NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F096095

Metagenome / Metatranscriptome Family F096095

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F096095
Family Type Metagenome / Metatranscriptome
Number of Sequences 105
Average Sequence Length 58 residues
Representative Sequence MIVQSLVTAFAFAFLATAALGHVLLLQAAFAPSNNPKSGKAAERPSGRAPITGAGIAP
Number of Associated Samples 104
Number of Associated Scaffolds 105

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 73.33 %
% of genes near scaffold ends (potentially truncated) 38.10 %
% of genes from short scaffolds (< 2000 bps) 83.81 %
Associated GOLD sequencing projects 101
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (79.048 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(30.476 % of family members)
Environment Ontology (ENVO) Unclassified
(36.190 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(41.905 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 44.83%    β-sheet: 0.00%    Coil/Unstructured: 55.17%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 105 Family Scaffolds
PF03401TctC 41.90
PF01343Peptidase_S49 13.33
PF01972SDH_sah 12.38
PF02091tRNA-synt_2e 2.86
PF05175MTS 1.90
PF09413DUF2007 1.90
PF00535Glycos_transf_2 0.95
PF05164ZapA 0.95
PF00348polyprenyl_synt 0.95
PF02129Peptidase_S15 0.95

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 105 Family Scaffolds
COG0616Periplasmic serine protease, ClpP classPosttranslational modification, protein turnover, chaperones [O] 51.43
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 41.90
COG0752Glycyl-tRNA synthetase, alpha subunitTranslation, ribosomal structure and biogenesis [J] 2.86
COG0142Geranylgeranyl pyrophosphate synthaseCoenzyme transport and metabolism [H] 0.95
COG3027Cell division protein ZapA, inhibits GTPase activity of FtsZCell cycle control, cell division, chromosome partitioning [D] 0.95


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms79.05 %
UnclassifiedrootN/A20.95 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001661|JGI12053J15887_10007939Not Available5721Open in IMG/M
3300002074|JGI24748J21848_1038381All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium605Open in IMG/M
3300002568|C688J35102_118811634All Organisms → cellular organisms → Bacteria → Proteobacteria600Open in IMG/M
3300004114|Ga0062593_100636547All Organisms → cellular organisms → Bacteria → Proteobacteria1026Open in IMG/M
3300004157|Ga0062590_102233847All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria574Open in IMG/M
3300004643|Ga0062591_100844225All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria851Open in IMG/M
3300004643|Ga0062591_101112622All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria762Open in IMG/M
3300005147|Ga0066821_1000175All Organisms → cellular organisms → Bacteria → Proteobacteria1950Open in IMG/M
3300005159|Ga0066808_1018982All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria666Open in IMG/M
3300005162|Ga0066814_10004645All Organisms → cellular organisms → Bacteria → Proteobacteria1431Open in IMG/M
3300005163|Ga0066823_10002961All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2080Open in IMG/M
3300005165|Ga0066869_10001540All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2561Open in IMG/M
3300005330|Ga0070690_100874224All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria701Open in IMG/M
3300005334|Ga0068869_101655536All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria570Open in IMG/M
3300005338|Ga0068868_101592233All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria613Open in IMG/M
3300005347|Ga0070668_100663110All Organisms → cellular organisms → Bacteria → Proteobacteria917Open in IMG/M
3300005354|Ga0070675_100732486All Organisms → cellular organisms → Bacteria → Proteobacteria902Open in IMG/M
