018783|Ga0193197_1071894All Organisms → cellular organisms → Eukaryota510Open in IMG/M
3300018784|Ga0193298_1083236All Organisms → cellular organisms → Eukaryota579Open in IMG/M
3300018789|Ga0193251_1120619All Organisms → cellular organisms → Eukaryota638Open in IMG/M
3300018795|Ga0192865_10081787All Organisms → cellular organisms → Eukaryota550Open in IMG/M
3300018796|Ga0193117_1064469All Organisms → cellular organisms → Eukaryota602Open in IMG/M
3300018797|Ga0193301_1099710All Organisms → cellular organisms → Eukaryota562Open in IMG/M
3300018803|Ga0193281_1066173All Organisms → cellular organisms → Eukaryota708Open in IMG/M
3300018803|Ga0193281_1078318All Organisms → cellular organisms → Eukaryota638Open in IMG/M
3300018812|Ga0192829_1073833All Organisms → cellular organisms → Eukaryota648Open in IMG/M
3300018819|Ga0193497_1097635All Organisms → cellular organisms → Eukaryota526Open in IMG/M
3300018823|Ga0193053_1071441All Organisms → cellular organisms → Eukaryota554Open in IMG/M
3300018835|Ga0193226_1102607All Organisms → cellular organisms → Eukaryota637Open in IMG/M
3300018836|Ga0192870_1037243All Organisms → cellular organisms → Eukaryota839Open in IMG/M
3300018854|Ga0193214_1105055All Organisms → cellular organisms → Eukaryota507Open in IMG/M
3300018863|Ga0192835_1097149All Organisms → cellular organisms → Eukaryota566Open in IMG/M
3300018884|Ga0192891_1142576All Organisms → cellular organisms → Eukaryota549Open in IMG/M
3300018887|Ga0193360_1134637All Organisms → cellular organisms → Eukaryota539Open in IMG/M
3300018919|Ga0193109_10185762All Organisms → cellular organisms → Eukaryota582Open in IMG/M
3300018921|Ga0193536_1185914All Organisms → cellular organisms → Eukaryota788Open in IMG/M
3300018921|Ga0193536_1216863All Organisms → cellular organisms → Eukaryota695Open in IMG/M
3300018921|Ga0193536_1302576All Organisms → cellular organisms → Eukaryota511Open in IMG/M
3300018934|Ga0193552_10205251All Organisms → cellular organisms → Eukaryota556Open in IMG/M
3300018950|Ga0192892_10247305All Organisms → cellular organisms → Eukaryota556Open in IMG/M
3300018953|Ga0193567_10170830All Organisms → cellular organisms → Eukaryota692Open in IMG/M
3300018953|Ga0193567_10200655All Organisms → cellular organisms → Eukaryota617Open in IMG/M
3300018957|Ga0193528_10246395All Organisms → cellular organisms → Eukaryota621Open in IMG/M
3300018958|Ga0193560_10226339All Organisms → cellular organisms → Eukaryota572Open in IMG/M
3300018959|Ga0193480_10198183All Organisms → cellular organisms → Eukaryota595Open in IMG/M
3300018960|Ga0192930_10302192All Organisms → cellular organisms → Eukaryota519Open in IMG/M
3300018961|Ga0193531_10229992All Organisms → cellular organisms → Eukaryota680Open in IMG/M
3300018963|Ga0193332_10237777All Organisms → cellular organisms → Eukaryota561Open in IMG/M
3300018964|Ga0193087_10172229All Organisms → cellular organisms → Eukaryota699Open in IMG/M
3300018965|Ga0193562_10089134All Organisms → cellular organisms → Eukaryota875Open in IMG/M
3300018965|Ga0193562_10173511All Organisms → cellular organisms → Eukaryota609Open in IMG/M
3300018965|Ga0193562_10193495All Organisms → cellular organisms → Eukaryota568Open in IMG/M
3300018969|Ga0193143_10103696All Organisms → cellular organisms → Eukaryota833Open in IMG/M
3300018978|Ga0193487_10229117All Organisms → cellular organisms → Eukaryota597Open in IMG/M
3300018979|Ga0193540_10122823All Organisms → cellular organisms → Eukaryota726Open in IMG/M
3300018979|Ga0193540_10149533All Organisms → cellular organisms → Eukaryota654Open in IMG/M
3300018985|Ga0193136_10254363All Organisms → cellular organisms → Eukaryota521Open in IMG/M
3300018987|Ga0193188_10070954All Organisms → cellular organisms → Eukaryota578Open in IMG/M
3300018988|Ga0193275_10173841All Organisms → cellular organisms → Eukaryota663Open in IMG/M
3300018989|Ga0193030_10247933All Organisms → cellular organisms → Eukaryota584Open in IMG/M
