NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F095869

Metagenome / Metatranscriptome Family F095869

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F095869
Family Type Metagenome / Metatranscriptome
Number of Sequences 105
Average Sequence Length 49 residues
Representative Sequence ASDFPHEGIVDMKKAVDEFLSREDIPEAAKRKISYDNPKRLYGL
Number of Associated Samples 94
Number of Associated Scaffolds 105

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.86 %
% of genes near scaffold ends (potentially truncated) 93.33 %
% of genes from short scaffolds (< 2000 bps) 89.52 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction Yes
3D model pTM-score0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.286 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(10.476 % of family members)
Environment Ontology (ENVO) Unclassified
(32.381 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(34.286 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 36.11%    β-sheet: 0.00%    Coil/Unstructured: 63.89%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 105 Family Scaffolds
PF07883Cupin_2 34.29
PF01042Ribonuc_L-PSP 26.67
PF04909Amidohydro_2 6.67
PF13482RNase_H_2 3.81
PF01565FAD_binding_4 2.86
PF02146SIR2 1.90
PF04972BON 1.90
PF01315Ald_Xan_dh_C 1.90
PF01797Y1_Tnp 1.90
PF02069Metallothio_Pro 0.95
PF08031BBE 0.95
PF00881Nitroreductase 0.95
PF04255DUF433 0.95
PF08915tRNA-Thr_ED 0.95
PF00515TPR_1 0.95

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 105 Family Scaffolds
COG0251Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 familyDefense mechanisms [V] 26.67
COG0846NAD-dependent protein deacetylase, SIR2 familyPosttranslational modification, protein turnover, chaperones [O] 1.90
COG1943REP element-mobilizing transposase RayTMobilome: prophages, transposons [X] 1.90
COG0277FAD/FMN-containing lactate dehydrogenase/glycolate oxidaseEnergy production and conversion [C] 0.95
COG0441Threonyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.95
COG2442Predicted antitoxin component of a toxin-antitoxin system, DUF433 familyDefense mechanisms [V] 0.95


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.29 %
UnclassifiedrootN/A5.71 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090014|GPIPI_17045356All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1081Open in IMG/M
2162886012|MBSR1b_contig_13401870All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium970Open in IMG/M
3300000033|ICChiseqgaiiDRAFT_c0753455Not Available2985Open in IMG/M
3300000890|JGI11643J12802_12268423All Organisms → cellular organisms → Bacteria1914Open in IMG/M
3300002128|JGI24036J26619_10108825All Organisms → cellular organisms → Bacteria → Proteobacteria568Open in IMG/M
3300005169|Ga0066810_10184483All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria516Open in IMG/M
3300005183|Ga0068993_10341504All Organisms → cellular organisms → Bacteria → Proteobacteria547Open in IMG/M
3300005289|Ga0065704_10243029All Organisms → cellular organisms → Bacteria → Proteobacteria995Open in IMG/M
3300005356|Ga0070674_100101594All Organisms → cellular organisms → Bacteria2096Open in IMG/M
3300005518|Ga0070699_100553883All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1047Open in IMG/M
3300005518|Ga0070699_101487361All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium621Open in IMG/M
3300005536|Ga0070697_100255879All Organisms → cellular organisms → Bacteria1498Open in IMG/M
