NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F095057

Metagenome / Metatranscriptome Family F095057

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F095057
Family Type Metagenome / Metatranscriptome
Number of Sequences 105
Average Sequence Length 44 residues
Representative Sequence MANEAPGAFGYLWFQQKGTKGAVGVLVVDHWLTIASVRMLRMSFL
Number of Associated Samples 84
Number of Associated Scaffolds 105

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 59.05 %
% of genes near scaffold ends (potentially truncated) 46.67 %
% of genes from short scaffolds (< 2000 bps) 81.90 %
Associated GOLD sequencing projects 78
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (63.810 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater
(21.905 % of family members)
Environment Ontology (ENVO) Unclassified
(53.333 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(92.381 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 54.79%    β-sheet: 0.00%    Coil/Unstructured: 45.21%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 105 Family Scaffolds
PF13561adh_short_C2 6.67
PF13377Peripla_BP_3 3.81
PF13478XdhC_C 2.86
PF01177Asp_Glu_race 1.90
PF08546ApbA_C 1.90
PF01494FAD_binding_3 1.90
PF06821Ser_hydrolase 1.90
PF00528BPD_transp_1 1.90
PF00171Aldedh 1.90
PF07394DUF1501 1.90
PF03401TctC 0.95
PF01384PHO4 0.95
PF12680SnoaL_2 0.95
PF00440TetR_N 0.95
PF00892EamA 0.95
PF00589Phage_integrase 0.95
PF00005ABC_tran 0.95
PF04832SOUL 0.95
PF06568DUF1127 0.95
PF01554MatE 0.95
PF02782FGGY_C 0.95
PF01638HxlR 0.95
PF05272VirE 0.95
PF04909Amidohydro_2 0.95
PF01965DJ-1_PfpI 0.95
PF10636hemP 0.95
PF13242Hydrolase_like 0.95
PF06253MTTB 0.95
PF00881Nitroreductase 0.95
PF00370FGGY_N 0.95
PF13193AMP-binding_C 0.95
PF01370Epimerase 0.95
PF01425Amidase 0.95
PF06240COXG 0.95

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 105 Family Scaffolds
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 3.81
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 1.90
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 1.90
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 1.90
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 1.90
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 1.90
COG1893Ketopantoate reductaseCoenzyme transport and metabolism [H] 1.90
COG3545Predicted esterase of the alpha/beta hydrolase foldGeneral function prediction only [R] 1.90
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 1.90
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 0.95
COG0306Phosphate/sulfate permeaseInorganic ion transport and metabolism [P] 0.95
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.95
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 0.95
COG3427Carbon monoxide dehydrogenase subunit CoxGEnergy production and conversion [C] 0.95
COG5457Uncharacterized conserved protein YjiS, DUF1127 familyFunction unknown [S] 0.95
COG5545Predicted P-loop ATPase and inactivated derivativesMobilome: prophages, transposons [X] 0.95
COG5598Trimethylamine:corrinoid methyltransferaseCoenzyme transport and metabolism [H] 0.95

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms63.81 %
UnclassifiedrootN/A36.19 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2006543006|2006908652All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae781Open in IMG/M
3300000101|DelMOSum2010_c10010227All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium HTCC21506075Open in IMG/M
3300000101|DelMOSum2010_c10038579Not Available2524Open in IMG/M
3300000101|DelMOSum2010_c10083135All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae1407Open in IMG/M
3300000115|DelMOSum2011_c10109395Not Available887Open in IMG/M
3300001344|JGI20152J14361_10086410Not Available663Open in IMG/M
3300001346|JGI20151J14362_10177209Not Available606Open in IMG/M
3300001349|JGI20160J14292_10181832All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria625Open in IMG/M
