NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F095948

Metagenome / Metatranscriptome Family F095948

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F095948
Family Type Metagenome / Metatranscriptome
Number of Sequences 105
Average Sequence Length 50 residues
Representative Sequence MTMRLPRPRHGDPLQTTQELRELAAAILQDDVQTLARTTAYLRRSY
Number of Associated Samples 88
Number of Associated Scaffolds 105

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 99.05 %
% of genes near scaffold ends (potentially truncated) 99.05 %
% of genes from short scaffolds (< 2000 bps) 93.33 %
Associated GOLD sequencing projects 80
AlphaFold2 3D model prediction Yes
3D model pTM-score0.55

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (82.857 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere
(12.381 % of family members)
Environment Ontology (ENVO) Unclassified
(37.143 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(52.381 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 44.59%    β-sheet: 0.00%    Coil/Unstructured: 55.41%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.55
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 105 Family Scaffolds
PF13302Acetyltransf_3 41.90
PF01914MarC 29.52
PF13673Acetyltransf_10 2.86
PF08281Sigma70_r4_2 2.86
PF13508Acetyltransf_7 1.90
PF09976TPR_21 0.95
PF09369MZB 0.95
PF13458Peripla_BP_6 0.95
PF07719TPR_2 0.95
PF05227CHASE3 0.95

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 105 Family Scaffolds
COG2095Small neutral amino acid transporter SnatA, MarC familyAmino acid transport and metabolism [E] 29.52

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms82.86 %
UnclassifiedrootN/A17.14 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001532|A20PFW1_1104852All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1457Open in IMG/M
3300001534|A15PFW1_10065192All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales2250Open in IMG/M
3300001534|A15PFW1_10587696All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium744Open in IMG/M
3300001538|A10PFW1_11172066All Organisms → cellular organisms → Bacteria1284Open in IMG/M
3300001538|A10PFW1_11414164All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1333Open in IMG/M
3300001686|C688J18823_10855739Not Available577Open in IMG/M
3300002568|C688J35102_119032763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria628Open in IMG/M
3300002568|C688J35102_119409840All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria689Open in IMG/M
3300004081|Ga0063454_101056622Not Available659Open in IMG/M
3300004153|Ga0063455_100386903All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria817Open in IMG/M
3300005336|Ga0070680_100217534Not Available1612Open in IMG/M
3300005339|Ga0070660_100439148Not Available1082Open in IMG/M
3300005344|Ga0070661_101636970All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium545Open in IMG/M
3300005437|Ga0070710_11325612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium536Open in IMG/M
3300005439|Ga0070711_101990659All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria511Open in IMG/M
3300005445|Ga0070708_101952122All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium544Open in IMG/M
3300005456|Ga0070678_100475770All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1098Open in IMG/M
3300005458|Ga0070681_10105857All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2755Open in IMG/M
3300005518|Ga0070699_102174692All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria506Open in IMG/M