3300018992|Ga0193518_10204953All Organisms → cellular organisms → Eukaryota754Open in IMG/M
3300018993|Ga0193563_10156133All Organisms → cellular organisms → Eukaryota771Open in IMG/M
3300018993|Ga0193563_10249792All Organisms → cellular organisms → Eukaryota550Open in IMG/M
3300018994|Ga0193280_10284282All Organisms → cellular organisms → Eukaryota615Open in IMG/M
3300018994|Ga0193280_10326533All Organisms → cellular organisms → Eukaryota553Open in IMG/M
3300018998|Ga0193444_10150624All Organisms → cellular organisms → Eukaryota615Open in IMG/M
3300018999|Ga0193514_10207078All Organisms → cellular organisms → Eukaryota703Open in IMG/M
3300018999|Ga0193514_10251956All Organisms → cellular organisms → Eukaryota617Open in IMG/M
3300019005|Ga0193527_10409960All Organisms → cellular organisms → Eukaryota512Open in IMG/M
3300019008|Ga0193361_10243822All Organisms → cellular organisms → Eukaryota644Open in IMG/M
3300019008|Ga0193361_10245137All Organisms → cellular organisms → Eukaryota642Open in IMG/M
3300019011|Ga0192926_10492485All Organisms → cellular organisms → Eukaryota506Open in IMG/M
3300019013|Ga0193557_10277688All Organisms → cellular organisms → Eukaryota515Open in IMG/M
3300019018|Ga0192860_10294056All Organisms → cellular organisms → Eukaryota587Open in IMG/M
3300019018|Ga0192860_10294080All Organisms → cellular organisms → Eukaryota587Open in IMG/M
3300019018|Ga0192860_10355104All Organisms → cellular organisms → Eukaryota515Open in IMG/M
3300019019|Ga0193555_10230575All Organisms → cellular organisms → Eukaryota606Open in IMG/M
3300019024|Ga0193535_10150068All Organisms → cellular organisms → Eukaryota756Open in IMG/M
3300019024|Ga0193535_10206520All Organisms → cellular organisms → Eukaryota623Open in IMG/M
3300019026|Ga0193565_10231551All Organisms → cellular organisms → Eukaryota645Open in IMG/M
3300019026|Ga0193565_10278344All Organisms → cellular organisms → Eukaryota563Open in IMG/M
3300019030|Ga0192905_10195938All Organisms → cellular organisms → Eukaryota556Open in IMG/M
3300019044|Ga0193189_10138928All Organisms → cellular organisms → Eukaryota580Open in IMG/M
3300019052|Ga0193455_10385421All Organisms → cellular organisms → Eukaryota578Open in IMG/M
3300019134|Ga0193515_1071733All Organisms → cellular organisms → Eukaryota604Open in IMG/M
3300019144|Ga0193246_10148371All Organisms → cellular organisms → Eukaryota822Open in IMG/M
3300019144|Ga0193246_10258942All Organisms → cellular organisms → Eukaryota530Open in IMG/M
3300019152|Ga0193564_10205594All Organisms → cellular organisms → Eukaryota592Open in IMG/M
3300019152|Ga0193564_10213438All Organisms → cellular organisms → Eukaryota577Open in IMG/M
3300031522|Ga0307388_11103103All Organisms → cellular organisms → Eukaryota539Open in IMG/M
3300031709|Ga0307385_10278911All Organisms → cellular organisms → Eukaryota636Open in IMG/M
3300031738|Ga0307384_10427066All Organisms → cellular organisms → Eukaryota620Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine95.24%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine2.86%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.95%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.95%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300008998Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_A100000548EnvironmentalOpen in IMG/M
3300009022Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S1EnvironmentalOpen in IMG/M
3300009274Eukaryotic communities of water from the North Atlantic ocean - ACM10EnvironmentalOpen in IMG/M
3300018579Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000845 (ERX1782161-ERR1712236)EnvironmentalOpen in IMG/M
3300018612Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001006 (ERX1782446-ERR1711922)EnvironmentalOpen in IMG/M
3300018616Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_138 - TARA_N000003003 (ERX1782367-ERR1711877)EnvironmentalOpen in IMG/M