3300005355|Ga0070671_100521725All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1023Open in IMG/M
3300005356|Ga0070674_101398100All Organisms → cellular organisms → Bacteria → Proteobacteria626Open in IMG/M
3300005365|Ga0070688_100373721All Organisms → cellular organisms → Bacteria → Proteobacteria1049Open in IMG/M
3300005367|Ga0070667_100242244Not Available1610Open in IMG/M
3300005438|Ga0070701_10333958All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria942Open in IMG/M
3300005440|Ga0070705_100173165All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1455Open in IMG/M
3300005457|Ga0070662_101326138All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria619Open in IMG/M
3300005468|Ga0070707_101975185All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria551Open in IMG/M
3300005535|Ga0070684_100198711All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1826Open in IMG/M
3300005539|Ga0068853_100073844All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2974Open in IMG/M
3300005545|Ga0070695_100603837All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria862Open in IMG/M
3300005547|Ga0070693_100127582All Organisms → cellular organisms → Bacteria → Proteobacteria1586Open in IMG/M
3300006038|Ga0075365_10359542All Organisms → cellular organisms → Bacteria → Proteobacteria1026Open in IMG/M
3300006042|Ga0075368_10015375All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2839Open in IMG/M
3300006163|Ga0070715_10769539All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria581Open in IMG/M
3300006178|Ga0075367_10063850All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2202Open in IMG/M
3300006353|Ga0075370_10575452All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.682Open in IMG/M
3300006605|Ga0074057_12332151All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2174Open in IMG/M
3300012987|Ga0164307_10080369All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1979Open in IMG/M
3300012988|Ga0164306_10578124All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria877Open in IMG/M
3300013297|Ga0157378_12650361All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria554Open in IMG/M
3300014325|Ga0163163_12611890All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria562Open in IMG/M
3300017965|Ga0190266_10016779All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2044Open in IMG/M
3300018027|Ga0184605_10069601All Organisms → cellular organisms → Bacteria → Proteobacteria1522Open in IMG/M
3300018051|Ga0184620_10006222All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2534Open in IMG/M
3300018055|Ga0184616_10017110All Organisms → cellular organisms → Bacteria → Proteobacteria2166Open in IMG/M
3300018066|Ga0184617_1044849All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1104Open in IMG/M
3300018067|Ga0184611_1001649All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68604859Open in IMG/M
3300018073|Ga0184624_10005351All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4143Open in IMG/M
3300018074|Ga0184640_10140163All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1073Open in IMG/M
3300018429|Ga0190272_12112914All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria601Open in IMG/M
3300018465|Ga0190269_10065169All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1708Open in IMG/M
3300019356|Ga0173481_10114291All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1060Open in IMG/M
3300019361|Ga0173482_10229269All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria778Open in IMG/M
3300019876|Ga0193703_1062672All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria558Open in IMG/M
3300020001|Ga0193731_1082031All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria840Open in IMG/M
3300021078|Ga0210381_10250196All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria630Open in IMG/M