3300005575|Ga0066702_10737779All Organisms → cellular organisms → Bacteria → Proteobacteria586Open in IMG/M
3300005844|Ga0068862_101305767All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium727Open in IMG/M
3300006049|Ga0075417_10250689All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales849Open in IMG/M
3300006175|Ga0070712_100213241All Organisms → cellular organisms → Bacteria1524Open in IMG/M
3300006844|Ga0075428_100633639All Organisms → cellular organisms → Bacteria1141Open in IMG/M
3300006845|Ga0075421_100529998All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1395Open in IMG/M
3300006852|Ga0075433_10853450All Organisms → cellular organisms → Bacteria → Proteobacteria795Open in IMG/M
3300006881|Ga0068865_101033082All Organisms → cellular organisms → Bacteria → Proteobacteria721Open in IMG/M
3300006904|Ga0075424_102341462All Organisms → cellular organisms → Bacteria → Proteobacteria561Open in IMG/M
3300007004|Ga0079218_10240037All Organisms → cellular organisms → Bacteria1420Open in IMG/M
3300007076|Ga0075435_101819222All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium535Open in IMG/M
3300009012|Ga0066710_101655996All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium977Open in IMG/M
3300009078|Ga0105106_10743051All Organisms → cellular organisms → Bacteria → Proteobacteria700Open in IMG/M
3300009078|Ga0105106_11243856All Organisms → cellular organisms → Bacteria → Proteobacteria528Open in IMG/M
3300009094|Ga0111539_13257634All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium523Open in IMG/M
3300009098|Ga0105245_11069081All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium853Open in IMG/M
3300009156|Ga0111538_10667928Not Available1317Open in IMG/M
3300009162|Ga0075423_10012630All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium8196Open in IMG/M
3300009168|Ga0105104_10643633All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium606Open in IMG/M
3300009609|Ga0105347_1007376All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium3859Open in IMG/M
3300009678|Ga0105252_10242365All Organisms → cellular organisms → Bacteria → Proteobacteria787Open in IMG/M
3300009814|Ga0105082_1122074All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium508Open in IMG/M
3300010043|Ga0126380_11128042All Organisms → cellular organisms → Bacteria → Proteobacteria670Open in IMG/M
3300010043|Ga0126380_12042470All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300010047|Ga0126382_10786891Not Available809Open in IMG/M
3300010047|Ga0126382_11297757All Organisms → cellular organisms → Bacteria658Open in IMG/M
3300010362|Ga0126377_10390793All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1399Open in IMG/M
3300010397|Ga0134124_10774902All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium956Open in IMG/M
3300010397|Ga0134124_11395996All Organisms → cellular organisms → Bacteria → Proteobacteria726Open in IMG/M
3300011332|Ga0126317_11081854All Organisms → cellular organisms → Bacteria → Proteobacteria628Open in IMG/M
3300011397|Ga0137444_1053290All Organisms → cellular organisms → Bacteria → Proteobacteria626Open in IMG/M
3300011437|Ga0137429_1012055All Organisms → cellular organisms → Bacteria → Proteobacteria2463Open in IMG/M
3300012039|Ga0137421_1095354All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium853Open in IMG/M
3300012469|Ga0150984_120883195All Organisms → cellular organisms → Bacteria → Proteobacteria565Open in IMG/M
3300012924|Ga0137413_10970033All Organisms → cellular organisms → Bacteria → Proteobacteria665Open in IMG/M