3300018626Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000790 (ERX1789512-ERR1719180)EnvironmentalOpen in IMG/M
3300018639Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000791 (ERX1782310-ERR1712181)EnvironmentalOpen in IMG/M
3300018648Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002360 (ERX1782304-ERR1712027)EnvironmentalOpen in IMG/M
3300018654Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000841 (ERX1782169-ERR1712180)EnvironmentalOpen in IMG/M
3300018676Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_020 - TARA_A100000761 (ERX1782202-ERR1711913)EnvironmentalOpen in IMG/M
3300018680Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001123 (ERX1789497-ERR1719250)EnvironmentalOpen in IMG/M
3300018700Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_124 - TARA_N000002043 (ERX1789597-ERR1719175)EnvironmentalOpen in IMG/M
3300018703Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001580 (ERX1782405-ERR1712108)EnvironmentalOpen in IMG/M
3300018706Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002813 (ERX1789488-ERR1719151)EnvironmentalOpen in IMG/M
3300018711Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_143 - TARA_N000003139 (ERX1782287-ERR1712099)EnvironmentalOpen in IMG/M
3300018715Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002809 (ERX1789494-ERR1719339)EnvironmentalOpen in IMG/M
3300018721Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000666 (ERX1789483-ERR1719260)EnvironmentalOpen in IMG/M
3300018731Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_151 - TARA_N000002755 (ERX1782345-ERR1712158)EnvironmentalOpen in IMG/M
3300018751Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_078 - TARA_N000001514 (ERX1789607-ERR1719173)EnvironmentalOpen in IMG/M
3300018756Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000879 (ERX1789481-ERR1719268)EnvironmentalOpen in IMG/M
3300018767Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000075 (ERX1782420-ERR1711944)EnvironmentalOpen in IMG/M
3300018770Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002783 (ERX1789454-ERR1719490)EnvironmentalOpen in IMG/M
3300018783Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000011 (ERX1782442-ERR1712209)EnvironmentalOpen in IMG/M
3300018784Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001620 (ERX1789528-ERR1719403)EnvironmentalOpen in IMG/M
3300018789Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001380 (ERX1809763-ERR1740128)EnvironmentalOpen in IMG/M
3300018795Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000791 (ERX1782279-ERR1712192)EnvironmentalOpen in IMG/M
3300018796Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_004 - TARA_X000000410 (ERX1789505-ERR1719432)EnvironmentalOpen in IMG/M
3300018797Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001622 (ERX1809762-ERR1740131)EnvironmentalOpen in IMG/M
3300018803Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001586 (ERX1789721-ERR1719184)EnvironmentalOpen in IMG/M
3300018812Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000065 (ERX1789716-ERR1719392)EnvironmentalOpen in IMG/M
3300018819Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002940 (ERX1789719-ERR1719288)EnvironmentalOpen in IMG/M
3300018823Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002285 (ERX1789533-ERR1719243)EnvironmentalOpen in IMG/M
3300018835Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_047 - TARA_N000000284 (ERX1782152-ERR1712198)EnvironmentalOpen in IMG/M
3300018836Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000807 (ERX1789715-ERR1719504)EnvironmentalOpen in IMG/M
3300018854Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000076 (ERX1789602-ERR1719346)EnvironmentalOpen in IMG/M
3300018863Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000581 (ERX1789689-ERR1719283)EnvironmentalOpen in IMG/M
3300018884Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000709 (ERX1789629-ERR1719186)EnvironmentalOpen in IMG/M