3300021082|Ga0210380_10184277All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria941Open in IMG/M
3300022756|Ga0222622_10132490All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1584Open in IMG/M
3300025901|Ga0207688_10247999All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1078Open in IMG/M
3300025903|Ga0207680_10277614All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1163Open in IMG/M
3300025914|Ga0207671_10183306All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1630Open in IMG/M
3300025916|Ga0207663_10605425All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria861Open in IMG/M
3300025918|Ga0207662_10000424All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales18665Open in IMG/M
3300025921|Ga0207652_10415240All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae1214Open in IMG/M
3300025932|Ga0207690_10743920Not Available808Open in IMG/M
3300025934|Ga0207686_10355740All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1104Open in IMG/M
3300025981|Ga0207640_10463235Not Available1047Open in IMG/M
3300025986|Ga0207658_11272083All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria673Open in IMG/M
3300026116|Ga0207674_10090798All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68603046Open in IMG/M
3300026142|Ga0207698_11040405Not Available830Open in IMG/M
3300026995|Ga0208761_1021088All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria621Open in IMG/M
3300027480|Ga0208993_1026791All Organisms → cellular organisms → Bacteria → Proteobacteria1019Open in IMG/M
3300027546|Ga0208984_1001700All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68603644Open in IMG/M
3300027866|Ga0209813_10043220All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1380Open in IMG/M
3300027903|Ga0209488_10856223All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium640Open in IMG/M
3300028379|Ga0268266_11826490All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria582Open in IMG/M
3300028380|Ga0268265_10896363All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria871Open in IMG/M
3300028592|Ga0247822_10850179All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria746Open in IMG/M
3300028708|Ga0307295_10063408Not Available966Open in IMG/M
3300028710|Ga0307322_10010487All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2044Open in IMG/M
3300028713|Ga0307303_10006464All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1973Open in IMG/M
3300028714|Ga0307309_10064531All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria821Open in IMG/M
3300028755|Ga0307316_10274828Not Available614Open in IMG/M
3300028768|Ga0307280_10009266All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68602642Open in IMG/M
3300028782|Ga0307306_10092388All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria799Open in IMG/M
3300028784|Ga0307282_10050675Not Available1854Open in IMG/M
3300028787|Ga0307323_10100148Not Available1039Open in IMG/M
3300028811|Ga0307292_10080495Not Available1260Open in IMG/M
3300028828|Ga0307312_10352623All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria963Open in IMG/M
3300028872|Ga0307314_10027150All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1339Open in IMG/M
3300028880|Ga0307300_10062248All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1074Open in IMG/M
3300028885|Ga0307304_10227458Not Available806Open in IMG/M
3300028889|Ga0247827_11037786Not Available559Open in IMG/M
3300030904|Ga0308198_1043151All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium681Open in IMG/M
3300030993|Ga0308190_1067272Not Available726Open in IMG/M
3300031058|Ga0308189_10200180Not Available723Open in IMG/M
3300031094|Ga0308199_1054455Not Available791Open in IMG/M
3300031099|Ga0308181_1043483Not Available828Open in IMG/M
3300031152|Ga0307501_10104919Not Available719Open in IMG/M
3300031184|Ga0307499_10268215Not Available551Open in IMG/M