3300012929|Ga0137404_10932516All Organisms → cellular organisms → Bacteria → Proteobacteria793Open in IMG/M
3300012930|Ga0137407_12238739All Organisms → cellular organisms → Bacteria → Proteobacteria522Open in IMG/M
3300012931|Ga0153915_10469360All Organisms → cellular organisms → Bacteria → Proteobacteria1435Open in IMG/M
3300012976|Ga0134076_10174490All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria891Open in IMG/M
3300013096|Ga0157307_1029989All Organisms → cellular organisms → Bacteria → Proteobacteria941Open in IMG/M
3300014265|Ga0075314_1000187All Organisms → cellular organisms → Bacteria → Proteobacteria9865Open in IMG/M
3300014883|Ga0180086_1025188All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1350Open in IMG/M
3300014884|Ga0180104_1003730All Organisms → cellular organisms → Bacteria → Proteobacteria3240Open in IMG/M
3300015254|Ga0180089_1041252All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium894Open in IMG/M
3300015374|Ga0132255_105198948All Organisms → cellular organisms → Bacteria → Proteobacteria551Open in IMG/M
3300015374|Ga0132255_105663537All Organisms → cellular organisms → Bacteria → Proteobacteria529Open in IMG/M
3300017966|Ga0187776_10182309All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1311Open in IMG/M
3300018063|Ga0184637_10307599All Organisms → cellular organisms → Bacteria959Open in IMG/M
3300018063|Ga0184637_10324200All Organisms → cellular organisms → Bacteria930Open in IMG/M
3300018063|Ga0184637_10763378All Organisms → cellular organisms → Bacteria → Proteobacteria520Open in IMG/M
3300018082|Ga0184639_10228684All Organisms → cellular organisms → Bacteria985Open in IMG/M
3300018082|Ga0184639_10250560All Organisms → cellular organisms → Bacteria936Open in IMG/M
3300018422|Ga0190265_11914969All Organisms → cellular organisms → Bacteria → Proteobacteria699Open in IMG/M
3300018422|Ga0190265_13016095All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae → Nostoc → unclassified Nostoc → Nostoc sp. CHAB 5844562Open in IMG/M
3300019208|Ga0180110_1174948All Organisms → cellular organisms → Bacteria → Proteobacteria601Open in IMG/M
3300020003|Ga0193739_1042256All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1179Open in IMG/M
3300020018|Ga0193721_1006222All Organisms → cellular organisms → Bacteria3125Open in IMG/M
3300020065|Ga0180113_1290544All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1099Open in IMG/M
3300021051|Ga0206224_1022653All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium754Open in IMG/M
3300022534|Ga0224452_1047205All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1274Open in IMG/M
3300025569|Ga0210073_1059375All Organisms → cellular organisms → Bacteria → Proteobacteria804Open in IMG/M
3300025925|Ga0207650_10763974All Organisms → cellular organisms → Bacteria → Proteobacteria818Open in IMG/M
3300025936|Ga0207670_10163363All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1664Open in IMG/M
3300026121|Ga0207683_12077638All Organisms → cellular organisms → Bacteria → Proteobacteria516Open in IMG/M
3300026535|Ga0256867_10344309All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium521Open in IMG/M
3300027395|Ga0209996_1033811All Organisms → cellular organisms → Bacteria → Proteobacteria748Open in IMG/M
3300027722|Ga0209819_10126534All Organisms → cellular organisms → Bacteria894Open in IMG/M
3300027840|Ga0209683_10598304All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium501Open in IMG/M