3300018887Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001826 (ERX1789534-ERR1719462)EnvironmentalOpen in IMG/M
3300018919Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_139 - TARA_N000003043 (ERX1789401-ERR1719342)EnvironmentalOpen in IMG/M
3300018921Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002809 (ERX1789458-ERR1719341)EnvironmentalOpen in IMG/M
3300018934Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_144 - TARA_N000003183EnvironmentalOpen in IMG/M
3300018950Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000711 (ERX1789413-ERR1719427)EnvironmentalOpen in IMG/M
3300018953Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_151 - TARA_N000002753EnvironmentalOpen in IMG/M
3300018957Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_151 - TARA_N000002755 (ERX1782215-ERR1712088)EnvironmentalOpen in IMG/M
3300018958Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_144 - TARA_N000003191EnvironmentalOpen in IMG/M
3300018959Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002199 (ERX1789530-ERR1719318)EnvironmentalOpen in IMG/M
3300018960Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000879 (ERX1789423-ERR1719357)EnvironmentalOpen in IMG/M
3300018961Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002783 (ERX1789414-ERR1719458)EnvironmentalOpen in IMG/M
3300018963Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001796 (ERX1789664-ERR1719481)EnvironmentalOpen in IMG/M
3300018964Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000939 (ERX1782328-ERR1712130)EnvironmentalOpen in IMG/M
3300018965Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_149 - TARA_N000002141EnvironmentalOpen in IMG/M
3300018969Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000539 (ERX1782234-ERR1712179)EnvironmentalOpen in IMG/M
3300018978Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_136 - TARA_N000002965 (ERX1789639-ERR1719422)EnvironmentalOpen in IMG/M
3300018979Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782403-ERR1712037)EnvironmentalOpen in IMG/M
3300018985Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_020 - TARA_A100000761 (ERX1782416-ERR1711874)EnvironmentalOpen in IMG/M
3300018987Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_038 - TARA_N000000041 (ERX1789590-ERR1719255)EnvironmentalOpen in IMG/M
3300018988Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001580 (ERX1782315-ERR1711974)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300018992Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_146 - TARA_N000003240 (ERX1789485-ERR1719233)EnvironmentalOpen in IMG/M
3300018993Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_150 - TARA_N000002703EnvironmentalOpen in IMG/M
3300018994Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001586 (ERX1789578-ERR1719368)EnvironmentalOpen in IMG/M
3300018998Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002360 (ERX1782428-ERR1712117)EnvironmentalOpen in IMG/M
3300018999Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003100 (ERX1782275-ERR1712038)EnvironmentalOpen in IMG/M
3300019005Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_148 - TARA_N000002119 (ERX1789730-ERR1719193)EnvironmentalOpen in IMG/M
3300019008Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001826 (ERX1789684-ERR1719447)EnvironmentalOpen in IMG/M
3300019011Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000871 (ERX1782184-ERR1712079)EnvironmentalOpen in IMG/M
3300019013Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003089EnvironmentalOpen in IMG/M
3300019018Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000981 (ERX1789537-ERR1719348)EnvironmentalOpen in IMG/M
3300019019Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002929EnvironmentalOpen in IMG/M
3300019024Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002797 (ERX1789427-ERR1719237)EnvironmentalOpen in IMG/M
3300019026Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_150 - TARA_N000002719EnvironmentalOpen in IMG/M