3300031421|Ga0308194_10161068Not Available699Open in IMG/M
3300031547|Ga0310887_10562030All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria695Open in IMG/M
3300031854|Ga0310904_10442972All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria860Open in IMG/M
3300031943|Ga0310885_10408052Not Available725Open in IMG/M
3300032205|Ga0307472_100222381All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1456Open in IMG/M
3300034147|Ga0364925_0292368Not Available609Open in IMG/M
3300034644|Ga0370548_028721Not Available896Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil30.48%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment6.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.67%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere5.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.76%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere4.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.81%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.81%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.86%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere2.86%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.90%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.90%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.90%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.90%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.90%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.90%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.95%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.95%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.95%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.95%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.95%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.95%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.95%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001661Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)EnvironmentalOpen in IMG/M
3300002074Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1Host-AssociatedOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005147Soil and rhizosphere microbial communities from Laval, Canada - mgLMCEnvironmentalOpen in IMG/M
3300005159Soil and rhizosphere microbial communities from Laval, Canada - mgLPBEnvironmentalOpen in IMG/M
3300005162Soil and rhizosphere microbial communities from Laval, Canada - mgLABEnvironmentalOpen in IMG/M
3300005163Soil and rhizosphere microbial communities from Laval, Canada - mgHMBEnvironmentalOpen in IMG/M
3300005165Soil and rhizosphere microbial communities from Laval, Canada - mgHMCEnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300006038Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5Host-AssociatedOpen in IMG/M
3300006042Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3Host-AssociatedOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006178Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2Host-AssociatedOpen in IMG/M
3300006353Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5Host-AssociatedOpen in IMG/M
3300006605Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018055Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coexEnvironmentalOpen in IMG/M
3300018066Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1EnvironmentalOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019876Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a2EnvironmentalOpen in IMG/M
3300020001Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2EnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026995Soil and rhizosphere microbial communities from Laval, Canada - mgLAB (SPAdes)EnvironmentalOpen in IMG/M
3300027480Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027546Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027866Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028708Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152EnvironmentalOpen in IMG/M