3300003216|JGI26079J46598_1031098All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseobacter → unclassified Roseobacter → Roseobacter sp. LE171218Open in IMG/M
3300003410|JGI26086J50260_1100783All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseobacter → unclassified Roseobacter → Roseobacter sp. LE17579Open in IMG/M
3300003580|JGI26260J51721_1032435All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseobacter → unclassified Roseobacter → Roseobacter sp. LE17927Open in IMG/M
3300003583|JGI26253J51717_1015089All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Planktotalea → Planktotalea frisia1963Open in IMG/M
3300003583|JGI26253J51717_1026591All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseobacter → unclassified Roseobacter → Roseobacter sp. LE171260Open in IMG/M
3300005912|Ga0075109_1094792All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1031Open in IMG/M
3300005941|Ga0070743_10073315All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae1157Open in IMG/M
3300005942|Ga0070742_10010364All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales2432Open in IMG/M
3300005942|Ga0070742_10127218Not Available706Open in IMG/M
3300006869|Ga0075477_10011921All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae4092Open in IMG/M
3300007557|Ga0102821_1009043All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae2823Open in IMG/M
3300007630|Ga0102903_1219441Not Available515Open in IMG/M
3300007692|Ga0102823_1142794All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseobacter → unclassified Roseobacter → Roseobacter sp. LE17636Open in IMG/M
3300007706|Ga0102899_1015137All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1792Open in IMG/M
3300007862|Ga0105737_1122278Not Available666Open in IMG/M
3300007864|Ga0105749_1114566All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Sulfitobacter → Sulfitobacter undariae607Open in IMG/M
3300008961|Ga0102887_1010545All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Loktanella3485Open in IMG/M
3300008964|Ga0102889_1043089All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales1383Open in IMG/M
3300008993|Ga0104258_1007337All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseobacter → unclassified Roseobacter → Roseobacter sp.2022Open in IMG/M
3300008999|Ga0102816_1221808Not Available593Open in IMG/M
3300008999|Ga0102816_1312567Not Available501Open in IMG/M
3300009026|Ga0102829_1258026Not Available574Open in IMG/M
3300009050|Ga0102909_1057528All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales966Open in IMG/M
3300009077|Ga0115552_1383090Not Available555Open in IMG/M
3300009079|Ga0102814_10775591All Organisms → cellular organisms → Bacteria → Proteobacteria529Open in IMG/M
3300009086|Ga0102812_10176072All Organisms → cellular organisms → Bacteria → Proteobacteria1168Open in IMG/M
3300009434|Ga0115562_1201117Not Available713Open in IMG/M
3300009434|Ga0115562_1247737Not Available622Open in IMG/M
3300009436|Ga0115008_10223482All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseobacter → unclassified Roseobacter → Roseobacter sp. LE171345Open in IMG/M
3300009442|Ga0115563_1038477All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales2383Open in IMG/M
3300009443|Ga0115557_1366575Not Available534Open in IMG/M
3300009467|Ga0115565_10052700All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1986Open in IMG/M
3300009497|Ga0115569_10199067Not Available925Open in IMG/M
3300009497|Ga0115569_10219683All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Oceanospirillaceae → Marinobacterium → Marinobacterium litorale868Open in IMG/M
3300009497|Ga0115569_10394866All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseobacter → unclassified Roseobacter → Roseobacter sp. LE17597Open in IMG/M
3300020165|Ga0206125_10002184All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae21063Open in IMG/M
3300020165|Ga0206125_10212956All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria748Open in IMG/M