3300005533|Ga0070734_10319725All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria887Open in IMG/M
3300005548|Ga0070665_101295978All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria738Open in IMG/M
3300006028|Ga0070717_10965514Not Available776Open in IMG/M
3300006173|Ga0070716_100513908Not Available886Open in IMG/M
3300006175|Ga0070712_100825930All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria796Open in IMG/M
3300006175|Ga0070712_100944509All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium745Open in IMG/M
3300006580|Ga0074049_11352828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria871Open in IMG/M
3300006642|Ga0075521_10618730All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300006755|Ga0079222_11477159All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria635Open in IMG/M
3300006796|Ga0066665_11229841All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium572Open in IMG/M
3300006903|Ga0075426_10224214All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1365Open in IMG/M
3300006953|Ga0074063_13430627Not Available996Open in IMG/M
3300009012|Ga0066710_101550473Not Available1019Open in IMG/M
3300009093|Ga0105240_11021664Not Available883Open in IMG/M
3300009098|Ga0105245_10497750All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1234Open in IMG/M
3300009098|Ga0105245_10969249Not Available894Open in IMG/M
3300009098|Ga0105245_11207230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium804Open in IMG/M
3300009176|Ga0105242_10967680All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria856Open in IMG/M
3300009651|Ga0105859_1291319All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria509Open in IMG/M
3300010376|Ga0126381_100132752All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3243Open in IMG/M
3300010398|Ga0126383_13504093All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria512Open in IMG/M
3300012003|Ga0120163_1036446All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1281Open in IMG/M
3300012189|Ga0137388_11795500All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria545Open in IMG/M
3300012362|Ga0137361_11154263All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium696Open in IMG/M
3300012924|Ga0137413_11605975All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria532Open in IMG/M
3300012951|Ga0164300_11077446All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria523Open in IMG/M
3300012960|Ga0164301_10954038All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria670Open in IMG/M
3300012984|Ga0164309_11803233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria525Open in IMG/M
3300012987|Ga0164307_11105773All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium651Open in IMG/M
3300012988|Ga0164306_11243633All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria626Open in IMG/M
3300012989|Ga0164305_11253369All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria645Open in IMG/M
3300013100|Ga0157373_10029057All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3986Open in IMG/M
3300013102|Ga0157371_10576153Not Available836Open in IMG/M
3300013105|Ga0157369_10525986All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1223Open in IMG/M
3300013105|Ga0157369_11774098All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium627Open in IMG/M
3300013307|Ga0157372_10190033All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2378Open in IMG/M
3300013307|Ga0157372_13007624All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria539Open in IMG/M