3300027862|Ga0209701_10452428All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium706Open in IMG/M
3300027873|Ga0209814_10016034All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium3005Open in IMG/M
3300027909|Ga0209382_10762784All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1034Open in IMG/M
3300027952|Ga0209889_1004826All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium3668Open in IMG/M
3300028380|Ga0268265_10499803All Organisms → cellular organisms → Bacteria1146Open in IMG/M
3300030006|Ga0299907_10368277All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1160Open in IMG/M
3300030570|Ga0247647_1162863All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium612Open in IMG/M
3300031226|Ga0307497_10545789All Organisms → cellular organisms → Bacteria → Proteobacteria579Open in IMG/M
3300031469|Ga0170819_14627909All Organisms → cellular organisms → Bacteria → Proteobacteria561Open in IMG/M
3300031538|Ga0310888_10976843All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium531Open in IMG/M
3300031548|Ga0307408_100164404Not Available1766Open in IMG/M
3300031720|Ga0307469_11681293All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium611Open in IMG/M
3300031852|Ga0307410_10211381All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1487Open in IMG/M
3300031858|Ga0310892_10156760Not Available1327Open in IMG/M
3300031962|Ga0307479_11552108All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium618Open in IMG/M
3300031965|Ga0326597_10258422All Organisms → cellular organisms → Bacteria → Proteobacteria2005Open in IMG/M
3300032001|Ga0306922_10685331All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1080Open in IMG/M
3300032003|Ga0310897_10664672All Organisms → cellular organisms → Bacteria → Proteobacteria520Open in IMG/M
3300032005|Ga0307411_10129687All Organisms → cellular organisms → Bacteria → Proteobacteria1841Open in IMG/M
3300032005|Ga0307411_10748118Not Available856Open in IMG/M
3300032075|Ga0310890_10217790All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1322Open in IMG/M
3300032163|Ga0315281_11778785All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300032174|Ga0307470_10609893All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium817Open in IMG/M
3300033433|Ga0326726_10651705All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1014Open in IMG/M
3300033486|Ga0316624_12268487All Organisms → cellular organisms → Bacteria → Proteobacteria505Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere10.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.57%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil7.62%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment4.76%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.76%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment3.81%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.81%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.81%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere3.81%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.86%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.90%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.90%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.90%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.90%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.90%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.90%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.95%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.95