3300020165|Ga0206125_10347032Not Available547Open in IMG/M
3300020169|Ga0206127_1153419All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseobacter → unclassified Roseobacter → Roseobacter sp. LE17887Open in IMG/M
3300020169|Ga0206127_1322956Not Available506Open in IMG/M
3300020187|Ga0206130_10018775All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseobacter → unclassified Roseobacter → Roseobacter sp. LE176244Open in IMG/M
3300020352|Ga0211505_1157125Not Available533Open in IMG/M
3300020358|Ga0211689_1057673Not Available1135Open in IMG/M
3300020595|Ga0206126_10021997All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae4181Open in IMG/M
3300020595|Ga0206126_10034111All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseobacter3023Open in IMG/M
3300021085|Ga0206677_10093988All Organisms → cellular organisms → Bacteria1430Open in IMG/M
3300021085|Ga0206677_10413766Not Available507Open in IMG/M
3300021087|Ga0206683_10185425All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae1098Open in IMG/M
3300021365|Ga0206123_10036125All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae2698Open in IMG/M
3300021957|Ga0222717_10047229All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae2802Open in IMG/M
3300021957|Ga0222717_10190656Not Available1222Open in IMG/M
3300021957|Ga0222717_10235779All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales1069Open in IMG/M
3300021957|Ga0222717_10604792Not Available574Open in IMG/M
(restricted) 3300023109|Ga0233432_10010683All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Lutimaribacter → Lutimaribacter saemankumensis7391Open in IMG/M
(restricted) 3300023109|Ga0233432_10189568All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae1035Open in IMG/M
3300023239|Ga0222660_1023228All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1111Open in IMG/M
3300024183|Ga0228603_1059257Not Available594Open in IMG/M
3300024191|Ga0228636_1128700All Organisms → cellular organisms → Bacteria → Proteobacteria559Open in IMG/M
3300024192|Ga0228637_1118700Not Available522Open in IMG/M
3300024221|Ga0228666_1021676All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae1544Open in IMG/M
3300024221|Ga0228666_1029046All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales1258Open in IMG/M
3300024228|Ga0228633_1049863All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales1058Open in IMG/M
(restricted) 3300024264|Ga0233444_10074390All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales1882Open in IMG/M
3300024291|Ga0228660_1044569All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales847Open in IMG/M
3300024292|Ga0228630_1057987All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales884Open in IMG/M
3300024316|Ga0228654_1025158All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseobacter → unclassified Roseobacter → Roseobacter sp. LE17859Open in IMG/M
3300024321|Ga0228626_1062438Not Available869Open in IMG/M
3300024328|Ga0228635_1127567Not Available550Open in IMG/M
3300024334|Ga0228671_1017297Not Available2131Open in IMG/M
3300024335|Ga0228672_1145745Not Available618Open in IMG/M
3300024346|Ga0244775_10175023All Organisms → cellular organisms → Bacteria → Proteobacteria1807Open in IMG/M
3300024420|Ga0228632_1077959All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales776Open in IMG/M
3300025483|Ga0209557_1108125Not Available561Open in IMG/M
3300025640|Ga0209198_1110699All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Silicimonas → Silicimonas algicola833Open in IMG/M
3300025668|Ga0209251_1175769Not Available537Open in IMG/M
3300025699|Ga0209715_1260002All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Roseobacter → unclassified Roseobacter → Roseobacter sp. LE17505Open in IMG/M
3300025701|Ga0209771_1016377All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Planktotalea → Planktotalea frisia3230Open in IMG/M