3300013307|Ga0157372_13473349All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria501Open in IMG/M
3300013772|Ga0120158_10163393All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1213Open in IMG/M
3300013832|Ga0120132_1075731All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium681Open in IMG/M
3300017993|Ga0187823_10169644All Organisms → cellular organisms → Bacteria → Terrabacteria group699Open in IMG/M
3300018468|Ga0066662_11985840All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium609Open in IMG/M
3300021363|Ga0193699_10005303All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales4661Open in IMG/M
3300021560|Ga0126371_10986508All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria984Open in IMG/M
3300021560|Ga0126371_12098343All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium681Open in IMG/M
3300025911|Ga0207654_10678069All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria739Open in IMG/M
3300025913|Ga0207695_11164893All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium651Open in IMG/M
3300025914|Ga0207671_11130323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium615Open in IMG/M
3300025917|Ga0207660_11562391All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300025919|Ga0207657_10230567All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1481Open in IMG/M
3300025919|Ga0207657_10373103Not Available1124Open in IMG/M
3300025919|Ga0207657_10494307Not Available959Open in IMG/M
3300025920|Ga0207649_11655480All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium507Open in IMG/M
3300025921|Ga0207652_10350609All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1332Open in IMG/M
3300025921|Ga0207652_10357177All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1319Open in IMG/M
3300025928|Ga0207700_11632360Not Available570Open in IMG/M
3300025932|Ga0207690_11280919All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria612Open in IMG/M
3300025939|Ga0207665_10400604Not Available1045Open in IMG/M
3300025939|Ga0207665_10685171All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium805Open in IMG/M
3300025939|Ga0207665_10744889All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria772Open in IMG/M
3300025939|Ga0207665_10859428All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria718Open in IMG/M
3300025944|Ga0207661_10883446All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium823Open in IMG/M
3300025949|Ga0207667_10574710Not Available1138Open in IMG/M
3300025981|Ga0207640_11025743All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium727Open in IMG/M
3300025981|Ga0207640_11691342All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria571Open in IMG/M
3300026023|Ga0207677_10097289All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2156Open in IMG/M
3300026041|Ga0207639_10445023Not Available1175Open in IMG/M
3300026067|Ga0207678_10279438All Organisms → cellular organisms → Bacteria1433Open in IMG/M
3300027826|Ga0209060_10204898All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria908Open in IMG/M
3300028563|Ga0265319_1225531All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium573Open in IMG/M
3300028799|Ga0307284_10381639All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria572Open in IMG/M
3300028800|Ga0265338_10971640All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria576Open in IMG/M
3300028819|Ga0307296_10350163Not Available807Open in IMG/M
3300029987|Ga0311334_10614089All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria884Open in IMG/M