%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.95%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.95%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.95%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.95%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.95%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.95%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.95%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.95%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.95%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.95%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.95%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment0.95%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.95%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.95%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.95%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.95%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.95%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090014Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
2162886012Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300002128Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5EnvironmentalOpen in IMG/M
3300005169Soil and rhizosphere microbial communities from Laval, Canada - mgHPAEnvironmentalOpen in IMG/M
3300005183Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1EnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009609Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890EnvironmentalOpen in IMG/M
3300009678Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100EnvironmentalOpen in IMG/M
3300009814Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300011332Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300011397Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT319_2EnvironmentalOpen in IMG/M
3300011437Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2EnvironmentalOpen in IMG/M
3300012039Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT534_2EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300013096Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2EnvironmentalOpen in IMG/M
3300014265Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D2EnvironmentalOpen in IMG/M
3300014883Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10DEnvironmentalOpen in IMG/M
3300014884Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1DaEnvironmentalOpen in IMG/M
3300015254Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10DEnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300019208Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT231_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020003Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2EnvironmentalOpen in IMG/M
3300020018Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2EnvironmentalOpen in IMG/M
3300020065Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT499_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021051Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos A1EnvironmentalOpen in IMG/M
3300022534Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1EnvironmentalOpen in IMG/M
3300025569Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026535Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq)EnvironmentalOpen in IMG/M
