Basic Information | |
---|---|
Family ID | F095719 |
Family Type | Metagenome |
Number of Sequences | 105 |
Average Sequence Length | 48 residues |
Representative Sequence | MRNAVLGLICAAALALALSDIAIFGIALWKIELAIVGALLFVTAGKKT |
Number of Associated Samples | 84 |
Number of Associated Scaffolds | 105 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 58.10 % |
% of genes near scaffold ends (potentially truncated) | 39.05 % |
% of genes from short scaffolds (< 2000 bps) | 88.57 % |
Associated GOLD sequencing projects | 73 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.35 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (80.952 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (18.095 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.571 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (59.048 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.95% β-sheet: 0.00% Coil/Unstructured: 46.05% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 105 Family Scaffolds |
---|---|---|
PF00005 | ABC_tran | 39.05 |
PF00083 | Sugar_tr | 29.52 |
PF03544 | TonB_C | 7.62 |
PF13620 | CarboxypepD_reg | 6.67 |
PF07690 | MFS_1 | 6.67 |
PF01061 | ABC2_membrane | 1.90 |
PF03965 | Penicillinase_R | 0.95 |
PF00117 | GATase | 0.95 |
PF01979 | Amidohydro_1 | 0.95 |
PF03352 | Adenine_glyco | 0.95 |
PF12706 | Lactamase_B_2 | 0.95 |
PF00144 | Beta-lactamase | 0.95 |
COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
---|---|---|---|
COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 7.62 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.95 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.95 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.95 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.95 |
COG2818 | 3-methyladenine DNA glycosylase Tag | Replication, recombination and repair [L] | 0.95 |
COG3682 | Transcriptional regulator, CopY/TcrY family | Transcription [K] | 0.95 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 80.95 % |
Unclassified | root | N/A | 19.05 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000890|JGI11643J12802_10355466 | Not Available | 791 | Open in IMG/M |
3300000891|JGI10214J12806_11074234 | Not Available | 692 | Open in IMG/M |
3300000891|JGI10214J12806_11275627 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
3300000953|JGI11615J12901_11556764 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300001431|F14TB_104572230 | Not Available | 621 | Open in IMG/M |
3300003996|Ga0055467_10046905 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
3300004480|Ga0062592_100260799 | All Organisms → cellular organisms → Bacteria | 1279 | Open in IMG/M |
3300005093|Ga0062594_102300492 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300005294|Ga0065705_10030474 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1330 | Open in IMG/M |
3300005294|Ga0065705_11071687 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300005295|Ga0065707_10087131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5137 | Open in IMG/M |
3300005330|Ga0070690_100451071 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
3300005331|Ga0070670_101030219 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
3300005336|Ga0070680_100074584 | All Organisms → cellular organisms → Bacteria | 2792 | Open in IMG/M |
3300005336|Ga0070680_101009153 | Not Available | 719 | Open in IMG/M |
3300005353|Ga0070669_101130723 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300005440|Ga0070705_100509490 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