3300031572|Ga0318515_10271312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria910Open in IMG/M
3300031640|Ga0318555_10457404All Organisms → cellular organisms → Bacteria692Open in IMG/M
3300031792|Ga0318529_10438532All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300031860|Ga0318495_10097031All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1325Open in IMG/M
3300031939|Ga0308174_11195575All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium648Open in IMG/M
3300032009|Ga0318563_10346756All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria803Open in IMG/M
3300032066|Ga0318514_10685847All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300032174|Ga0307470_11847578All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300032782|Ga0335082_11670461All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria510Open in IMG/M
3300032892|Ga0335081_12595213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium520Open in IMG/M
3300032954|Ga0335083_11406677All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium533Open in IMG/M
3300033805|Ga0314864_0032374All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1141Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere12.38%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.57%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost7.62%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere7.62%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere6.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.71%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere5.71%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil4.76%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.81%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.81%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.81%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.86%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.90%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.90%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.90%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.90%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.95%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.95%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.95%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.95%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.95%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.95%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.95%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.95%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.95%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001532Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-PF 12A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001534Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-PF-7A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001538Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006580Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006642Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-DEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009651Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-063EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012003Permafrost microbial communities from Nunavut, Canada - A20_80cm_0.25MEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013772Permafrost microbial communities from Nunavut, Canada - A10_80_0.25MEnvironmentalOpen in IMG/M
3300013832Permafrost microbial communities from Nunavut, Canada - A3_5cm_0MEnvironmentalOpen in IMG/M