3300027395Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027722Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027840Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300027952Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300030570Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb12 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033486Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_AEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPIPI_013501302088090014SoilMTTSRDLELLGDDCLFWASDFPHEGIVDMAKAVKEFLDREDIPDAAKRKISYXNPKRLYA
MBSR1b_0772.000034002162886012Miscanthus RhizosphereFQCGEEMTTGRDLELLGDECLFWASDFPHEGIVSMSKAVKEFLDREDIPEGSKRKISYDNPKRLYRI
ICChiseqgaiiDRAFT_075345543300000033SoilCLFWASDFPHEGIVDMSKAVEEFLSRDDIPASAKKKISYDNAKKLYGL*
JGI11643J12802_1226842353300000890SoilFQCGEEMTTSRDLELLGTECLFWASDFPHEGIVDMSKAVKEFLSREDIPESAKRKISHDNPKRLYGL*
JGI24036J26619_1010882523300002128Corn, Switchgrass And Miscanthus RhizosphereIVDMKKAVDEFLSREDIPEAAKRKISYDNPKRLYGL*
Ga0066810_1018448323300005169SoilFWASDFPHEGIVDMAKAVKEFLDREDIPDAAKRKISYDNPKRLYAL*
Ga0068993_1034150423300005183Natural And Restored WetlandsLGDECLFWASDFPHEGIVSMKKAVQEFLDRDDIPMASKRKISYDNPKKLYAL*
Ga0065704_1024302933300005289Switchgrass RhizosphereSDFPHEGIVDMAKAVTEFLERKDISKASKRKISYDNSKKLYGL*
Ga0070674_10010159413300005356Miscanthus RhizosphereLFWASDFPHEGIVDMSKAVEEFLSRGDIPASSKRKISYDNAKKLYGL*
Ga0070699_10055388313300005518Corn, Switchgrass And Miscanthus RhizosphereDFPHEGIVSMKKAVDEFLERDDIPAASKRKIGRENPKKLYRL*
Ga0070699_10148736123300005518Corn, Switchgrass And Miscanthus RhizosphereDFPHEGIVSMSKAVKEFLDREDIPEGSKRKISYDNPKRLYRI*
Ga0070697_10025587943300005536Corn, Switchgrass And Miscanthus RhizosphereASDFPHEGIVDMKKAVDEFLSREDIPEAAKRKISYDNPKRLYGL*
Ga0066702_1073777913300005575SoilCGEEMTTSRDLELLGDACLFWASDFPHEGIVDMSKAVNEFLSREDIPEAAKRKISYDNPKRLYRL*
Ga0068862_10130576713300005844Switchgrass RhizosphereEGIVSMSKAVKEFLDREDIPEGAKRKISYENPKRLYRI*
Ga0075417_1025068933300006049Populus RhizosphereDMSKAVNEFLSRGDIPEASKRKISYANPKRLYAL*
Ga0070712_10021324143300006175Corn, Switchgrass And Miscanthus RhizosphereECLFWASDFPHEGIVDMSKAVNEFLSREDIPEAAKRKISYDNPKRLYRI*
Ga0075428_10063363913300006844Populus RhizosphereFPHEGIVDMSKAVNEFLSRGDIPEASKRKISYANPKRLYAL*
Ga0075421_10052999813300006845Populus RhizosphereCLFWASDFPHEGIVSMKKAVDEFLDRHDIPEASKRKIGRENPKMLYRL*
Ga0075433_1085345013300006852Populus RhizosphereFPHEGIVDMKKAVDEFLSREDIPEAAKRKISYDNPKRLYGL*
Ga0068865_10103308223300006881Miscanthus RhizosphereFWASDFPHEGIVSMSKAVKEFLDREDIPEGSKRKISYDNPKRLYRL*
Ga0075424_10234146223300006904Populus RhizospherePHEGIVNMRKAVDEFLDREDISATAKKKISYDNPKKLYRL*
Ga0079218_1024003743300007004Agricultural SoilDECLFWASDFPHEGIVDMSKAVNEFLSREDIPTGAKRKISYDNPKRLYRL*
Ga0075435_10181922223300007076Populus RhizosphereASDFPHEGILDMATAVKEFLTREDIPAEAKYKIGNENPRRLYGLG*
Ga0066710_10165599613300009012Grasslands SoilHEGIVDMSKAVNEFLSREDIPETSKRKISYDNPKRLYGL
Ga0105106_1074305123300009078Freshwater SedimentGEEMTTSRDLELLGDECLFWASDFPHEGIVSMKKAVDEFLDREDIPEASKRKISYDNPKKLYGL*
Ga0105106_1124385623300009078Freshwater SedimentSMKKAVDEFVEREDIPEAAKRKISYDNPKRLYAL*
Ga0111539_1325763413300009094Populus RhizosphereQVYFQCGEEMTTGRDLELLGDQCLFWASDFPHEGIVDMSKAVEEFLSRGDIPASSKRKISYDNAKKLYGL*
Ga0105245_1106908113300009098Miscanthus RhizosphereFQCGEESTTRRDLEILGDGCLVWASDFPHEGIVNMAKAAGAFITRPDIPESSKRKIAEENPQRLYNLS*
Ga0111538_1066792813300009156Populus RhizosphereQCLFWASDFPHEGIVDMSKAVEEFLSRGDIPASSKRKISYDNAKKLYGL*
Ga0075423_10012630133300009162Populus RhizosphereELLGDECLFWASEFPHEGIVDMSKAVNEFLSREDIPEAAKRKISYDNPKRLYRI*
Ga0105104_1064363313300009168Freshwater SedimentWPNRKWASDFPHEGIVDMAKAVREFLEREDIPDAAKRKITYDNAKRLYGL*