3300005441|Ga0070700_101644984 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300005455|Ga0070663_102170079 | Not Available | 501 | Open in IMG/M |
3300005458|Ga0070681_10573645 | Not Available | 1042 | Open in IMG/M |
3300005546|Ga0070696_100880137 | Not Available | 742 | Open in IMG/M |
3300005577|Ga0068857_101876024 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300005578|Ga0068854_101117605 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
3300005615|Ga0070702_100560338 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
3300005615|Ga0070702_100936271 | Not Available | 681 | Open in IMG/M |
3300005719|Ga0068861_101512725 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
3300006196|Ga0075422_10099369 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
3300006844|Ga0075428_100477113 | All Organisms → cellular organisms → Bacteria | 1335 | Open in IMG/M |
3300006844|Ga0075428_100503078 | All Organisms → cellular organisms → Bacteria | 1296 | Open in IMG/M |
3300006844|Ga0075428_101175873 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
3300006844|Ga0075428_101953360 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300006845|Ga0075421_100437564 | All Organisms → cellular organisms → Bacteria | 1564 | Open in IMG/M |
3300006845|Ga0075421_100671171 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
3300006865|Ga0073934_10000068 | All Organisms → cellular organisms → Bacteria | 294972 | Open in IMG/M |
3300006876|Ga0079217_10096032 | All Organisms → cellular organisms → Bacteria | 1320 | Open in IMG/M |
3300006881|Ga0068865_100883959 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
3300006894|Ga0079215_11174391 | Not Available | 582 | Open in IMG/M |
3300007004|Ga0079218_10068933 | All Organisms → cellular organisms → Bacteria | 2291 | Open in IMG/M |
3300009094|Ga0111539_10000056 | All Organisms → cellular organisms → Bacteria | 114878 | Open in IMG/M |
3300009100|Ga0075418_10043191 | All Organisms → cellular organisms → Bacteria | 4859 | Open in IMG/M |
3300009100|Ga0075418_10572802 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
3300009147|Ga0114129_10805513 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
3300009147|Ga0114129_12749245 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300009156|Ga0111538_11513368 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
3300010040|Ga0126308_10007597 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 5266 | Open in IMG/M |
3300010047|Ga0126382_10371687 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Zavarzinella → Zavarzinella formosa | 1104 | Open in IMG/M |
3300010397|Ga0134124_11044101 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
3300011427|Ga0137448_1141228 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
3300011440|Ga0137433_1202215 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
3300011445|Ga0137427_10227205 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
3300012901|Ga0157288_10107213 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
3300014326|Ga0157380_10747759 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
3300014326|Ga0157380_11229296 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 794 | Open in IMG/M |
3300015374|Ga0132255_105212507 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300022880|Ga0247792_1107861 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300023102|Ga0247754_1111717 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
3300025310|Ga0209172_10000072 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 295037 | Open in IMG/M |
3300025315|Ga0207697_10165842 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