3300017993Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027826Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028563Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaGHost-AssociatedOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300029987I_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033805Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
A20PFW1_110485213300001532PermafrostMTMGLPRPRHGDPLDTTQELRALAAAVLREDVETLARTTDYLRRSYRVVFIGYVAM
A15PFW1_1006519233300001534PermafrostMSTSLPRPRHGDPLETTQELRALAAAVLREDVETLARTTDYLRRSYRVVFIGYVAMMIFG
A15PFW1_1058769613300001534PermafrostMTMRLPRPRHGDPVETTQDLRDLAAAILRDDIHTLARTTAYLRRSYRVVFLGYVAMM
A10PFW1_1117206613300001538PermafrostMTMQLPRPRHGDPLQTTAELRALAAAVLNDDIHTLARTTAYLRRSYRVV
A10PFW1_1141416423300001538PermafrostMTMRLPRPRHGDPIETTQELRDLAAAILHDDIQTLARTTAYLRRS
C688J18823_1085573923300001686SoilMESMRLPRPRHGDEARTTQELRDLAASILHQDVEALA
C688J35102_11903276313300002568SoilMTMRLPRPRHGDPHDTTQELRALAAAVLSEDVRTLAQTTDYLR
C688J35102_11940984023300002568SoilMTMRLPRPRHGDPHDTTQELRALAAAVLSEDVQTLARTTKYLRRSYRVVFLGYVAMMVFG
Ga0063454_10105662223300004081SoilMTVGLPRPRHGDEEITTHELRALAAAVLHDDVQTLARTSKYLRRS
Ga0063455_10038690313300004153SoilMTEMRLPRPRHGDPLQTTQELRDLAAAILRDDVSTLAKTTAYLRRSYRVVFIGYVAMMVIGV
Ga0070680_10021753413300005336Corn RhizosphereMALKQLPRPRHGDSLQTTEDLRALAAAILLDDVQTLARTTAYLRRSYRVVFIGYVAMM
Ga0070660_10043914813300005339Corn RhizosphereMTMRLPRPRHGDPVETTAELRELAASILREDVDTLARTTAYL
Ga0070661_10163697023300005344Corn RhizosphereMALKQLPRPRHGDSLQTTEDLRALAAAILQDDVQTLARTTAYLRRSYRVVFIGYV
Ga0070710_1132561223300005437Corn, Switchgrass And Miscanthus RhizosphereMATVRLPRPRHGDPLQTTEDLRALAAAILQDDVQTLARTTAYLRRSYRVVFIGYVAMMVFGVAAIV
Ga0070711_10199065923300005439Corn, Switchgrass And Miscanthus RhizosphereMVMRLPRPRHGDPIRTTFELRELAAAVLEDDVRTLARTTAYLRRSYRAVFVGYLAMLVFG
Ga0070708_10195212213300005445Corn, Switchgrass And Miscanthus RhizosphereMAITRLPRPRHGDSLQTTEDLRALAAAILQDDVQTLARTTAY
Ga0070678_10047577023300005456Miscanthus RhizosphereMEVQLSRPRHGNPLETTQELRELASAILQDDIQTLARTTAYLRRSYRIVFVGY
Ga0070681_1010585713300005458Corn RhizosphereMTMRLPRPRHGDPLETTQELHALAAAVLREDVETLARTTGYLRRSYRVVFVGYVAMMIFGVGAIVAA
Ga0070699_10217469213300005518Corn, Switchgrass And Miscanthus RhizosphereMVMRLPRPRHGDPIRTTADLRDLAAAVLEDDVQTLARTTAYLRRSYRAV
Ga0070734_1031972513300005533Surface SoilMATMRLPRPRHGDPLQTTEDLRALAAAILQDDVQTLARTTAYLRRSYRVVFIGYVAMMVF
Ga0070665_10129597813300005548Switchgrass RhizosphereMAMRLTRPRHGDPVQTTAQLRDLAAAVLSEDVRTLARTTAYLRRSYRTVFVAYLA
Ga0070717_1096551423300006028Corn, Switchgrass And Miscanthus RhizosphereMKVQLPRPRHGDPVRTTEELRALAAAVLEDDVQTLARTTAYL
Ga0070716_10051390823300006173Corn, Switchgrass And Miscanthus RhizosphereMALKQLPRPRHGDSLQTTEDLRALAAAILQDDVQTLARTTAYLRRSYRVVFIGYVAMMVFGV
Ga0070712_10082593013300006175Corn, Switchgrass And Miscanthus RhizosphereMVMRLPRPRHGDPIRTTLELRELAASVLQDDVQTLARTTTYLRRSYRAVFLGYLA
Ga0070712_10094450923300006175Corn, Switchgrass And Miscanthus RhizosphereMTMRLPRPRHGDPQQTTAELRELAASILQDDVQTLARTTAYLRRSYRVVFIGYIAMMVFGVAAIA
Ga0074049_1135282813300006580SoilMVMRLPRPRHGDPIRTTFELRELAAAVLEDDVRTLARTTA
Ga0075521_1061873013300006642Arctic Peat SoilMTMRLPRPRHGDPFETTAELRELAASILREDVATLARTTAY
Ga0079222_1147715923300006755Agricultural SoilMATMRLPRPRHGDPLQTTEDLRALAAAILQDDVQTLARTTAYLR
Ga0066665_1122984123300006796SoilMVMRLPRPRHGDPIRTTTELRALAAAVLEDDVQTLARTTAYLRRSYRAVFMG
Ga0075426_1022421433300006903Populus RhizosphereMTMRLPRPRHGDPLQTTQQLRALAASVLSEDVQTLARTTSYLRRSYRVVF
Ga0074063_1343062723300006953SoilMTVRLPRPRHGDPHETTAELRELAASILHDDVQTLARTTAYLRRSYRVV