3300025822|Ga0209714_1144634Not Available611Open in IMG/M
3300026461|Ga0247600_1115713Not Available533Open in IMG/M
3300026479|Ga0228622_1034543All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales1276Open in IMG/M
3300026479|Ga0228622_1087426All Organisms → cellular organisms → Bacteria → Proteobacteria648Open in IMG/M
3300026506|Ga0228604_1066017All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Ruegeria600Open in IMG/M
3300027170|Ga0208963_1054925Not Available606Open in IMG/M
3300027298|Ga0208970_1008217All Organisms → cellular organisms → Bacteria → Proteobacteria2197Open in IMG/M
3300027406|Ga0208965_1030541All Organisms → cellular organisms → Bacteria → Proteobacteria1313Open in IMG/M
3300027413|Ga0208950_1045183All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae1104Open in IMG/M
3300027553|Ga0208947_1037508All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae1227Open in IMG/M
3300027849|Ga0209712_10199679All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1139Open in IMG/M
3300028124|Ga0228621_1055494Not Available582Open in IMG/M
3300028130|Ga0228619_1075775All Organisms → cellular organisms → Bacteria → Proteobacteria850Open in IMG/M
3300028133|Ga0228609_1046063Not Available1200Open in IMG/M
3300028196|Ga0257114_1004597All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae → Roseibium → Roseibium denhamense8269Open in IMG/M
3300028273|Ga0228640_1080693Not Available634Open in IMG/M
3300028396|Ga0228643_1114689Not Available623Open in IMG/M
3300031851|Ga0315320_10542353Not Available775Open in IMG/M
3300031851|Ga0315320_10700359All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium650Open in IMG/M
3300031851|Ga0315320_10827038All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Nereida → Nereida ignava578Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater21.90%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine13.33%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine11.43%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine11.43%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater8.57%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater5.71%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine3.81%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water3.81%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine3.81%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater2.86%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine2.86%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine1.90%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water1.90%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine1.90%
MarineEnvironmental → Aquatic → Marine → Inlet → Unclassified → Marine0.95%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous0.95%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake0.95%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water0.95%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.95%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2006543006Marine microbial communities from anoxic basin of Saanich Inlet - SI040908_100EnvironmentalOpen in IMG/M
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300001344Pelagic Microbial community sample from North Sea - COGITO 998_met_02EnvironmentalOpen in IMG/M
3300001346Pelagic Microbial community sample from North Sea - COGITO 998_met_01EnvironmentalOpen in IMG/M
3300001349Pelagic Microbial community sample from North Sea - COGITO 998_met_10EnvironmentalOpen in IMG/M
3300003216Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNAEnvironmentalOpen in IMG/M
3300003410Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_153SG_22_DNAEnvironmentalOpen in IMG/M
3300003580Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNAEnvironmentalOpen in IMG/M
3300003583Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_100m_DNAEnvironmentalOpen in IMG/M