3300025559|Ga0210087_1034531 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
3300025901|Ga0207688_10874480 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300025903|Ga0207680_10295809 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1127 | Open in IMG/M |
3300025903|Ga0207680_10456251 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
3300025917|Ga0207660_10223175 | All Organisms → cellular organisms → Bacteria | 1479 | Open in IMG/M |
3300025918|Ga0207662_10243080 | All Organisms → cellular organisms → Bacteria | 1179 | Open in IMG/M |
3300025921|Ga0207652_10756338 | Not Available | 865 | Open in IMG/M |
3300025923|Ga0207681_11494275 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300025930|Ga0207701_10335346 | All Organisms → cellular organisms → Bacteria | 1309 | Open in IMG/M |
3300025933|Ga0207706_10300319 | All Organisms → cellular organisms → Bacteria | 1399 | Open in IMG/M |
3300025933|Ga0207706_11587322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 531 | Open in IMG/M |
3300025934|Ga0207686_11336887 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
3300025938|Ga0207704_10623275 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
3300025986|Ga0207658_11952464 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300026118|Ga0207675_100770058 | Not Available | 974 | Open in IMG/M |
3300027252|Ga0209973_1035933 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
3300027378|Ga0209981_1072286 | Not Available | 533 | Open in IMG/M |
3300027424|Ga0209984_1016239 | Not Available | 993 | Open in IMG/M |
3300027639|Ga0209387_1073095 | Not Available | 796 | Open in IMG/M |
3300027665|Ga0209983_1170248 | Not Available | 500 | Open in IMG/M |
3300027880|Ga0209481_10079154 | All Organisms → cellular organisms → Bacteria | 1564 | Open in IMG/M |
3300027886|Ga0209486_10034433 | All Organisms → cellular organisms → Bacteria | 2460 | Open in IMG/M |
3300027907|Ga0207428_10002483 | All Organisms → cellular organisms → Bacteria | 18414 | Open in IMG/M |
3300027909|Ga0209382_10024324 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 7328 | Open in IMG/M |
3300027909|Ga0209382_10208491 | All Organisms → cellular organisms → Bacteria | 2236 | Open in IMG/M |
3300027909|Ga0209382_10640440 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
3300027909|Ga0209382_12157035 | Not Available | 529 | Open in IMG/M |
3300028380|Ga0268265_10976314 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
3300028380|Ga0268265_11319947 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
3300028812|Ga0247825_10115392 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Zavarzinella → Zavarzinella formosa | 1825 | Open in IMG/M |
3300031184|Ga0307499_10282520 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300031538|Ga0310888_10085002 | All Organisms → cellular organisms → Bacteria | 1574 | Open in IMG/M |
3300031740|Ga0307468_100259283 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
3300031740|Ga0307468_101201919 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
3300031854|Ga0310904_10100506 | All Organisms → cellular organisms → Bacteria | 1588 | Open in IMG/M |
3300031943|Ga0310885_10142833 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Zavarzinella → Zavarzinella formosa | 1137 | Open in IMG/M |
3300031944|Ga0310884_10095781 | All Organisms → cellular organisms → Bacteria | 1443 | Open in IMG/M |
3300031944|Ga0310884_10393715 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 794 | Open in IMG/M |
3300032000|Ga0310903_10350978 | Not Available | 739 | Open in IMG/M |
3300032000|Ga0310903_10569898 | Not Available | 599 | Open in IMG/M |