3300019030Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000666 (ERX1789399-ERR1719153)EnvironmentalOpen in IMG/M
3300019044Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_038 - TARA_N000000041 (ERX1789478-ERR1719328)EnvironmentalOpen in IMG/M
3300019052Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_132 - TARA_N000002402 (ERX1789503-ERR1719228)EnvironmentalOpen in IMG/M
3300019134Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003100 (ERX1782286-ERR1712165)EnvironmentalOpen in IMG/M
3300019144Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001503 (ERX1789695-ERR1719376)EnvironmentalOpen in IMG/M
3300019152Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_150 - TARA_N000002717EnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031709Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0103502_1026547113300008998MarineMTAYLPSFDSLYSSAKDPAKAMANLQKMPADAKARAVAFLVWRRKMEQDLGNRLVGISKGREHLEPRVIFGDQRVQAVLGLLGQRILWASTLFDGLMK*
Ga0103706_1012384313300009022Ocean WaterMTAYLPSFDSLYSSAKDPAKAMANLQKMPADAKARAVAFLVWRRKMEQDLGNRLVAISKGREHLEPRIIFGDQRVQAVLGLLGQRILWASTLFDGLMK*
Ga0103878_104336013300009274Surface Ocean WaterMTAFLPSFDTLYSSAKDPAKAMANLQRMPADAKAQAVAFLTWRRKMEQDLGNRLVSISKGRERLEPQVVFGDPRVQAVLGLLGQRILWASTLFDGFMK*
Ga0192922_101411013300018579MarineIGGGNISLFGIMTAFLPSFDTLYSSAKDPAKAMANLQRMPADAKAQAVAFLTWRRKMEQDLGNRLVSISKGRERLEPQVVFGDPRVQAVLGLLGQRILWASTLFDGFMK
Ga0193121_103775213300018612MarineMGSRSGRRASIGGGNISLFGIMTAFLPSFDTLYSSAKDPAKAMANLQRMPADAKAQAVAFLTWRRKMEQDLGNRLVSISKGRERLEPQVVFGDPRVQAVLGLLGQRILWASTLFDGFMK
Ga0193064_102245013300018616MarineTWGSRPGQTASIGGGNNSLSGTMTAFLPSFDTLYSSAKDPAKAMANLQRMPADAKAQAVAFLTWRRKMEQDLGNRLVSISKGRERLEPQVVFGDPRVQAVLGLLGQRILWASTLFDGFMK
Ga0192863_102145623300018626MarineVEAMTAFLPSFDSLYSSAKDPAKAMSNLQQMPADAKAKAVAFLAWRRKMEQDLGNRLVAISKGREHLEPRIVFGDPRVQVVLGLLGQRIIWASTLFDGLM
Ga0192863_102379513300018626MarineVEAMTAFLPSFDSLYSSAKDPAKAMSNLQQMPADAKAKAVAFLAWRRKMEQDLGNRLVAISKGREHLEPRIVFGDPRVQAVLGLLGQRIIWASTLFDGLM
Ga0192864_102332523300018639MarineLDIFGVFVAAMTAFLPSFDSLYSSAKDPAKAMSNLQQMPADAKAKAVAFLAWRRKMEQDLGNRLVAISKGREHLEPRIVFGDPRVQVVLGLLGQRIIWASTLFDGLM
Ga0192864_102592913300018639MarineLDIFGVFVAAMTAFLPSFDSLYSSAKDPAKAMSNLQQMPADAKAKAVAFLAWRRKMEQDLGNRLVAISKGREHLEPRIVFGDPRVQAVLGLLGQRIIWASTLFDGLM
Ga0192864_102730813300018639MarineLDIFGVFVAAMTAFLPSFDSLYSSAKDPAKAMSNLQQMPADAKAKAVAFLAWRRKMEQDLGNRLVAISKGREHLEPRIVFGDPRVQAVLGLLGQRIIWASTLFDGLMK
Ga0193445_104756113300018648MarineMGSRSGQTASIGGGNILLFGIMTAFLPSFDTLYSSAKDPAKAMANLQRMPADAKAQAVAFLTWRRKMEQDLGNRLVSISKGRERLEPQVVFGDPRVQAVLGLLGQRILWASTLFDGFMK
Ga0192918_104948713300018654MarineTWGSRSGRRASIGGGNISLFGIMTAFLPSFDTLYSSAKDPAKAMANLQRMPADAKAQAVAFLTWRRKMEQDLGNRLVSISKGRERLEPQVVFGDPRVQAVLGLLGQRILWASTLFDGFMK
Ga0193137_106508713300018676MarineSFDTLYSSAKDPAKAMANLQRMPADAKAQAVAFLTWRRKMEQDLGNRLVSISKGRERLEPQVVFGDPRVQAVLGLLGQRILWASTLFDGFMK
Ga0193263_104447523300018680MarineMTAYLPSFDSLYSSAKDPAKAMANLQKMPADAKARAVAFLVWRRKMEQDLGNRLVAISKGREHLEPRVIFGDQRVQAVLGLLGQRILWASTLFDGLMK
Ga0193403_103957613300018700MarineMAAYLPSFDSLFSSAKDPAKAMANLQKMPADAKARAIAFLTWRRKMEQDLGNRLVAISKGRERLEPQVIFGDPRVQAVLGLLGQRILWASTLFDGLMK
Ga0193274_103086713300018703MarineAPATCNLPFLDPAKAMANLQNMPADAKARAIAFLTWRRKMEQDLGNRLVAISKGREHLEPRVIFGDPRVQAVLGLLGQRILWASTLFDGLMK
Ga0193539_106998013300018706MarineMTAYLPSFDSLYSSAKDPAKAMANLQKMPADAKARAVAFLVWRRKMEQDLGNRLVGISKGREHLEPRVIFGDQRVQAVLGLLGQRILWASTLFDGLMK
Ga0193539_107380813300018706MarineLLLLDSLLQEILDICGNTCAAMTAFLPSFDSLYSSAKDPATTMSNLQKMPAEAKAKAVAFLAWRRKMEQDLGNRLVAISKGREHLEPRIVFGDPRVQAVLGLLGQRILWASTLFDGFMK
Ga0193069_104020513300018711MarineNISLFGIMTAFLPSFDTLYSSAKDPAKAMANLQRMPADAKAQAVAFLTWRRKMEQDLGNRLVSISKGRERLEPQVVFGDPRVQAVLGLLGQRILWASTLFDGFMK
Ga0193537_105845413300018715MarineGSTCAAMTAFLPSFDSLYSSAKDPAKAMSNLQKMPAEAKAKAVAFLAWRRKMEQDLGNRLVAISKGREHLEPRIVFGDPRVQAVLGLLGQRILWASTLFDGFMK
Ga0193537_108814813300018715MarineMTAYLPSFDSLYSSAKDPAKAMANLQKMPADAKARAVAFLVWRRKMEQDLGNRLVAISKGREHLEPRIIFGDQRVQAVLGLLGQRILWASTLFDGLMK