3300005912Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKDEnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300005942Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757EnvironmentalOpen in IMG/M
3300006869Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300007557Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715EnvironmentalOpen in IMG/M
3300007630Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02EnvironmentalOpen in IMG/M
3300007692Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743EnvironmentalOpen in IMG/M
3300007706Estuarine microbial communities from the Columbia River estuary - metaG 1555B-3EnvironmentalOpen in IMG/M
3300007862Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2umEnvironmentalOpen in IMG/M
3300007864Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461B_3.0umEnvironmentalOpen in IMG/M
3300008961Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02EnvironmentalOpen in IMG/M
3300008964Estuarine microbial communities from the Columbia River estuary - metaG 1551A-02EnvironmentalOpen in IMG/M
3300008993Marine microbial communities from eastern North Pacific Ocean - P1 free-livingEnvironmentalOpen in IMG/M
3300008999Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545EnvironmentalOpen in IMG/M
3300009026Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575EnvironmentalOpen in IMG/M
3300009050Estuarine microbial communities from the Columbia River estuary - metaG 1557A-02EnvironmentalOpen in IMG/M
3300009077Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328EnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009086Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713EnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009442Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519EnvironmentalOpen in IMG/M
3300009443Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421EnvironmentalOpen in IMG/M
3300009467Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530EnvironmentalOpen in IMG/M
3300009497Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503EnvironmentalOpen in IMG/M
3300020165Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1EnvironmentalOpen in IMG/M
3300020169Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1EnvironmentalOpen in IMG/M
3300020187Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1EnvironmentalOpen in IMG/M
3300020352Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556084-ERR599144)EnvironmentalOpen in IMG/M
3300020358Marine microbial communities from Tara Oceans - TARA_B100000768 (ERX555925-ERR599009)EnvironmentalOpen in IMG/M
3300020595Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1EnvironmentalOpen in IMG/M
3300021085Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015EnvironmentalOpen in IMG/M
3300021087Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300023109 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MGEnvironmentalOpen in IMG/M
3300023239Saline water microbial communities from Ace Lake, Antarctica - #549EnvironmentalOpen in IMG/M
3300024183Seawater microbial communities from Monterey Bay, California, United States - 3DEnvironmentalOpen in IMG/M
3300024191Seawater microbial communities from Monterey Bay, California, United States - 45DEnvironmentalOpen in IMG/M
3300024192Seawater microbial communities from Monterey Bay, California, United States - 47DEnvironmentalOpen in IMG/M
3300024221Seawater microbial communities from Monterey Bay, California, United States - 80DEnvironmentalOpen in IMG/M
3300024228Seawater microbial communities from Monterey Bay, California, United States - 41DEnvironmentalOpen in IMG/M
3300024264 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MGEnvironmentalOpen in IMG/M
3300024291Seawater microbial communities from Monterey Bay, California, United States - 74DEnvironmentalOpen in IMG/M
3300024292Seawater microbial communities from Monterey Bay, California, United States - 37DEnvironmentalOpen in IMG/M