3300032003|Ga0310897_10269020 | Not Available | 769 | Open in IMG/M |
3300032013|Ga0310906_10568339 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
3300032075|Ga0310890_10092071 | All Organisms → cellular organisms → Bacteria | 1875 | Open in IMG/M |
3300032075|Ga0310890_10691730 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
3300032144|Ga0315910_10452761 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
3300032174|Ga0307470_10583169 | Not Available | 833 | Open in IMG/M |
3300032179|Ga0310889_10272792 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 18.10% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 12.38% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.71% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.76% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.76% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 4.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.81% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.81% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 3.81% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.86% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.86% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.86% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.86% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.90% |
Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 1.90% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.90% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.90% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.90% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.90% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.90% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.90% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.90% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.95% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.95% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.95% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.95% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.95% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.95% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.95% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
3300003996 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300011427 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT418_2 | Environmental | Open in IMG/M |
3300011440 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2 | Environmental | Open in IMG/M |
3300011445 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2 | Environmental | Open in IMG/M |
3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300022880 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6 | Environmental | Open in IMG/M |
3300023102 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5 | Environmental | Open in IMG/M |
3300025310 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
3300025559 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027639 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes) | Environmental | Open in IMG/M |
3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI11643J12802_103554662 | 3300000890 | Soil | MRNVILGLICAAALALALSDLAVFGIAIWKIELAIVGMLLFVTAGRKAS* |
JGI10214J12806_110742342 | 3300000891 | Soil | PDFMRNAVLGLICAAALALALSDIAIFGIALWKIELAIVGALLFVTAGKKT* |
JGI10214J12806_112756272 | 3300000891 | Soil | MRNAVLGLICAAALAVSISGASIFGIAAWKIVLAAAGAVLFVITGKKT* |
JGI11615J12901_115567642 | 3300000953 | Soil | MRNAILGFICAATLALAFSDIAIFGIAMWKIELAVVGALVFITAGKKT* |