Ga0192904_105729013300018721MarineRRASIGGGNISLFGIMTAFLPSFDTLYSSAKDPAKAMANLQRMPADAKAQAVAFLTWRRKMEQDLGNRLVSISKGRERLEPQVVFGDPRVQAVLGLLGQRILWASTLFDGFMK
Ga0193529_107582813300018731MarineMGSLSGQTASLGGGNISLFGIMTAFLPSFDTLYSSAKDPAKAMANLQRMPADAKAQAVAFLTWRRKMEQDLGNRLVSISKGRERLEPQVVFGDARVQAVLGLLGQRILWASTLFDGFMK
Ga0192938_108101013300018751MarineMTAFLPSFDSLYSSAKDPATTMSNLQKMPAEAKAKAVAFLAWRRKMEQDLGNRLVAISKGREHLEPRIVFGDPRVQAVLGLLGQRILWASTLFDGFMK
Ga0192938_108262513300018751MarineLLLDSLLQEILDICGNTCAAMTAFLPSFDSLYSSAKDPATTMSNLQKMPAEAKAKAVAFLAWRRKMEQDLGNRLVAISKGREHLEPRIVFGDPRVQAVLGLLGQRILWASTLFDGFMK
Ga0192931_108652413300018756MarineSLGGGNISLFGIMTAFLPSFDTLYSSAKDPAKAMANLQRMPADAKAQAVAFLTWRRKMEQDLGNRLVSISKGRERLEPQVVFGDPRVQAVLGLLGQRILWASTLFDGFMK
Ga0193212_107557813300018767MarinePAKAMANLQRMPADAKAQAVAFLTWRRKMEQDLGNRLVSISKGRERLEPQVVFGDPRVQAVLGLLGQRILWASTLFDGFMK
Ga0193530_106131523300018770MarineKLLLLDSLLQEILDICGNTCAAMTAFLPSFDSLYSSAKDPATTMSNLQKMPAEAKAKAVAFLAWRRKMEQDLGNRLVAISKGREHLEPRIVFGDPRVQAVLGLLGQRILWASTLFDGFMK
Ga0193530_109334013300018770MarineSSAKDPAKAMANLQKMPADAKARAVAFLVWRRKMEQDLGNRLVGISKGREHLEPRVIFGDQRVQAVLGLLGQRILWASTLFDRLMK
Ga0193197_107189413300018783MarineSSAKDPAKAMANLQRMPADAKAQAVAFLTWRRKMEQDLGNRLVSISKGRERLEPQVVFGDPRVQAVLGLLGQRILWASTLFDGFMK
Ga0193298_108323613300018784MarineQTASIGGGNISLFGIMTAFLPSFDTLYSSAKDPAKAMANLQRMPADAKAQAVAFLTWRRKMEQDLGNRLVSISKGRERLEPQVVFGDPRVQAVLGLLGQRILWASTLFDGFMK
Ga0193251_112061923300018789MarineLLLDSLLQEIFLIFVGAMTAYIPSFDSLCASAKDPAKAMANLQKMTADSKARAIDILAWRKKMEQDLGNRLVAISKGRELLEPRIIFGDARVQAVLGLLGQRILWASTLFDGLIK
Ga0192865_1008178713300018795MarineVEAMTAFLPSFDSLYSSAKDPAKAMSNLQQMPADAKAKAVAFLAWRRKMEQDLGNRLVAISKGREHLEPRIVFGDPRVQAVLGLLGQRIIWASTLFDGLMK
Ga0193117_106446923300018796MarineIWSICAAMTAYLPPFDSLYNSAKDPAKAMANLQKMPADAKARAVAFLVWRRKMEQDLGNRLVGISKGREHLEPRVIFGDQRVQAVLGLLGQRILWASTLFDRLMK
Ga0193301_109971013300018797MarineGGNILLFGIMTAFLPSFDTLYSSAKDPAKAMANLQRMPADAKAQAVAFLTWRRKMEQDLGNRLVSISKGRERLEPQVVFGDPRVQAVLGLLGQRILWASTLFDGFMK
Ga0193281_106617313300018803MarineLLQEILDICGNTCAAMTAFLPSFDSLYSSAKDPATTMSNLQKMPAEAKAKAVAFLAWRRKMEQDLGNRLVAISKGREHLEPRIVFGDPRVQAVLGLLGQRILWASTLFDGFMK
Ga0193281_107831813300018803MarineMAAYLPSFNSLFSSAKDPAKAMANLQNMPADAKARAIAFLTWRRKMEQDLGNRLVAISKGREHLEPRVIFGDPRVQAVLGLLGQRILWASTLFDGLMK
Ga0192829_107383313300018812MarineMTAYLPSFDSLYNSAKDPAKAMANLQKMPADAKARAVAFLVWRRKMEQDLGNRLVAISKGREQIEPRIIFGDRRVQAVLGLLGQRILWASTLFDGLMK
Ga0193497_109763513300018819MarineSGTMTAFLPSFDTLYSSAKDPAKAMANLQRMPADAKAQAVAFLTWRRKMEQDLGNRLVSISKGRERLEPQVVFGDPRVQAVLGLLGQRILWASTLFDGFMK
Ga0193053_107144113300018823MarineASIGGGNISLFGIMTAFLPSFDTLYSSAKDPAKAMANLQRMPADAKAQAVAFLTWRRKMEQDLGNRLVSISKGRERLEPQVVFGDPRVQAVLGLLGQRILWASTLFDGFMK
Ga0193226_110260713300018835MarineHGGSICAAMAAYLPSFDSLFSSAKDPAKAMANLQKMPADAKARAIAFLTWRRKMEQDLGNRLVAISKGRERLEPQVIFGDPRVQAVLGLLGQRILWASTLFDGLMK
Ga0192870_103724313300018836MarineLLLLDSLLQEIDICESTCGAMTAFLPSFDSLYSSAKDPAKAMSNLQQMPADAKAKAVAFLAWRRKMEQDLGNRLVAISKGREHLEPRIVFGDPRVQVVLGLLGQRIIWASTLFDGLM
Ga0193214_110505513300018854MarineGNILLFGIMTAFLPSFDTLYSSAKDPAKAMANLQRMPADAKAQAVAFLTWRRKMEQDLGNRLVSISKGRERLEPQVVFGDPRVQAVLGLLGQRILWASTLFDGFMK
Ga0192835_109714913300018863MarineTASIGGGNNSLSGTMTAFLPSFDTLYSSAKDPAKAMANLQRMPADAKAQAVAFLTWRRKMEQDLGNRLVSISKGRERLEPQVVFGDPRVQAVLGLLGQRILWASTLFDGFMK
Ga0192891_114257613300018884MarineSGSICAAMTAYLPSFDSLYSSAKDPAKAMANLQKMPADAKARAVAFLVWRRKMEQDLGNRLVAISKGREHLEPRIIFGDQRVQAVLGLLGQRILWASTLFDGLMK
Ga0193360_113463713300018887MarineGNISLFGIMTAFLPSFDTLYSSAKDPAKAMANLQRMPADAKAQAVAFLTWRRKMEQDLGNRLVSISKGRERLEPQVVFGDPRVQAVLGLLGQRILWASTLFDGFMK
Ga0193109_1018576213300018919MarineQTASIGGGNNSLSGTMTAFLPSFDTLYSSAKDPAKAMANLQRMPADAKAQAVAFLTWRRKMEQDLGNRLVSISKGRERLEPQVVFGDPRVQAVLGLLGQRILWASTLFDGFMK
Ga0193536_118591413300018921MarineMTAYLPSFDSLYSSAKDPAKAMANLQKMPADAKARAVAFLVWRRKMEQDLGNRLVGISKGREHLEPRVIFGDQRVQAVLGLLGQRILWASTLFDRLMK
Ga0193536_121686313300018921MarineKLLLLDSLLQEILDICGNTCVAMTAFLPSFDSLYSSAKDPAKAMSNLQKMPADAKAKAVAFLAWRRKMEQDLGNRLVAISKGREHLEPRIVFGDPRVQAVLGLLGQRILWASTLFDGFMK