3300028710Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380EnvironmentalOpen in IMG/M
3300028713Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184EnvironmentalOpen in IMG/M
3300028714Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028782Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028872Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204EnvironmentalOpen in IMG/M
3300028880Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300030904Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_202 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030993Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031058Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031094Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031099Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031152Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_SEnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300034147Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17EnvironmentalOpen in IMG/M
3300034644Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12053J15887_1000793943300001661Forest SoilMIIQSLVTAFTIAFLATVVFGHVLLLRAAFAPTNNPKSGKAAERPSGRAPIAGAGIAA*
JGI24748J21848_103838133300002074Corn, Switchgrass And Miscanthus RhizosphereQSLVTAFAFAFLATAALGHVLLLQAAFAPSNNPKSGKAAERPSGRAPITGAGIAS*
C688J35102_11881163423300002568SoilMIVQSLVTAFAFAFLATAVLGHVLLLQAAFAPSNNPKSGKAAKRPSGRAPITGAGIAP*
Ga0062593_10063654733300004114SoilMIVQSLVTAFAFAFLATAALGHLLLLQAAFAPSNNPKSGKAAQRPSGRAPITGAGIAP*
Ga0062590_10223384733300004157SoilMIVQSLVTAFTIAFLATAMLGHVLLLRAVFVPANNPKSGRAAKRASGRTPIAGPGIAA*
Ga0062591_10084422513300004643SoilMIVQSLVTAFAFAFLAPAALGHVLLLQAAFAPSNNPKSGKAAQRPSGRTPISGAGIAP*
Ga0062591_10111262233300004643SoilMIVQSLVTAFAFAFLATAALGHLLLLQGTFAPSNNPKSGKAAQRPSGRAPITGAGIAP*
Ga0066821_100017523300005147SoilMIVQSLVTAFAFAFLATAALGHVLLLQAAFAPSNNPKSGKAAQRPSGRAPITGAGIAS*
Ga0066808_101898213300005159SoilMIVQSLVTAFAFAFLATAALGHVLLLQAAFAPSNNPKSGKAAERPSGRAPITGAGI
Ga0066814_1000464523300005162SoilMIVQSLVTAFAFAFLATAALGHVLLLQAAFAPSNNPKWGKAAQRPSGRAPITGAGIAP*
Ga0066823_1000296113300005163SoilMIVQSLVTAFAFAFVATAALGHVLLLQAAFAPSNNPKSGKAAQRPSGRAPITGAGIAP*
Ga0066869_1000154053300005165SoilMIVQSLVTAFAFAFLATAALGHVLLLQAAFAPSNNPKSGKAAQRPSGRAPITGAGIAP*
Ga0070690_10087422413300005330Switchgrass RhizosphereMIVQSLVTAFAFAFLATAALGHVLLLQAAFAPSNNPKSGKAAERPSGRAPIAGAGIAS*
Ga0068869_10165553623300005334Miscanthus RhizosphereMIVQSLVTAFAFAFLATAALGHVLLLQAAFAPGNNPKSGKAAERPSGRAPITGAGIAP*
Ga0068868_10159223333300005338Miscanthus RhizosphereEGVMIVQSLVTAFAFAFLATAALGHVLLLQVAFAPSNNPKSGKAAERPSGRAPITGAGIAP*
Ga0070668_10066311023300005347Switchgrass RhizosphereMIVQSLVTAFAFAFLATAALGHVLLLQVAFAPSNNPKSGKAAERPSGRAPITGAGIAS*
Ga0070675_10073248623300005354Miscanthus RhizosphereMIVQSLVTAFAFAFLATAALGHVLLLQVAFAPSNNPKSGKAAERPSGRAPITGAGIAP*
Ga0070671_10052172533300005355Switchgrass RhizosphereTIAFLATAMLGHVLLLRAVFVPANNPKSGRAAKRASGRTPIAGPGIAA*
Ga0070674_10139810023300005356Miscanthus RhizosphereMIVQSLVTAFAFAFLATAALGHVLLLQAAFAPSNNPKSGKAAERPSGRAPITGAGIAS*
Ga0070688_10037372133300005365Switchgrass RhizosphereMIVQSLVTAFTIAFLATAMFGHVLLLRAVLVPANNPKSGRAAKRASGRTPIAGPGIAA*
Ga0070667_10024224413300005367Switchgrass RhizosphereSLVTAFAFAFLATAALGHVLLLQAAFAPSNNPKSGKAAERPSGRAPITGAGIAP*
Ga0070701_1033395813300005438Corn, Switchgrass And Miscanthus RhizosphereMIVQSLVTAFTIAFLATAMLGHVLLLRAVLVPANNPKSGRAAKRASGRTPIAGPGIAA*
Ga0070705_10017316533300005440Corn, Switchgrass And Miscanthus RhizosphereMIVQSLVTAFAFAFLAPAALGHVLLLQAAFAPSNNPKSGKAAQRPSGRAPITGAGIAP*
Ga0070662_10132613813300005457Corn RhizosphereMIVQSLVTAFAFAFLATAALGHVLLLQAAFAPSNNPKSGKAAERPSGRAPITGAGIAP*
Ga0070707_10197518513300005468Corn, Switchgrass And Miscanthus RhizosphereMIVQSLVTAFAFAFLATAALGHVLLLQAAFAPSNNPKSGKAAERPSDRAPITGAGIAP