Ga0105347_100737653300009609SoilCLFWASDFPHEGIVSMKKAVDEFVEREDIPEAAKRKISYDNPKRLYGL*
Ga0105252_1024236513300009678SoilDECLFWASDFPHEGIVSMKKAVQEFLDREDIPETSKRKISYDNPKKLYAL*
Ga0105082_112207413300009814Groundwater SandGDECLFWASDFPHEGIVSMKKAVQEFLDRDDIPEPAKRKISYDNPKKLYGL*
Ga0126380_1112804213300010043Tropical Forest SoilMTTSRDLELLGDECLFWASDFPHEGIVSMGNAVKEFLDRDDISDASKQKISYDNPKRLYAL*
Ga0126380_1204247013300010043Tropical Forest SoilMAAAVKEFLTREDIPLEAKRKIAGDNPKRLYGIRN*
Ga0126382_1078689123300010047Tropical Forest SoilYFQCGEELTTQRDLELLGDHCMLWATNFPHEGIVDMAAAVKEFLTREDIPLEAKRKIAGDNPKRLYGIRN*
Ga0126382_1129775723300010047Tropical Forest SoilMITRRDLELLGDECPFWPSDFTHEGIVDIAKAVNELLDRKDILEPAKRKISYDNPKNLYKI*
Ga0126377_1039079333300010362Tropical Forest SoilMTTRRDLELLGDECPFWPSDFTHEGIVDIAKAVNELLDRKDILEPAKRKISYDNPKNLYKI*
Ga0134124_1077490233300010397Terrestrial SoilCLFWASDFPHEGIVSMGKAVEEFLEREDIPEPAKRKISYDNPKRLYGL*
Ga0134124_1139599623300010397Terrestrial SoilGEEMTTSRDLELLGDECLFWASDFPHEGIVDMSKAVKEFLGRDDIPERAKHKISYENPKRLYRL*
Ga0126317_1108185413300011332SoilTDMRKAVQEFTTREDIPESAKRKISYDNPKKLYRL*
Ga0137444_105329023300011397SoilCLFWASDFPHEGIVSMKKAVQEFLDRNDIPEASKRKISYDNPKKLYGL*
Ga0137429_101205513300011437SoilSRDLELLGDECLFWASDFPHEGIVSMKKAVQEFLDREDIPETSKRKISYDNPKKLYAL*
Ga0137421_109535433300012039SoilEGIADMTKAVREFLDRRDISEASKRKISYDNPKRLYAL*
Ga0150984_12088319513300012469Avena Fatua RhizosphereFWASDFPHEGITDMRKAVQEFTGREDIPEPAKRKISYDNPKKLYRL*
Ga0137413_1097003313300012924Vadose Zone SoilASDFPHEGIVDMSKAVNEFLSREDIPEAAKRKISYDNPKNLYRL*
Ga0137404_1093251613300012929Vadose Zone SoilSRDLELLGDDCLFWASDFPHEGIVDMAKAVKEFLDREDIPDAAKRNISYDNPKRLYVL*
Ga0137407_1223873923300012930Vadose Zone SoilEGIVDMSKAVNEFLSREDIPEASKGKISYDNPKRLYGL*
Ga0153915_1046936043300012931Freshwater WetlandsASDFPHEGIVDMRKAVNEFLERDDIPPAAKRKISYDNPKRLYRL*
Ga0134076_1017449013300012976Grasslands SoilIYFQCGEELTTRRDLELLGDHCLLWASDFPHEGITDMATAVKQFLMREDIPPESKRKIASENPKSLYATAR*
Ga0157307_102998933300013096SoilVDMKKAVDEFLSREDIPEAAKRKISYDNPKRLYGL*
Ga0075314_100018713300014265Natural And Restored WetlandsEECLFWASDFPHEGIVDMGKAVKEFLSREDISEAAKQKISYENPKRLYRL*
Ga0180086_102518833300014883SoilEEMTTGRDLELLGDECLFWASDFPHEGIVSMKKAVDEFLDRDDIPTAAKRKISYDNPKRLYGL*
Ga0180104_100373063300014884SoilLFWASDFPHEGIVDMSKAVNEFLGREDLSAASKRKISYDNPKKLYGL*
Ga0180089_104125213300015254SoilDMSKAVNEFLGREDLSAASKRKISYDNPKKLYGL*
Ga0132255_10519894823300015374Arabidopsis RhizosphereIVDMSKAVNEFLSREDIPEAAKRKISYDNPKRLYRI*
Ga0132255_10566353723300015374Arabidopsis RhizosphereDMSKAVNEFLSREDIPEAAKRKISYDNPKRLYGL*
Ga0187776_1018230913300017966Tropical PeatlandLFWASDFPHEGIVSMKKAVQEFLDREDIPQAAKRKISYDNPKRLYGL
Ga0184637_1030759933300018063Groundwater SedimentSDFPHEGIVDMSRAVKEFLDRDDIPEPAKRKISYENPKRLYGL
Ga0184637_1032420033300018063Groundwater SedimentPHEGIVDMGKAVKDFLQRQDIPNGSKRKISYDNPKRLYAL
Ga0184637_1076337813300018063Groundwater SedimentSDFPHEGIVDMSRAVKEFLDRDDIPEPAKRKISYENPKRLYRL
Ga0184639_1022868433300018082Groundwater SedimentDFPHEGIVDMSRAVKEFLDRDDIPEPAKRKISYENPKRLYGL
Ga0184639_1025056033300018082Groundwater SedimentFWASDFPHEGIVDMGKAVKDFLQRQDIPNGSKRKISYDNPKRLYAL
Ga0190265_1191496913300018422SoilSDFPHEGIVDMSKAVHEFLSRADIPAGAKRKISYDNPKRLYRI
Ga0190265_1301609513300018422SoilDHCLFWASDFPHEGIVDMTKAVKEFLSRDDIPASSKKKISYDNAKRLYGL
Ga0180110_117494823300019208Groundwater SedimentVSMKKAVQEFLDRNDIPEASKRKIGRENPKKLYRL
Ga0193739_104225633300020003SoilLLGDECLFWASDFPHEGIVDMSRAVREFLDRDDIPEPAKRKISYENPKRLYRL
Ga0193721_100622213300020018SoilELLGDECLFWASDFPHEGIVDMSKAVNEFLSREDIPEAAKRKISYDNPKRLYRI