Ga0193536_130257613300018921MarineMTAYLPSFDSLFSSAKDPAKAMANLQKMPADAKARAVAFLVWRRKMEQDLGNRLVGISKGREHLEPRVIFGDQRVQAVLGLLGQRILWASTLFDGLMK
Ga0193552_1020525113300018934MarineIMTAFLPSFDTLYSSAKDPAKAMANLQRMPADAKAQAVAFLTWRRKMEQDLGNRLVSISKGRERLEPQVVFGDPRVQAVLGLLGQRILWASTLFDGFMK
Ga0192892_1024730513300018950MarineSFYCLIHFYKSILDICGSICAAMTAYLPSFDSLYSSAKDPAKAMANLQKMPADAKARAVAFLVWRRKMEQDLGNRLVAISKGREHLEPRIIFGDQRVQAVLGLLGQRILWASTLFDGLMK
Ga0193567_1017083013300018953MarineMTAFLPSFDTLYSSAKDPAKAMANLQRMPADAKAQAVAFLTWRRKMEQDLGNRLVSISKGRERLEPQVVFGDARVQAVLGLLGQRILWASTLFDGFMK
Ga0193567_1020065513300018953MarineMTAYLPSFDSLYSSAKDPAKAMANLQKMPADAKARAIAFLTWRRKMEQDLGNRLVAISKGREHLEPRVIFGDPRVQAVLGLLGQRILWASTLFDGLMK
Ga0193528_1024639513300018957MarineGSRSGRRASIGVGNISLFGIMTAFLPSFDTLYSSAKDPAKAMANLQRMPADAKAQAVAFLTWRRKMEQDLGNRLVSISKGRERLEPQVVFGDARVQAVLGLLGQRILWASTLFDGFMK
Ga0193560_1022633913300018958MarineERRASIGGGNISLFGIMTAFLPSFDTLYSSAKDPAKAMANLQRMPADAKAQAVAFLTWRRKMEQDLGNRLVSISKGRERLEPQVVFGDPRVQAVLGLLGQRILWASTLFDGFMK
Ga0193480_1019818313300018959MarineQTASIGGRNISLFGIMTAFLPSFDTLYSSAKDPAKAMANLQRMPADAKAQAVAFLTWRRKMEQDLGNRLVSISKGRERLEPQVVFGDPRVQAVLGLLGQRILWASTLFDGFMK
Ga0192930_1030219213300018960MarineSAKDPAKAMANLQRMPTDAKAQAVAFLTWRRKMEQDLGNRLVSISKGRERLEPQVVFGDPRVQAVLGLLGQRILWASTLFDGFMK
Ga0193531_1022999223300018961MarineMTAFLPSFDSLYSSAKDPAKAMANLQKVPADAKARAVAFLSWRRKMEQDLGNRLVAIGKGRENLEPQVVFGDPRVQAVLGLLGQRILWASTLFDGLINK
Ga0193332_1023777713300018963MarineGQTASIGGGNILLFGIMTAFLPSFDTLYSSAKDPAKAMANLQRMPADAKAQAVAFLTWRRKMEQDLGNRLVSISKGRERLEPQVVFGDPRVQAVLGLLGQRILWASTLFDGFMK
Ga0193087_1017222913300018964MarinePAKAMANLQKMPADAKARAVAFLAWRRKMEQDLGNRLVAISKGREQIEPRIIFGDRRVQAVLGLLGQRILWASTLFDGLMK
Ga0193562_1008913413300018965MarineMTAFLPSFDSLYSSAKDPAKAMSNLQKMPADAKAKAVAFLAWRRKMEQDLGNRLVAISKGREHLEPRIVFGDPRVQAVLGLLGQRILWASTLFDGFMK
Ga0193562_1017351113300018965MarineMGSLSGQTASLGGGNISLFGIMTAFLPSFDTLYSSAKDPAKAMANLQRMPADAKAQAVAFLTWRRKMEQDLGNRLVSISKGRERLEPQVVFGDPRVQAVLGLLGQRILWASTLFDGFMK
Ga0193562_1019349513300018965MarineTWEAMANLQNMPADAKARAIAFLTWRRKMEQDLGNRLVAISKGREHLEPRVIFGDPRVQAVLGLLGQRILWASTLFDGLMK
Ga0193143_1010369613300018969MarineTWGCAAMTAYLPSFDSLYSSAKDPAKAMANLQKMPADAKARAVAFLAWRRKMEQDLGNRLVAISKGREQIEPRIIFGDRRVQAVLGLLGQRILWASTLFDGLMK
Ga0193487_1022911713300018978MarineGQTASIGGGNISLFGIMTAFLPSFDTLYSSAKDPAKAMANLQRMPADAKAQAVAFLTWRRKMEQDLGNRLVSISKGRERLEPQVVFGDPRVQAVLGLLGQRILWASTLFDGFMK
Ga0193540_1012282313300018979MarineLIKHEIFDNMNILRYIKDILDLFIWSICAAMTAYLPSFDSLYSSAKDPAKAMANLQKMPADAKARAVAFLVWRRKMEQDLGNRLVGISKGREHLEPRVIFGDQRVQAVLGLLGQRILWASTLFDGLMK
Ga0193540_1014953313300018979MarinePAKAMANLQKMPADAKARAVAFLVWRRKMEQDLGNRLVAISKGREHLEPRIIFGDQRVQAVLGLLGQRILWASTLFDGLMK
Ga0193136_1025436313300018985MarineMANLQNMPADAKARAIAFLTWRRKMEQDLGNRLVAISKGREHLEPRVIFGDPRVQAVLGLLGQRILWASTLFDGLMK
Ga0193188_1007095413300018987MarineQTASIGGGNILLFGIMTAFLPSFDTLYSSAKDPAKAMANLQRMPADAKAQAVAFLTWRRKMEQDLGNRLVSISKGRERLEPQVVFGDPRVQAVLGLLGQRILWASTLFDGFMK
Ga0193275_1017384113300018988MarineHGTRDICGSIWAAMAAYLPSFNSLFSSAKAPATCNLPFLDPAKAMANLQNMPADAKARAIAFLTWRRKMEQDLGNRLVAISKGREHLEPRVIFGDPRVQAVLGLLGQRILWASTLFDGLM
Ga0193030_1024793313300018989MarineKDPAKAMANLQKVPTDAKARAVAFLSWRRKMEQDLGNRLVAIGKGRENLEPQVVFGDPRVQAVLGLLGQRILWASTLFDGLINK
Ga0193518_1020495323300018992MarineKLLLLDSLLQEIDICGSTFAAMTAFLPSFDSLYSSAKDPAKAMSNLQKMPADAKAKAVAFLAWRRKMEQDLGNRLVAISKGREHLEPRIVFGDPRVQAVLGLLGQRILWASTLFDGFMK
Ga0193563_1015613313300018993MarineTKLLLLDSLLQEILDICGNTCAAMTAFLPSFDSLYSSAKDPATTMSNLQKMPAEAKAKAVAFLAWRRKMEQDLGNRLVAISKGREHLEPRIVFGDPRVQAVLGLLGQRILWASTLFDGFM
Ga0193563_1024979213300018993MarineGLGGGNISLFGIMTAFLPSFDTLYSSAKDPAKAMANLQRMPADAKAQAVAFLTWRRKMEQDLGNRLVSISKGRERLEPQVVFGDARVQAVLGLLGQRILWASTLFDGFMK
Ga0193280_1028428213300018994MarineFYCLIHFYKSILDICGSICAAMTAYLPSFDSLYSSAKDPAKAMANLQKMPADAKARAVAFLVWRRKMEQDLGNRLVAISKGREHLEPRIIFGDQRVQAVLGLLGQRILWASTLFDGLMK
Ga0193280_1032653313300018994MarineASLGGGNISLFGIMTAFLPSFDTLYSSAKDPAKAMANLQRMPADAKAQAVAFLTWRRKMEQDLGNRLVSISKGRERLEPQVVFGDPRVQAVLGLLGQRILWASTLFDGFMK