Ga0066710_10155047323300009012Grasslands SoilMLMRLPRPRHGDPIRTTADLRDLAAAVLEDDVRTLARTTAYLRRSYRAVFVAYLPMV
Ga0105240_1102166423300009093Corn RhizosphereMATMRLPRPRHGDPLQTTEDLRALAASILQDDVQTLARTTAYLRRSYRV
Ga0105245_1049775033300009098Miscanthus RhizosphereMAMRLTRPRHGDPVQTTAQLRELAAAVLSEDVRTLSRTTAYLRRSYR
Ga0105245_1096924923300009098Miscanthus RhizosphereMALKQLPRPRHGDSLQTTEDLRALAAAILQDDVQTLARTTAYLR
Ga0105245_1120723013300009098Miscanthus RhizosphereMEVQLSRPRHGNPLETTQELRELASAILQDDIQTLARTTSYLRRSYRVV
Ga0105242_1096768033300009176Miscanthus RhizosphereMTMRLPRPRHGDPQETTLELRALAAAVLSEDFQTQAPTT
Ga0105859_129131913300009651Permafrost SoilMTMRLPRPRHGDPKQTTVELRALAAAVLADDIQTLARTAAYLRRSYRAV
Ga0126381_10013275213300010376Tropical Forest SoilMVMRLPRPRHGDPVLTTTELRALASSVLEDDVQTLARTTAYLRRSYRAVFVGYLA
Ga0126383_1350409313300010398Tropical Forest SoilMVMRLPRPRHGDPTLTTTELQALAASVLEDDVRTLARTTAY
Ga0120163_103644633300012003PermafrostMSTSLPRPRHGDPLETTQELRALAAAVLREDVETLARTTDYLRRSYRVVFIGYVAMMIFGVG
Ga0137388_1179550023300012189Vadose Zone SoilMTMGLPRPRHGDPLETTQELRALAAAVLREDVETLARTTDYLRRSYRVVFIGYVAMMIFGVG
Ga0137361_1115426313300012362Vadose Zone SoilMTMRLPRPRHGDPLETTQELHALAAAVLREDIETLARTTDYLRRSYRVVFIGYVAMMIFGVGAIV
Ga0137413_1160597513300012924Vadose Zone SoilMTMRLPRPRHGDPIRTTLELRELAAAVLEDDVRTLARTTAYLRRSYRAVLLGYLAMLVF
Ga0164300_1107744613300012951SoilMTMRLPRPRHGDPLETTQELHALAAAVLREDVETLARTTDYLRRSYRVV
Ga0164301_1095403823300012960SoilMATMRLPRPRHGDPLQTTEDLRALAAAILQDDVQTLARTTAYLRRSYRVVFIGYVAMMVFGVAAIISYCS
Ga0164309_1180323323300012984SoilMVMRLPRPRHGDSLETTVQLHELASAVLTEDVRALARTTAYLRRSYRVVFVGYIAMLV
Ga0164307_1110577323300012987SoilMEVQLSRPRHGNPLETTQELRELASAILQDDIQTLARTTSYL
Ga0164306_1124363323300012988SoilMVMRLPRPRHGDPIRTTLELRELAASVLEDDVQTLARTTAY
Ga0164305_1125336923300012989SoilMVMRLPRPRHGDPIRTTLELRELAASVLEDDVQTLARTTAYLRRSYRAVFVGYLA
Ga0157373_1002905763300013100Corn RhizosphereMALKQLPRPRHGDSLQTTEDLRALAAAILQDDVQTL
Ga0157371_1057615313300013102Corn RhizosphereMATMRLPRPRHGDPLQTTEDLRALAAAILQDDVQTLARTTAYLRRSYRVV
Ga0157369_1052598613300013105Corn RhizosphereMSLPRPRHGDPLETTEELRALAASVLREDVETLARTTD
Ga0157369_1177409823300013105Corn RhizosphereMTTRLPRPRHGDPVETTTELRALAASILREDVDTLARTTAYLRRSYRVVFIGYVAMMV
Ga0157372_1019003313300013307Corn RhizosphereMEAAMATMRLPRPRHGDPLQTTEDLRALAAAILQDDVQTLART
Ga0157372_1300762413300013307Corn RhizosphereMEMRLPRPRHGDPLQTTQELRTLAATILQDDVQTLARTTAYLRRSYRVVFVGYVAMMVFGIAAI
Ga0157372_1347334923300013307Corn RhizosphereMSMSLPRPRHGDPLETTEELRALAASVLREDVETLARTTDYLRRSYRVVFY
Ga0120158_1016339343300013772PermafrostMTMRLPRPRHGDPIETTQELRDLAAAILHDDIQTLARTTAYLRRSYQVVFLGYVAMMVFGVA
Ga0120132_107573133300013832PermafrostMTTRLPRPRHGDPARTTQELRDLAAAILQEDVQTLTRTTAYLRRSYRVVFLGYV
Ga0187823_1016964423300017993Freshwater SedimentMTMRLPRPRHGDPLQTTQELRELAAAILQDDVQTLARTTAYLRRSYRVVFVGYVAMMVF
Ga0066662_1198584023300018468Grasslands SoilMTMRLPRPRHGDPEETAAELRELAASILHDDVQTL
Ga0193699_1000530363300021363SoilMTMRLPRPRHGDPLETTQELRALAAAVLREDIETLARTTDY
Ga0126371_1098650813300021560Tropical Forest SoilMTMRLPRPRHGDPLHTTLELRELAAAILEDDVQTLARTT
Ga0126371_1209834313300021560Tropical Forest SoilMTMRLPRPRHGDPLQTTDELRELAAAILQDDVQTLARTTAYLRR
Ga0207654_1067806913300025911Corn RhizosphereMTMRLPRPRHGDPLETTQELHALAAAVLREDVETLARTTGYLRRSYRVVLVGY
Ga0207695_1116489313300025913Corn RhizosphereMATMRLPRPRHGDPLQTTEDLRALAASILQDDVQTLARTTAYLRRS
Ga0207671_1113032313300025914Corn RhizosphereMATMRLPRPRHGDPLQTTEDLRALAAAILQDDVQTLARTTAYLRRSYR
Ga0207660_1156239113300025917Corn RhizosphereMATMRLPRPRHGDPLQTTEDLRALAAAILQDDVQTLARTTAYLRRSYRVVFIG