3300024316Seawater microbial communities from Monterey Bay, California, United States - 66DEnvironmentalOpen in IMG/M
3300024321Seawater microbial communities from Monterey Bay, California, United States - 31DEnvironmentalOpen in IMG/M
3300024328Seawater microbial communities from Monterey Bay, California, United States - 44DEnvironmentalOpen in IMG/M
3300024334Seawater microbial communities from Monterey Bay, California, United States - 89DEnvironmentalOpen in IMG/M
3300024335Seawater microbial communities from Monterey Bay, California, United States - 90DEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300024420Seawater microbial communities from Monterey Bay, California, United States - 40DEnvironmentalOpen in IMG/M
3300025483Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025640Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 (SPAdes)EnvironmentalOpen in IMG/M
3300025668Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_100m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025699Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 (SPAdes)EnvironmentalOpen in IMG/M
3300025701Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025822Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 (SPAdes)EnvironmentalOpen in IMG/M
3300026461Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 75R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026479Seawater microbial communities from Monterey Bay, California, United States - 26DEnvironmentalOpen in IMG/M
3300026506Seawater microbial communities from Monterey Bay, California, United States - 4DEnvironmentalOpen in IMG/M
3300027170Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C43A7_35 (SPAdes)EnvironmentalOpen in IMG/M
3300027298Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C49A8_35 (SPAdes)EnvironmentalOpen in IMG/M
3300027406Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_07_M0_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027413Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_54_BLW_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027553Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_04_M0_20 (SPAdes)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028124Seawater microbial communities from Monterey Bay, California, United States - 25DEnvironmentalOpen in IMG/M
3300028130Seawater microbial communities from Monterey Bay, California, United States - 22DEnvironmentalOpen in IMG/M
3300028133Seawater microbial communities from Monterey Bay, California, United States - 10DEnvironmentalOpen in IMG/M
3300028196Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10mEnvironmentalOpen in IMG/M
3300028273Seawater microbial communities from Monterey Bay, California, United States - 51DEnvironmentalOpen in IMG/M
3300028396Seawater microbial communities from Monterey Bay, California, United States - 55DEnvironmentalOpen in IMG/M
3300031851Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
20070577552006543006MarineMANVAPGAFGYLWLQQKGTKGTVGVLVVEHWLTIASVRMLRMSFL
DelMOSum2010_1001022753300000101MarineMAIEAPGAFVYLWFQQKGTKRAVVVLVGDHLLTIASVRMLRIGFL*
DelMOSum2010_1003857923300000101MarineMANEALGAFGYLRFQQKGTKRAVVVFVVDHWLTIASARMLRMSF*
DelMOSum2010_1008313523300000101MarineMANEAPGAFVYLWFQQKGTKGAVVVLVGDHLLTIASVRMLHMSFL*
DelMOSum2011_1010939513300000115MarineWMANEALGAFGYLRFQQKGTKRAVVVFVVDHWLTIASARMLRMSF*
JGI20152J14361_1008641013300001344Pelagic MarineMANVAPGAFGYLWIQQKGTKGAVGVLVVDHWLTIASVRMLRMSFL*
JGI20151J14362_1017720923300001346Pelagic MarineMTNVAPGAFGYLWFQTKGTKGAVGVLVVDHWLTIASVRMLRMSFL*
JGI20160J14292_1018183213300001349Pelagic MarineEAPGAFGYLWFQQKGTKGAIVVLVVVHWLTIASMRMLRSSFL*
JGI26079J46598_103109823300003216MarineMTNVAPGAFGYLWLQQKGTKGTVGVLVVEHLLTIASVRMLRMSFL*
JGI26086J50260_110078313300003410MarineMTKEAPGAFGYLWFQQKETKGTIVVAVVDHWLTIASVRMLRMSFL*
JGI26260J51721_103243523300003580MarineMTNEDPGAFGYLWLQQKGTKGAVGVLVVDHWLTIASVRMLRMSFL*
JGI26253J51717_101508913300003583MarineMANEAXGAFGYLWLQQKGTKGTVGVLVVEHWLTIASVRMLRMSFL*