F14TB_1045722301 | 3300001431 | Soil | MRNAVLGLICAAALALALSDIAIFGIAIWKIELAIVGALLFVTAGRKAP* |
Ga0055467_100469052 | 3300003996 | Natural And Restored Wetlands | MRNAALGLICAAALALALSDIAIFGIAIWKIELAIVGALVFITAAGKKT* |
Ga0062592_1002607992 | 3300004480 | Soil | MRNAVLGLICAAALALALSDIAIFGIAIWKIELAIVGALLFVTSGKKT* |
Ga0062594_1023004922 | 3300005093 | Soil | MRNAVIGLICAAALAVSLSGASIFGIAAWKIVLAAAGAVLFVKTGKKT* |
Ga0065705_100304741 | 3300005294 | Switchgrass Rhizosphere | MRNAVLGLICAAALALALSDIAIFGIAMWKIELAIAGALLFITAGKKT* |
Ga0065705_110716871 | 3300005294 | Switchgrass Rhizosphere | MRNAVLGLICATALALALSDIAIFGIAMWKIELAIAGALLF |
Ga0065707_100871312 | 3300005295 | Switchgrass Rhizosphere | MRNAVLGLICATALALALSDIAIFGIAMWKIELAIAGALLFITAGKKT* |
Ga0070690_1004510711 | 3300005330 | Switchgrass Rhizosphere | MRNAVLGLICAAALALALSDIAIFGIAIWKIELAVVGALLFITAGKRT* |
Ga0070670_1010302192 | 3300005331 | Switchgrass Rhizosphere | MRNAILGLICAAALALAFSDIAIFGIAMWKIELAIVGALLFVTAGKKT* |
Ga0070680_1000745843 | 3300005336 | Corn Rhizosphere | MRNAVLGLICAAALALALSDIAIFGIAIWKIELAIVGALLFVTAGRKAS* |
Ga0070680_1010091532 | 3300005336 | Corn Rhizosphere | LGLICAAALALALSDLAIFGIAIWKIELAIVGMLLFVTAGRKAS* |
Ga0070669_1011307232 | 3300005353 | Switchgrass Rhizosphere | MRNAILGFVCAAALALALSDIAIFGIAIWKIELAIAGALLFVTAGKKT* |
Ga0070705_1005094902 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MRNVILGLICAAALALALSDLAIFGIAIWKIELAIVGMLLFVTAGRKAS* |
Ga0070700_1016449841 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MRNAVLGLICAAALALALSDIAIFGIAIWKIELAVVGALLFVTSGKKT* |
Ga0070663_1021700791 | 3300005455 | Corn Rhizosphere | AVLGLICAAALALALSDIAIFGIAIWKIELAIVGALLFVTSGKKT* |
Ga0070681_105736451 | 3300005458 | Corn Rhizosphere | LGLICAAALALALSDLAVFGIAIWKIELAIVGMLLFVTAGRKAS* |
Ga0070696_1008801372 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MRNAVLGLICAAALALALSDIAIFGIAIWKIELAIVGALLFVTAGKKAS* |
Ga0068857_1018760242 | 3300005577 | Corn Rhizosphere | MRNAVLGLICATALALALSDITIFGIAMWKIELAIAGALLFITAGKKT* |
Ga0068854_1011176052 | 3300005578 | Corn Rhizosphere | MRNAVLGLICAAALALALSDVAIFGIAMWKIELAIVGALLFVTAG |
Ga0070702_1005603381 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MRNAILGLICAAALALAFSDIAIFGIAMWKIELAIVGALLFVT |
Ga0070702_1009362711 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | PDFMRNAVLGLICAAALALALSDIAIFGIAIWKIELAIVGALLFVTAGRKAS* |
Ga0068861_1015127252 | 3300005719 | Switchgrass Rhizosphere | MRNAVLGLICAAALALALSDIAIFGIAMWKIELAIVGALLFVTAGKKAS* |
Ga0075422_100993692 | 3300006196 | Populus Rhizosphere | MRNAILGLICAAALALAFSDIAIFGIAMWKIELAIVGALLFITAGKKH* |
Ga0075428_1004771132 | 3300006844 | Populus Rhizosphere | MRNAALGLVCAAALALALSDITIFGIAIWKIELAIAGALLFVTAGKKT* |
Ga0075428_1005030782 | 3300006844 | Populus Rhizosphere | MRNAVLGLICAAALALALSDIAIVGIAMWKIELAIVGALLFITAGKKH* |
Ga0075428_1011758732 | 3300006844 | Populus Rhizosphere | MRNAILGLICAAALALAFSDIAIFGIAMWKIELAIV |
Ga0075428_1019533602 | 3300006844 | Populus Rhizosphere | DVPSRSLPRQQALSSDSMRNAALGLICAAALALALSDLTIFGIAVWKIELAVAGAVLFVTAGKKT* |
Ga0075421_1004375642 | 3300006845 | Populus Rhizosphere | MRNAALGLICAAALALALSDLTIFGIAVWKIELAVAGAVLFVTAGKKT* |
Ga0075421_1006711712 | 3300006845 | Populus Rhizosphere | MRNAVLGLICAAALALALSDIAIFGIAMWKIELAIVGALLFITAGKKT* |
Ga0073934_10000068127 | 3300006865 | Hot Spring Sediment | MRNAILGLICAAALALALSDITVFGIAIWKIELALAGLILYVSAGNRT* |
Ga0079217_100960322 | 3300006876 | Agricultural Soil | MRNAALGLVCAAALALALSDITIVGIAIWKIELALAGLVLFVTAGKKT* |
Ga0068865_1008839592 | 3300006881 | Miscanthus Rhizosphere | MRNAVLGLICAAALALALSDIAIFGIAIWKIELAVVGALLFITA |
Ga0079215_111743912 | 3300006894 | Agricultural Soil | SMRNAALGLVCAAALALALSDITIVGIAIWKIELALAGLVLFVTAGKKT* |