Ga0207657_1023056713300025919Corn RhizosphereMEMRLPRPRHGDPVRTTAELRELAAAVLSEDVRTLARTTAYLRRSYRTV
Ga0207657_1037310313300025919Corn RhizosphereMTMRLPRPRHGDPVETTAELRELAASILREDVDTLARTT
Ga0207657_1049430713300025919Corn RhizosphereMATMRLPRPRHGDPLQTTEDLRALAAAILQDDVQTLART
Ga0207649_1165548013300025920Corn RhizosphereMATMRLPRPRHGDPLQTTEDLRALAAAILQDDVQTLARTTAYLRRSYRVVFIGY
Ga0207652_1035060923300025921Corn RhizosphereMATMRLPRPRHGDPLHTTEDLRALAAAILQDDVQTLARTTAYLRRSYRV
Ga0207652_1035717733300025921Corn RhizosphereMTMRLPRPRHGDPLETTQELHALAAAVLREDVETLA
Ga0207700_1163236023300025928Corn, Switchgrass And Miscanthus RhizosphereMTVGLPRPRHGDEEITTHELRALAAAVLHDDVQTLA
Ga0207690_1128091923300025932Corn RhizosphereMAMRLTRPRHGDPVQTTAQLRELAAAVLSEDVRTLARTTAYLRRSYRTVFVAYLAMLVFG
Ga0207665_1040060413300025939Corn, Switchgrass And Miscanthus RhizosphereMAMRLTRPRHGDPVQTTAELRDLAAAVLSEDVRTLARTTAYLRRSYRTVFVA
Ga0207665_1068517123300025939Corn, Switchgrass And Miscanthus RhizosphereMTMRLPRPRHGDPLQTTQELRELAASVLSEDVRTLARTTSYLRRSYRVVF
Ga0207665_1074488913300025939Corn, Switchgrass And Miscanthus RhizosphereMVMRLPRPRHGDPIRTTLELRELAASVLQDDVQTLARTTAYLRR
Ga0207665_1085942813300025939Corn, Switchgrass And Miscanthus RhizosphereMTMRLPRPRHGDSLETTQELRALAADVLREDVETLARTTDYLRR
Ga0207661_1088344633300025944Corn RhizosphereMEMRLPRPRHGDTIQTTAELRELAAAVLSEDVRTLARTTAYLRR
Ga0207667_1057471013300025949Corn RhizosphereMALKQLPRPRHGDSLQTTEDLRALAAAILQDDVQTLARTTAYLRRSYRVVFIGYVAMMVF
Ga0207640_1102574323300025981Corn RhizosphereMATMRLPRPRHGDPLQTTEDLRALAASILQNDVQTLVRTTAYLQRSYRMVFIGYVAMMVFGVAA
Ga0207640_1169134213300025981Corn RhizosphereMATMRLPRPRHGDPLQTTEDLRALAAAILQDDVQTLARTTAYLRRSYRVVFIGYVAMMIFGVAAIVA
Ga0207677_1009728933300026023Miscanthus RhizosphereMAMRLTRPRHGDPVQTTAQLRDLAAAVLSEDVRTLARTTA
Ga0207639_1044502323300026041Corn RhizosphereMALKQLPRPRHGDSLQTTEDLRALAAAILQDDVQTLAR
Ga0207678_1027943813300026067Corn RhizosphereMTMSLPRPRHGDPTNDAEELRRLAAAVLQDDVATLARTNAYLRRSYRV
Ga0209060_1020489813300027826Surface SoilMATMRLPRPRHGDPLQTTEDLRALAAAILQDDVQTLARTTAYLRRSYRVVFIGYVAMMVFGVAA
Ga0265319_122553123300028563RhizosphereMSTTRLPRPRHGDPNQATLELRELAAAVLADDIQTLSRTTAYLRRSYRTVFLAYV
Ga0307284_1038163913300028799SoilMTMRLPRPRHGDPLETTQELHALAAAVLREDVETLAR
Ga0265338_1097164013300028800RhizosphereMTMRLPRPRHGDPDQATSELRELAAAVLADDIQTLSRTTAYLRRSYR
Ga0307296_1035016323300028819SoilMAMRLTRPRHGDPVQTTAQLRELAAAVLSEDVRTLART
Ga0311334_1061408913300029987FenMTMRLPRPRHGDPIQTTAELRELAASILHDDVRTLARTT
Ga0318515_1027131213300031572SoilMTMRLPRPRHGDPLHTTQELRELAAAILEDDVQTLARTTAYLRRSYR
Ga0318555_1045740413300031640SoilMTMRLPRPRHGDPLQTTQELRELAAAILQDDVQTLARTTAYLRRSYRVVFVGY
Ga0318529_1043853213300031792SoilMTMRLPRPRHGDPLQTTQELRELAAAILQDDVQTLARTTAYLRRSY
Ga0318495_1009703113300031860SoilMTMRLPRPRHGDPLQTTQELRELAAAILQDDVQTLARTTAYLRRSYRVVFVGYV
Ga0308174_1119557513300031939SoilMTMRLPRPRHGDPVETTAELRELAASILREDVDTLARTTAYLR
Ga0318563_1034675613300032009SoilMTMRLPRPRHGDPLQTTQELRELAAAILQDDVQTLARTTAYLRRSYRVVFVGYVAMMVFGVAAIVA
Ga0318514_1068584713300032066SoilMTMRLPRPRHGDPLHTTQELRELAAAILEDDVQTLARTTAYLRRSYRVVFVGYVAMMLFGVAAVV
Ga0307470_1184757823300032174Hardwood Forest SoilMSMRLPRPRHGDPLQTTEELRELAAAILQDDVQTLARTTAYLRRSYRVVFVG
Ga0335082_1167046123300032782SoilMTMRLPRPRHGDPLQTTQELRELAAAILQDDVQTLART
Ga0335081_1259521323300032892SoilMTMRLPRPRHGETGETTSELRELAASILREDVETLARTSAYLRRSYRVVFLGYVAMMVFGIA
Ga0335083_1140667723300032954SoilMSSMRLPRPRHGESGDTTSELRELAASILREDVDTLARTTKYLRRSYR
Ga0314864_0032374_3_1703300033805PeatlandMTMRLPRPRHGDPLQTTQELRELAAAILQDDVQTLARTTAYLRRSYRVVFVGYVAM

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.