JGI26253J51717_102659123300003583MarineMTNVAPGAFGYLWLQQKGTKGTVGVLVAEHWLTIASVRMLRMSFL*
Ga0075109_109479213300005912Saline LakeMTNEAPGAFGYLWFQQKGTKGAVVVLVVDHWLTIASVRMLRMSFL*
Ga0070743_1007331513300005941EstuarineWPETNRVPWMTNVAPGAFGYLWLQQKGTKGTVGVLVVEHLLTIASVRMLRMSFL*
Ga0070742_1001036413300005942EstuarineMANEAPGAFGYLWFHQKGTKGLLVFLLEHLLTIASVRM
Ga0070742_1012721823300005942EstuarineMANEAPGAFVYLWFQQKGTKRAVVVLVGDHLLTIASVRMLRIGFL*
Ga0075477_1001192153300006869AqueousMTNEAQGAFGYLWFQQKGIKGLLVFLLLTRLTIASVRMLRM
Ga0102821_100904313300007557EstuarineMANEAQGAFGYLWLQQKGTKGTVGVLVVEHLLTIASVRMLRMSFL*
Ga0102903_121944113300007630EstuarineMTNEAQGAFGYLWFQQKATKGTIVVAVVDHWLTIASVRMLRMSFL*
Ga0102823_114279423300007692EstuarineMAKEAPGAFGYLWFQQKGTKGAIVVAVADHWLTIASVRMLRMSFL*
Ga0102899_101513743300007706EstuarineMANEAQGAFGYLWLQQKGTKGTVGVLVVDYWLTIASVRMLRMSFL*
Ga0105737_112227813300007862Estuary WaterFVYLWFQQKGTKRAVVVLVGDHLLTIASVRMLRIGFL*
Ga0105749_111456623300007864Estuary WaterMANEAQGAFGYLWFQQKETKGTVGVLVVEHLLTIASVRMLRMSFL*
Ga0102887_101054513300008961EstuarineMANEAPGAFGYPWFQQKGTKGTVGVLVVVHLLTIASVRMLRMSFL*
Ga0102889_104308933300008964EstuarineMANEAPGAFSYLWFQQKGTKGAVGVLVVDHWLTIASVRMLRMSSL*
Ga0104258_100733733300008993Ocean WaterMAIEAPGAFVYLWFQQKGTKRAVVVLVGDHLLTIASVRMLR
Ga0102816_122180813300008999EstuarineMANEAPGAFRYLWFQQKGTNGAVGVLVVDHWLTNASVRMLRMSFL*
Ga0102816_131256713300008999EstuarineMANEALGAFVYLWFQQKGTKGTVVVLVGDHWLTIASVRMLRMSFL*
Ga0102829_125802613300009026EstuarineMTKEAPGAFGYLWFQQKETKGTIVVAVVDHWLTIASVRILRMSFL*
Ga0102909_105752843300009050EstuarineMANEAPGAFGYLWLQQKGTKGAVGVLVVDHWLTIASVRMLRMSFL*
Ga0115552_138309013300009077Pelagic MarineMTNVAPGAFGYLWFQTKGTKGAVGVLVVDHWLTIASVRMLRMSF
Ga0102814_1077559123300009079EstuarineGAFGYLRFQQKGTKRAVVVFVVDHWLTIASARMLRMSF*
Ga0102812_1017607213300009086EstuarineMANVAPGAFGYLWLQQKGTKGTVGVLVVEHLLTIASVRMLRMSFL*
Ga0115562_120111713300009434Pelagic MarineMANEAPGASVYLWFQQKGTKGAVVVLVGDHLLTIASVRMLHMSFL*
Ga0115562_124773723300009434Pelagic MarineSIANEAPGAFGYLWFQQKGTKRAVVVLVGDHLLTIASVRMLRIGFL*
Ga0115008_1022348213300009436MarineMTNEAPGAFGYLWFQQKGTKGAVGVLVVDHWLTIASVRML
Ga0115563_103847713300009442Pelagic MarineMANEAPGAFGYLWFQQKLTKGAIVVLVVVHWLTIASVRMLRINFLWTSLVELSCL
Ga0115557_136657513300009443Pelagic MarineMTNVAPGAFGYLWLQQKGTKGAVGVLVVDHWLTIASVRMLRMSFL*
Ga0115565_1005270033300009467Pelagic MarineAFGYLWFQQKGTKGAIVVLVVVHWLTIASMRMLRSSFL*
Ga0115569_1019906713300009497Pelagic MarineMANEAPGAFGYLWFQQKLTKGAIVVLVVVHWLTIASVRMLRINFLWTSLVELSCLR
Ga0115569_1021968323300009497Pelagic MarineRVPSIANEAPGAFGCLWFQQKGTKGAVVVLVGDYLLTIASVRMLHMSFL*
Ga0115569_1039486613300009497Pelagic MarineWWPETNRVPWMTNEAPGAFGYLWFQQKGTKGAVGVLVVDHWLTIASVRMLRMSSL*
Ga0206125_1000218443300020165SeawaterMTNVAPGAFGYLWFQTKGTKGAVGVLVVDHWLTIASVRMLRMSFL
Ga0206125_1021295613300020165SeawaterGAFGYLWFQQKGTKGAVGVLVVDHWLTIASVRMLRMCFL
Ga0206125_1034703223300020165SeawaterMANVAPGAFGYLWIQQKGTKGAVGVLVVDHWLTIASVRMLRMSFL
Ga0206127_115341913300020169SeawaterMANEAPGAFGYLWFQQKGTKGAVGVLVVDHWLTIASVRMLRMSFL
Ga0206127_132295613300020169SeawaterMAIEAPGAFVYLWFQQKGTKRAVVVLVGDHLLTIASVRMLRIGFL
Ga0206130_1001877563300020187SeawaterMANEALGAFGYLRFQQKGTKRAVVVFVVDHWLTIASARMLRMSF
Ga0211505_115712523300020352MarineMANEGLGAFGYLWFQQKGSKRAGVVLVVDHWLTIASARMLRMNFW
Ga0211689_105767323300020358MarineMTNEAPGAFGYLWFQQKGTKGAVGVLVVDHWLTIASVRMLRMSFL
Ga0206126_1002199783300020595SeawaterANEAPGAFGYLWFQQKGTKGAVGVLVVDHWLTIASVRMLRMCFL
Ga0206126_1003411123300020595SeawaterMANEAPGAFVYLWFQQKGTKGAVVVLVGDHLLTIASVRMLHMSFL
Ga0206677_1009398813300021085SeawaterMVNEALGAFGYFWFQQKGTKRAVVVLEHWLTIASARMLRMSF
Ga0206677_1041376613300021085SeawaterMTNEAPAAFSYLWLQQKGTKGAVGVLVADHWLTIASVRMLRMSFL
Ga0206683_1018542543300021087SeawaterMTNEAPGAFGYLWFQQKGTKGTVGVLVVEHLLTIASVRMLRMSFL
Ga0206123_1003612513300021365SeawaterMANEAPGAFGYLWFQQKGTKGAVGVLVVDHWLTIASVRMLRMCFL
Ga0222717_1004722943300021957Estuarine WaterAPGAFGYLWFQQKGTKGAVVVLVVDHWLTIASVRMLRMCFL