Ga0079218_100689333 | 3300007004 | Agricultural Soil | MRNAALGLICAGALALALSGVTVFGIAIWKIELAIAGALLFVTAGRKAS* |
Ga0111539_1000005688 | 3300009094 | Populus Rhizosphere | MRNAAIGLICAAALAIALSDFTILGIAVWKIELALAGLVLFVTAGKKT* |
Ga0075418_100431912 | 3300009100 | Populus Rhizosphere | MRNAVLGLICAAALALALSDIAIFGIAMWKIELAIVGALLFITAGKKH* |
Ga0075418_105728022 | 3300009100 | Populus Rhizosphere | MRNAALGLVCAAALALALSDITIFGIAIWKIELAIAGALLFVTAGKKP* |
Ga0114129_108055132 | 3300009147 | Populus Rhizosphere | MRNAALGLICAAALALALSDITIFGIAVWKIELAVAGAILFVTAGKKK* |
Ga0114129_127492452 | 3300009147 | Populus Rhizosphere | MRNAALGLVCAAALALALSDITIFGIAIWKIELAIAGALLFVTA |
Ga0111538_115133682 | 3300009156 | Populus Rhizosphere | MRNAILGFICAAALALAFSDISVFGIAMWKIELAIAGALLFITAGKKT* |
Ga0126308_100075972 | 3300010040 | Serpentine Soil | MRNAVLGLICAAALALALSDIALFGIAIWKIELAIVGALLFVTSGKKT* |
Ga0126382_103716871 | 3300010047 | Tropical Forest Soil | YHLRAAGSPDSMRNAAIGLICAAALALALSDLTIFGIAMWKIELAIVGALLFVTAGKKT* |
Ga0134124_110441011 | 3300010397 | Terrestrial Soil | MRNAILGLICAAALALAFSDIAIFGIAMWKIELAIVGALLFVTAGK |
Ga0137448_11412282 | 3300011427 | Soil | MRNAVLGLICAAALALAMSGFEVAGIAIWKIELAVFGALLFVTAGRKT* |
Ga0137433_12022152 | 3300011440 | Soil | MRNAVLGLICAAALALALSDIAIFGIAMWKIELAIVGALLFINAGKKA* |
Ga0137427_102272052 | 3300011445 | Soil | MRNAILGLIGAAALAVSFSGAEIYGIAAWKIVLAAAGAVLFVTAGKRAS* |
Ga0157288_101072132 | 3300012901 | Soil | MRNAVLGLICAAALALALSDIAIFGIAIWKIELAIVGALLFVTSVKKT* |
Ga0157380_107477592 | 3300014326 | Switchgrass Rhizosphere | MRNAVLGMICAAALALALSDIAIFGIAIRKIELAVVGALLFVTSGKKT* |
Ga0157380_112292962 | 3300014326 | Switchgrass Rhizosphere | GAYHGRPSPDVMRNAVLGLICAAALALALSDIAIFGIAIWKIELAIAGALLFITAGKKT* |
Ga0132255_1052125072 | 3300015374 | Arabidopsis Rhizosphere | MRNAILGFVCAAALALALSDIAIFGIAIWKIELAIAGALLFVT |
Ga0247792_11078612 | 3300022880 | Soil | MRNAVLGLICAAALALALSDIAIFGIAIWKIELAIVGALLFVTSGKKT |
Ga0247754_11117172 | 3300023102 | Soil | MRNAVLGLICAAALALALSDIAIFGIAIWKIELAI |
Ga0209172_10000072123 | 3300025310 | Hot Spring Sediment | MRNAILGLICAAALALALSDITVFGIAIWKIELALAGLILYVSAGNRT |
Ga0207697_101658422 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MRNAVLGLICAAALALALSDIAIFGIAIWKIELAVVGALLFITAGKRT |
Ga0210087_10345311 | 3300025559 | Natural And Restored Wetlands | MRNAALGLICAAALALALSDIAIFGIAIWKIELAIVGALVFITAAGKKT |
Ga0207688_108744801 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MRNAILGLICAAALALAFSDIAIFGIAMWKIELAIVGALLFVTAGKKT |
Ga0207680_102958091 | 3300025903 | Switchgrass Rhizosphere | RSPRFHMRNAVLGLICAAALALALSDIAIFGIAIWKIELAVVGALLFITAGKRT |
Ga0207680_104562512 | 3300025903 | Switchgrass Rhizosphere | MRNAVLGLICAAALALALSDIAIFGIAIWKIELAVVGA |
Ga0207660_102231751 | 3300025917 | Corn Rhizosphere | MRNAVLGLICAAALALALSDIAIFGIAMWKIELAIVGA |
Ga0207662_102430802 | 3300025918 | Switchgrass Rhizosphere | MRNAVLGLICAAALALALSDIAIFGIAIWKIELAVVGALLFVTSGKKT |
Ga0207652_107563382 | 3300025921 | Corn Rhizosphere | TRQVSPDSMRNVILGLICAAALALALSDLAIFGIAIWKIELAIVGMLLFVTAGRKAS |
Ga0207681_114942752 | 3300025923 | Switchgrass Rhizosphere | MRNAILGFVCAAALALALSDIAIFGIAIWKIELAIAGALLFVTAGKKT |
Ga0207701_103353462 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MRNAVLGLICAAALALALSDIAIFGIAIRKIELAVVGALLFITAGKRT |
Ga0207706_103003191 | 3300025933 | Corn Rhizosphere | GSGRSPRFHMRNAVLGLICAAALALALSDIAIFGIAIWKIELAVVGALLFITAGKRT |
Ga0207706_115873221 | 3300025933 | Corn Rhizosphere | MRNVILGLICAAALALALSDLAIFGIAIWKIELAIVGMLLFVTAGRKAS |
Ga0207686_113368872 | 3300025934 | Miscanthus Rhizosphere | MRNAVLGLICAAALALALSDLAIFGIAIWKIELAIVGMLLFVTAGRKAS |