Ga0193444_1015062413300018998MarineMGSRPGQTASIGGGNNSLSGTMTAFLPSFDTLYSSAKDPAKAMANLQRMPADAKAQAVAFLTWRRKMEQDLGNRLVSISKGRERLEPQVVFGDPRVQAVLGLLGQRILWASTLFDGFMK
Ga0193514_1020707813300018999MarineTWESAGNRERQKDLSMTAFLPSFDSLYSSAKDPAKAMANLQKVPADAKARAVAFLSWRRKMEQDLGNRLVAIGKGRENLEPQVVFGDPRVQAVLGLLGQRILWASTLFDGLINK
Ga0193514_1025195623300018999MarineMGSRSGRRASIGVGNISLFGIMTAFLPSFDTLYSSAKDPAKAMANLQRMPADAKAQAVAFLTWRRKMEQDLGNRLVSISKGRERLEPQVVFGDPRVQAVLGLLGQRILWASTLFDGFMK
Ga0193527_1040996013300019005MarineSSAKDPAKAMANLQNMPADAKARAIAFLTWRRKMEQDLGNRLVAISKGREHLEPRVIFGDPRVQAVLGLLGQRILWASTLFDGLMK
Ga0193361_1024382213300019008MarineMAAYLPSFDSLFSSAKDPARAMANLQKMPADAKARAIAFLTWRRKMEQDLGNRLVAISKGREHLEPRVIFGDPRVQAVLGLLGQRILWASTLFDGLMK
Ga0193361_1024513713300019008MarineEILDICGNTCTAMTAFLPFFDSLYSSAKDPATTMSNLQKMPAEAKAKAVAFLAWRRKMEQDLGNRLVAISKGREHLEPRIVFGDPRVQAVLGLLGQRILWASTLFDGFMK
Ga0192926_1049248513300019011MarineLYSSAKDPAKAMANLQKVPADAKARAVAFLSWRRKMEQDLGNRLVAIGKGRENLEPQVVFGDPRVQAVLGLLGQRILWASTLFDGLIYK
Ga0193557_1027768813300019013MarineAAMAAYLPSFDSLFSSAKDPAKAMANLQKMPADAKARAIAFLTWRRKMEQDLGNRLVAISKGREHLEPRVIFGDPRVQAVLGLLGQRILWASTLFDGLMK
Ga0192860_1029405613300019018MarineMAAYLPSFDSLFSSAKDPAKAMANLQKMPADAKARAIAFLTWRRKMEQDLGNRLVAISKGREHLEPRVIFGDPRVQAVLGLLGQRILWASTLFDGLMK
Ga0192860_1029408013300019018MarineMAAYLPSFDSLFSSAKDPAKAMANLQNMPADAKARAIAFLTWRRKMEQDLGNRLVAISKGREHLEPRVIFGDPRVQAVLGLLGQRILWASTLFDGLMK
Ga0192860_1035510413300019018MarineSLFSSAKDPAKAMANLQKMPADAKARAVAFLVWRRKMEQDLGNRLVAISKGREHLEPRIIFGDQRVQAVLGLLGQRILWASTLFDGLMK
Ga0193555_1023057513300019019MarineTASIGGGNILLFGIMTAFLPSFDTLYSSAKDPAKAMANLQRMPADAKAQAVAFLTWRRKMEQDLGNRLVSISKGRERLEPQVVFGDPRVQAVLGLLGQRILWASTLFDGFMK
Ga0193535_1015006823300019024MarineLLLLDSLLQEILDICGNTCAAMTAFLPSFDSLYSSAKDPATAMSNLQKMPADAKAKAVAFLAWRRKMEQDLGNRLVAISKGREHLEPRIVFGDPRVQAVLGLLGQRILWASTLFDGFMK
Ga0193535_1020652013300019024MarineQAFIARFTSTRDISGSICAAMTAYLPSFDSLYSSAKDPAKAMANLQKMPADAKARAVAFLVWRRKMEQDLGNRLVAISKGREHLEPRIIFGDQRVQAVLGLLGQRILWASTLFDGLMK
Ga0193565_1023155113300019026MarineGCKSSSCCFFDVSLSGQTASLGGGNISLFGIMTAFLPSFDTLYSSAKDPAKAMANLQRMPADAKAQAVAFLTWRRKMEQDLGNRLVSISKGRERLEPQVVFGDARVQAVLGLLGQRILWASTLFDGFMK
Ga0193565_1027834413300019026MarineSFDSLYSSAKDPAKAMANLQKMPADAKARAIAFLTWRRKMEQDLGNRLVAISKGREHLEPRVIFGDPRVQAVLGLLGQRILWASTLFDGLMK
Ga0192905_1019593813300019030MarineSICAAMTAYLPSFDSLYSSAKDPAKAMANLQKMPADAKARAVAFLVWRRKMEQDLGNRLVAISKGREHLEPRIIFGDQRVQAVLGLLGQRILWASTLFDGLMK
Ga0193189_1013892813300019044MarineSIGGGNILLFGIMTAFLPSFDTLYSSAKDPAKAMANLQRMPADAKAQAVAFLTWRRKMEQDLGNRLVSISKGRERLEPQVVFGDPRVQAVLGLLGQRILWASTLFDGFMK
Ga0193455_1038542113300019052MarineSIGGGNISLFGIMTAFLPSFDTLYSSAKDPAKAMANLQRMPADAKAQAVAFLTWRRKMEQDLGNRLVSISKGRERLEPQVVFGDPRVQAVLGLLGQRILWASTLFDGFMK
Ga0193515_107173313300019134MarineHGSRSGRRASIGGGNISLFGIMTAFLPSFDTLYSSAKDPAKAMANLQRMPADAKAQAVAFLTWRRKMEQDLGNRLVSISKGRERLEPQVVFGDPRVQAVLGLLGQRILWASTLFDGFMK
Ga0193246_1014837113300019144MarineVEAMTAFLPSFDSLYSSAKDPAKAMSNLQQMPADAKAKAVAFLVWRRKMEQDLGNRLVAISKGREHLEPRIVFGDPRVQVVLGLLGQRIIWASTLFDGLM
Ga0193246_1025894213300019144MarineVEAMTAFLPSFDSLYSSAKDPAKAMSNLQQMPADAKAKAVAFLVWRRKMEQDLGNRLVAISKGREHLEPRIVFGDPRVQAVLGLLGQRIIWASTLFDGLMK
Ga0193564_1020559413300019152MarineQTASLGGGNISLFGIMTAFLPSFDTLYSSAKDPAKAMANLQRMPADAKAQAVAFLTWRRKMEQDLGNRLVSISKGRERLEPQVVFGDARVQAVLGLLGQRILWASTLFDGFMK
Ga0193564_1021343813300019152MarineILDICGSIWAAMAAYLPSFNSLFSSAKDPAKAMANLQNMPADAKARAIAFLTWRRKMEQDLGNRLVAISKGREHLEPRVIFGDPRVQAVLGLLGQRILWASTLFDGLMK
Ga0307388_1110310313300031522MarineMTAYIPSFDSLCASAKDPAKAMANLQKMTADSKARAIDILAWRKKMEQDLGNRLVAISKGRELLEPRIIFGDARVQAVLGLLGQRILWASTLFDGLIK
Ga0307385_1027891113300031709MarineKLLLLDSLLQEIFLIFVGAMTAYIPSFDSLCASAKDPAKAMANLQKMTADSKARAIDILAWRKKMEQDLGNRLVAISKGRELLEPRIIFGDARVQAVLGLLGQRILWASTLFDGLIK
Ga0307384_1042706613300031738MarineIFLIFVGAMTAYIPSFDSLCASAKDPAKAMANLQKMTADSKARAIDILAWRKKMEQDLGNRLVAISKGRELLEPRIIFGDARVQAVLGLLGQRILWASTLFDGLIK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.