Ga0222717_1019065613300021957Estuarine WaterMAKEAQRAFGYLWFHQKGTKGTIVVAVVDHWLTIASVRMLRMSFL
Ga0222717_1023577923300021957Estuarine WaterMAKEAPGAFGYLWFQQKETKGTIVVAVVDHWLTIASVRMLRMSFL
Ga0222717_1060479213300021957Estuarine WaterMANEAPGAFVYLWFQQKGTKRAVVVLVGDHLLTIASVRMLRIGFL
(restricted) Ga0233432_1001068373300023109SeawaterMTKEAPGAFGYLWFQQKETKGTIVVAVVDHWLTIASVRMLRMSFL
(restricted) Ga0233432_1018956833300023109SeawaterWPETNRVPWMTNVAPGAFGYLWLQQKGTKGTVGVLVVEHLLTIASVRMLRMSFL
Ga0222660_102322823300023239Saline WaterMTNEAPGAFGYLWFQQKGTKGAVVVLVVDHWLTIASVRMLRMSFL
Ga0228603_105925713300024183SeawaterMAKEAPGAFGYLWFQQKGTKGTIVVAVADHWLTIASVRMLRMSFL
Ga0228636_112870023300024191SeawaterNYLWFQQKGTKSAVVVLVVDHWLTIASVRMLRMSFL
Ga0228637_111870013300024192SeawaterAFGYLLFQQKATKGTIVVAVVEHLLTIASVRMLRMSFL
Ga0228666_102167613300024221SeawaterGAFGYLWFQQKGTLGTIVVAVADHWLTIASVRMLRMSFL
Ga0228666_102904613300024221SeawaterMAKEAPGAFGYLWFQQKATKGTIVVAVVDHWLTIASVRMLRMSFL
Ga0228633_104986323300024228SeawaterMTNEAPSAFDYLWFQQKGTKGAIGVLVVDHWLTIASVRMLRMSFL
(restricted) Ga0233444_1007439033300024264SeawaterMTNVAPGAFGYLWLQQKGTKGTVGVLVVEHLLTIASVRMLRMSFL
Ga0228660_104456923300024291SeawaterYLWFQQKATKGTIVVAVVDHWLTIASVRMLRMSFL
Ga0228630_105798713300024292SeawaterAPGAFGYLWFQQKGTLGTIVVAVADHWLTIASVRMLRMSFL
Ga0228654_102515813300024316SeawaterMTNEAPGAFGYLWFQQKGTKGAVGVLVVDHWLKIASVRMLRMCFL
Ga0228626_106243813300024321SeawaterWRPQTNRVPWMTNEAPVVIGNPWFQQKGTKGAVDVLVAEHWLTIASVRMLRMSFL
Ga0228635_112756723300024328SeawaterRAFSYLWFQQKGTKGAVGVLVVDHWLTIASVRMLRMSFL
Ga0228671_101729713300024334SeawaterAFGYIWFQQKGTKGAVGVLAVDHWLTIASVRMLRMSFL
Ga0228672_114574513300024335SeawaterYLWFKQKRTKGAVGVLVVDHWLTIASVRMLRMSFL
Ga0244775_1017502333300024346EstuarineMANEALGAFGYLRFQQKGTKRAVVVFVVDHWLTIGSARMLRMSF
Ga0228632_107795923300024420SeawaterGSHKIANEAPGAFGYLWFQQKGTKGTIVVAVADHWLTIASVRMLRMSFL
Ga0209557_110812513300025483MarineMTNEDPGAFGYLWLQQKGTKGAVGVLVVDHWLTIASVRMLRMSFL
Ga0209198_111069913300025640Pelagic MarineMANEAPGAFGYLWFQQKLTKGAIVVLVVVHWLTIASVRMLRINFLWTSLV
Ga0209251_117576913300025668MarineMANEAPGAFSYLWFQQKGTKGAVGVLMVDHWLTIASVRMLRMSFL
Ga0209715_126000213300025699Pelagic MarineMANEAPGAFGYLWFQQKLTKGAIVVLVVVHWLTIASVRMLRINFLW
Ga0209771_101637753300025701MarineFGYLWFHQKGTKGAVGVLVVDHWLTIASVRMLRMSFL
Ga0209714_114463413300025822Pelagic MarineMTNVAPGAFGYLWFQTKGTKGAVGVLVVDHWLTIASV
Ga0247600_111571323300026461SeawaterMTKEAPGAFGYLWFQQKGTKGTIVVAVADHWLTIASVRMLRMSFL
Ga0228622_103454313300026479SeawaterPWMAKEAPGAFGYLWFQQKETKGTIVVAVVDHWLTIASVRMLRMSFL
Ga0228622_108742623300026479SeawaterEAPGAFNYLWFQQKGTKSAVVVLVVDHWLTIASVRMLRMSFL
Ga0228604_106601713300026506SeawaterVPSIANEAPGAFGCLWFQQKGTKGAVGVLVVDHWLKIASVRMLRMCFL
Ga0208963_105492513300027170MarineMANGPPGAFGYLWFQQKGTKETVGVLMVDHWLTIASVR
Ga0208970_100821733300027298MarineMTKEAPGAFGYLWFQQKGTKGAVGVLVVDHWLKIASVRMLRMCFL
Ga0208965_103054113300027406MarineNEALGAFGYLRFQQKGTKRAVVVFVVDHWLTIASARMLRMSF
Ga0208950_104518333300027413MarineMTKEAPGAFGYLWFQQKETKGTIGVLVVDHWLTIASVRMLRMNFL
Ga0208947_103750813300027553MarinePGAFGYLWFQQKGTKGAIVVLVVVHWLTIASMRVLRSSFL
Ga0209712_1019967913300027849MarineMTNEAPGAFGYLWFQQKGTKGTTVVVLVADHKLTIASVRLLRMTFL
Ga0228621_105549423300028124SeawaterRVPWMANVAPGTFSYLWFQQKGTKGAVGVLVVVDHWLTIASVRMLRMSFL
Ga0228619_107577533300028130SeawaterAYEAPGAFGYLWFQQNGTKGAVGVLVVDHWLTIASVRMLRMSFL
Ga0228609_104606323300028133SeawaterYLWFQQKGTKGAVVVAVADHWLTIASVRMLRMSFL
Ga0257114_100459713300028196MarinePETNRVPLMTKEAPGAFGYLWFQQKETKGTIVVAVVDHWLTIASVRMLRMSFL
Ga0228640_108069333300028273SeawaterTNVAPGAFGYLWFQQKATKGTIVVAVVDHWLTIASVRMLRMSFL
Ga0228643_111468913300028396SeawaterMAKEAPGAFGYLWFQQKETKGTIVVAVVDHWLTIASVRMLRMCFL
Ga0315320_1054235313300031851SeawaterMAKEAPGAFGYLWFQQKETKGTIVVAVVDHWLTIASVRMLR
Ga0315320_1070035923300031851SeawaterIANEAPGAFGYLWFQQKGTKGAVGVLVVDHWLTIASVRMLRMSFL
Ga0315320_1082703813300031851SeawaterMTNEAQGAFGYLWFQQKATKGTVGVLVVEHLLTIASVRML

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.