Ga0207704_106232751 | 3300025938 | Miscanthus Rhizosphere | MRNAVLGLICAAALALALSDIAIFGIAIWKIELAVVGALLFITAG |
Ga0207658_119524641 | 3300025986 | Switchgrass Rhizosphere | MRNAVLGLICAAALALALSDIAIFGIAIWKIELAVVGALLFVT |
Ga0207675_1007700582 | 3300026118 | Switchgrass Rhizosphere | VSPDFMRNAVLGLICAAALALALSDIAIFGIAMWKIELAIVGALLFVTAGKKAS |
Ga0209973_10359332 | 3300027252 | Arabidopsis Thaliana Rhizosphere | MRNAVLGLICAAALALALSDIAIFGIALWKIELAIVGALLF |
Ga0209981_10722862 | 3300027378 | Arabidopsis Thaliana Rhizosphere | MRNAVLGLICAAALALALSDIAIFGIALWKIELAIVGALLFVTAGKKT |
Ga0209984_10162392 | 3300027424 | Arabidopsis Thaliana Rhizosphere | MRNVILGLICAAALALALSDIAIFGIALWKIELAIVGALLFVTAGKKT |
Ga0209387_10730952 | 3300027639 | Agricultural Soil | MRNAALGLVCAAALALALSDITIVGIAIWKIELALAGLVLFVTAGKKT |
Ga0209983_11702481 | 3300027665 | Arabidopsis Thaliana Rhizosphere | TLRKRQVSPDFMRNAVLGLICAAALALALSDIAIFGIALWKIELAIVGALLFVTAGKKT |
Ga0209481_100791542 | 3300027880 | Populus Rhizosphere | MRNAVLGLICAAALALALSDIAIVGIAMWKIELAIVGALLFITAGKKH |
Ga0209486_100344333 | 3300027886 | Agricultural Soil | MRNAALGLICAGALALALSGVTVFGIAIWKIELAIAGALLFVTAGRKAS |
Ga0207428_1000248317 | 3300027907 | Populus Rhizosphere | MRNAAIGLICAAALAIALSDFTILGIAVWKIELALAGLVLFVTAGKKT |
Ga0209382_100243246 | 3300027909 | Populus Rhizosphere | MRNAALGLICAAALALALSDLTIFGIAVWKIELAVAGAVLFVTAGKKT |
Ga0209382_102084912 | 3300027909 | Populus Rhizosphere | MRNAALGLVCAAALALALSDITIFGIAIWKIELAIAGALLFVTAGKKT |
Ga0209382_106404402 | 3300027909 | Populus Rhizosphere | MRNAVLGLICAAALALALSDIAIFGIAMWKIELAIVGALLFITAGKKT |
Ga0209382_121570351 | 3300027909 | Populus Rhizosphere | RNAALGLVCAAALALALSDITIFGIAIWKIELAIAGALLFVTAGKKT |
Ga0268265_109763141 | 3300028380 | Switchgrass Rhizosphere | MRNAVLGLICAAALALALSDIAIFGIAIWKIELAVVG |
Ga0268265_113199472 | 3300028380 | Switchgrass Rhizosphere | MRNAVIGLICAAALAVSLSGASIFGIAAWKIVLAAAGAVLFVKTGKKT |
Ga0247825_101153921 | 3300028812 | Soil | MRNAILGLIGAAALAVSFSGMEIFGIAAWKIVLAAAGAALFVTAGKKT |
Ga0307499_102825202 | 3300031184 | Soil | MRNAVLGLICAAALALALSDIAIFGIAIWKIELAVAGALLFITAGKKT |
Ga0310888_100850022 | 3300031538 | Soil | MRNAVLGLICAAALALALSDIAIFGIAIWKIELAIAGALLFITAGKKT |
Ga0307468_1002592831 | 3300031740 | Hardwood Forest Soil | MRNAVLGLICAAALAVSLSGASIFGIAAWKIVLAAAGAVLFVITGKKT |
Ga0307468_1012019191 | 3300031740 | Hardwood Forest Soil | MRNAVLGLICAAALAIALSDIAIFGIAIWKIELAI |
Ga0310904_101005062 | 3300031854 | Soil | MRNAVLGLICAAALAVSISGASIFGIAAWKIVLAAAGAVLFVITGKKT |
Ga0310885_101428331 | 3300031943 | Soil | QVSPVNSMRNAVLGLICAAALAVSISGASIFGIAAWKIVLAAAGAVLFVITGKKT |
Ga0310884_100957812 | 3300031944 | Soil | MRNAVLGLICAAALALALSDIAIFGIAIWKIELAIA |
Ga0310884_103937152 | 3300031944 | Soil | GRPSPDFMRNAVLGLICAAALALALSDIAIFGIAIWKIELAIAGALLFITAGKKT |
Ga0310903_103509781 | 3300032000 | Soil | VLGLICAAALAVSISGASLFGIAAWKIVLAAAGAVLFVKTGKKT |
Ga0310903_105698981 | 3300032000 | Soil | VLGLICAAALAVSISGASIFGIAAWKIVLAAAGAVLFVITGKKT |
Ga0310897_102690202 | 3300032003 | Soil | RPSPDPMRNAILGLICAAALALAFSDIAIFGIAMWKIELAIVGALLFVTAGKKT |
Ga0310906_105683392 | 3300032013 | Soil | VNSMRNAVLGLICAAALAVSISGASIFGIAAWKIVLAAAGAVLFVITGKKT |
Ga0310890_100920711 | 3300032075 | Soil | MRNAVLGLICAAALALALSDIAIFGIAIWKIELAVVGALLFVTSGKK |
Ga0310890_106917301 | 3300032075 | Soil | VNSMRNAVLGLICAAALAVSISGASIFGIAAWKIVLAAAGAVLFVITGK |
Ga0315910_104527612 | 3300032144 | Soil | MRNAVLGLVCAAALALALSDLSIFGIAIWKIELAVVGALLFITAGKKT |
Ga0307470_105831692 | 3300032174 | Hardwood Forest Soil | TRGAGLPSDSMRNAVLGLICAAALAVSLSGASIFGIAAWKIVLAAAGAVLFVITGKKT |
Ga0310889_102727921 | 3300032179 | Soil | MRNAVLGLVCAAALALALSDIAIFGIAIWKIELAIAGALLFVTAGKKT |
⦗Top⦘ |