Ga0180113_129054433300020065Groundwater SedimentLGDECLFWASDFPHEGIVDMSKAVNEFLGREDLSAASKRKISYDNPKKLYGL
Ga0206224_102265313300021051Deep Subsurface SedimentTGRDLELLGDECLFWASDFPHEGIVSMKKAVQEFLDREDIPQVSKRKISYDNPKKLYGL
Ga0224452_104720513300022534Groundwater SedimentIVDMAKAVKEFLDREDIPDAAKRKISYENPKRLYAL
Ga0210073_105937523300025569Natural And Restored WetlandsLELLGDGCLFWASDFPHEGIVSMKKAVQEFLDRDDIPAASKRKISYDNPKKLYAL
Ga0207650_1076397423300025925Switchgrass RhizospherePHEGIVDMKKAVDEFLSREDIPEAAKRKISYDNPKRLYGL
Ga0207670_1016336343300025936Switchgrass RhizosphereFGIVDMSKAVNEFLSREDIPEAAKRKISYDNPKRLYGL
Ga0207683_1207763813300026121Miscanthus RhizosphereLLGDQCLFWASDFPHEGIVDMSKAVNEFLSREDIPEAAKRKISYDNPKRLYRI
Ga0256867_1034430933300026535SoilPRASKLIERGQLYFQCGEEMTTSRDLDLLGDECLFWASDFPHEGIVDMAKAVSEFLERKDIPAASKLKIGYDNPKKLYAL
Ga0209996_103381133300027395Arabidopsis Thaliana RhizosphereWASDFPHEGIVDMSKAVKEFLSREDIPESAKRKISHDNPKRLYGL
Ga0209819_1012653423300027722Freshwater SedimentMTTSRDLELLGDDCLFWAADLPHEGIVDMAKAVREFLEREDIPDAAKRKISDDNAKDFYG
Ga0209683_1059830413300027840Wetland SedimentFWASDFPHEGIVSMGKVVQEFVERDDIPEASKRKISYDNPKRLYGL
Ga0209701_1045242833300027862Vadose Zone SoilMTTSRDLELLGDHCLFWASDFPHEGIVDMAKAVKEFMNREDIPEASKRKISYDNPKRLYG
Ga0209814_1001603413300027873Populus RhizosphereELLGDECLFWASDFPHEGIVDMSKAVNEFLSRGDIPEASKRKISYANPKRLYAL
Ga0209382_1076278413300027909Populus RhizosphereMTTSRDLELLGDECLFWASDFPHEGIVSMKKAVDEFLDRHDIPEASKRKIGRENPKMLYR
Ga0209889_100482653300027952Groundwater SandDFPHEGIVDMAKAVQEFLDRKDIPDAAKRKISYDNPKRLYAL
Ga0268265_1049980333300028380Switchgrass RhizosphereCGEEMTTGRDLELLGDECLFWASDFPHEGIVSMSKAVKEFLDREDIPEGAKRKISYENPKRLYRI
Ga0299907_1036827713300030006SoilDECLFWASDFPHEGIVDMARAVNEFLERNDIPPSSKLKIGYDNPKRLYAL
Ga0247647_116286313300030570SoilQCGEEMTTSRDLDLLGDDCLFWASDFPHEGIVDMAKAVTEFLERKDISKASKRKISYDNSKKLYGL
Ga0307497_1054578913300031226SoilFWASDFPHEGIVSMKKAVDEFVEREDIPEAAKRKISYDNPKRLYAL
Ga0170819_1462790913300031469Forest SoilEEMTTSRDLELLGDGCLFWASDFPHEGIVDMAKAVKEFLDRKDILEPAKRKISYDNAKKLYRL
Ga0310888_1097684313300031538SoilWASDFPHEGIVDMSKAVEEFLSRGDIPASSKRKISYDNAKKLYGL
Ga0307408_10016440423300031548RhizosphereGIVDMSKAVQEFLSRDDIPASSKKKIGYDNAKKLYGL
Ga0307469_1168129313300031720Hardwood Forest SoilLELLGDDCLFWASDFPHEGIVDMAKAVTEFLERKDISKASKRKISYDNSKKLYGL
Ga0307410_1021138113300031852RhizosphereTGRDLELLGDECLFWASDFPHEGIVSMKKAVDEFLEREDIPDVAKRKISYDNPKRLYSL
Ga0310892_1015676013300031858SoilDLELLGDQCLFWASDFPHEGIVDMSKAVEEFLSRGDIPASSKRKISYDNAKKLYGL
Ga0307479_1155210823300031962Hardwood Forest SoilSDFPHEGILDMAAAVKEFLTREDIPVASKHKIGNENPRRLYGLG
Ga0326597_1025842213300031965SoilSDFPHEGIVDMSKAVNEFLGREDISAASKRKISYDNPKKLYGL
Ga0306922_1068533113300032001SoilQCLFWASDFPHEGIVDMRKAVNEFLSREDIPEAAKRKISYDNPKRLYRL
Ga0310897_1066467223300032003SoilPHEGIVSMSKAVKEFLDREDIPEGSKRKISYDNPKRLYRL
Ga0307411_1012968713300032005RhizosphereELLGDECLFWASDFPHEGIVSMKKAVDEFLEREDIPDVAKRKISYDNPKKLYSL
Ga0307411_1074811823300032005RhizosphereLLGDQCLFWASDFPHEGIVDMSKAVQEFLSRDDIPALSKKKIGYDNAKKLYGL
Ga0310890_1021779013300032075SoilDFPHEGIVSMKKAVDEFLEREDIPDAAKRKISYDNPKRLYSL
Ga0315281_1177878523300032163SedimentVVSMKKAVQEFLDRDDIPAASKRKISYDNPKKLYGL
Ga0307470_1060989313300032174Hardwood Forest SoilMTTSRDLELLGDECLFWASDFPHEGIVNMSKAVNEFLSREDIPEAAKRKISYDNPKKLYR
Ga0326726_1065170533300033433Peat SoilGRDLELLGDECLFWASDFPHEGIVSMKKAVDEFLERDDIPEAAKRKISYDNPKRLYAL
Ga0316624_1226848723300033486SoilDECLFWASDFPHEGIVDMSKAVNEFLERDDIPPAAKRKISYDNPKRLYRL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.