Ga0070684_10019871113300005535Corn RhizosphereVQSLVTAFTIAFLATAMLGHVLLLRAVFVPANNPKSGRAAKRASGRTPIAGPGIAA*
Ga0068853_10007384463300005539Corn RhizosphereMIVQSLVTAFAFAFLATAALGHLLLLQATFAPSNNPKSGKAAQRPSGRAPITGAGIAP*
Ga0070695_10060383713300005545Corn, Switchgrass And Miscanthus RhizosphereSGPQLEGVMIVQSLVTAFAFAFLATAALGHVLLLQAAFAPSNNPKWGKAAQRPSGRAPITGAGIAP*
Ga0070693_10012758213300005547Corn, Switchgrass And Miscanthus RhizosphereMIVQSLVTAFAFAFVATAALGHVLLLQAAFAPSNNPKSGKAAQRPSGRAPITGA
Ga0075365_1035954223300006038Populus EndosphereMIVQSLVTAFAFAFLATAALGHVLLLQAAFAPSNNPKSGKAAQRPSGRAPIAGAGIAT*
Ga0075368_1001537513300006042Populus EndosphereVMIVQSLVTAFAFAFLATAALGHVLLLQAAFAPSNNPKSGKAAQRPSGRAPIAGAGIAP*
Ga0070715_1076953913300006163Corn, Switchgrass And Miscanthus RhizosphereFAFLATAALGHVLLLQAAFAPSNNPKSGKAAQRPSGRAPITGAGIAP*
Ga0075367_1006385033300006178Populus EndosphereMIVQSLVTAFAFAFLAPAALGHVLLLQAAFAPSNDPKSGKAAQRPSGRTPISGAGIAP*
Ga0075370_1057545233300006353Populus EndospherePQVEGVMIVQSLVTAFAFAFLAPAALGHVLLLQAAFAPSNNPKSGKAAQRPSGRTPISGAGIAP*
Ga0074057_1233215143300006605SoilMIVQSLVTAFAFAFLATAALGHVLLLQVAFAPSNNPKSGKAAERPSGRAPIAGAGIAS*
Ga0164307_1008036933300012987SoilMIVQSLVTAFAFAFLATAALGHMLLLQAAFAPSNNPKSGKAAERPSGRAPITGAGIAP*
Ga0164306_1057812423300012988SoilMIVQSLVTAFAFAFLATAALGHVLLLQAAFAPSNNPKSGKAAKRPSGRAPITGAGIAP*
Ga0157378_1265036123300013297Miscanthus RhizosphereMIVQSLVTAFAFAFLATAALGHVLLLQAAFAPSNNPKSGNAAERPSGRAPITGAGIAT*
Ga0163163_1261189013300014325Switchgrass RhizosphereMIVQSLVTAFAFAFVATAALGHVLLLQAAFAPSNNPKSGKAAQRPSGRAPITG
Ga0190266_1001677923300017965SoilMIVQSLVTAFAFAFLATAALGHVLLLQAAFAPSNNPKSGKAAQRPSGRAPITGAGIAP
Ga0184605_1006960133300018027Groundwater SedimentMIVQSLVMAFTIAFIATAVLGHVLLLRAALVPAKNPKSGRAAERPSGRTPIAGAGIAA
Ga0184620_1000622233300018051Groundwater SedimentMIVQSLVMAFTIAFVATAVLGHVLPLRAAFVPAKNPKSGRAAERPSGRTPIAGAGIAA
Ga0184616_1001711023300018055Groundwater SedimentMIVQSLVTAFAFAFLATAVLGHVLLLQAAFAPSNNPKWGKAAQRPSGRAPITGAGIAP
Ga0184617_104484913300018066Groundwater SedimentMIVQALVTAFAFAFLATAALGHVLLLQAAFAPRDNPKSGKAAQRPSGRAPITGAGIAP
Ga0184611_100164923300018067Groundwater SedimentMIVQSLVTAFAFAFLATAALGHVLLLQAAFAPSNNPKWGKAAQRPSGRAPITGAGIAP
Ga0184624_1000535133300018073Groundwater SedimentMIVQSLVTAFAFACLATAALGHVLLLQAAFAPRNNPKSGKAAQRPSGRAPITGAGIAP
Ga0184640_1014016323300018074Groundwater SedimentMIVQSLVTAFAFAFLATAALGHMLLLQAAFAPSNNPKSGKATERPSGRAPITGV
Ga0190272_1211291413300018429SoilMIVQSLVTAFAFACLATAALGHVLLLQAAFAPSNNPKSGKAAERRSGRAPITGVGIAPQGRQRLARDR
Ga0190269_1006516933300018465SoilMIVQSLVTAFAFAFLATAALGHVLLLQAAFAPSNNPKSGKAAERPLGRAPITSVGIAP
Ga0173481_1011429133300019356SoilMIVQSLVTAFTIAFLATAMLGHVLLLRAVFVPANNPKSGRAAKRASGRTPIAGPGIAA
Ga0173482_1022926913300019361SoilMIVQSLVTAFAFAFLATAALGHLLLLQGTFAPSNNPKSGKAAQRPSGRAPITGAGI
Ga0193703_106267223300019876SoilMIVQSLVTAFAFAFLATAVLGHVLLLQAAFAPSNNPKSGKAAKRPSGRAPITGAGIAP
Ga0193731_108203123300020001SoilMIVQSLVMAFTIAFVATAVLGHVLLLRAAFVPAKNPKSGRAAERPSGRTPIAGAGIAA
Ga0210381_1025019623300021078Groundwater SedimentMIVQSLVTAFAFAFAFLATAVLGHVLLLQAAFAPSNNPKSGKAAKRPSGRAPITGAGIAP
Ga0210380_1018427723300021082Groundwater SedimentMIVQSLVTAFAFAFLATAALGHVLLLQAAFAPSNNPKWGKAAQRPSGRAPITGAGIAT
Ga0222622_1013249023300022756Groundwater SedimentMIVQSLVTAFAFAFLATAALGHMLLLQAAFAPSNNPKSGKAAKRPSGRAPITGAGIAP
Ga0207688_1024799913300025901Corn, Switchgrass And Miscanthus RhizosphereMIVQSLVTAFTIAFLATAMLGLVLLLRAVFVPANNPKSGRAAKRASGRTPIAGPGIAA
Ga0207680_1027761423300025903Switchgrass RhizosphereMIVQSLVTAFAFAFLATAALGHMLLLQAAFAPSNNPKSGKAAERPSGRAPITGAGIAP
Ga0207671_1018330633300025914Corn RhizosphereMIVQSLVTAFAFAFLATAALGHVLLLQAAFAPSNNPKSGKAAERPSGRAPITGAGIAT
Ga0207663_1060542523300025916Corn, Switchgrass And Miscanthus RhizosphereMIVQSLVTAFAFAFVATAALGHVLLLQAAFAPSNNPKSGKAAQRPSGRAPITGAGIAP
Ga0207662_1000042433300025918Switchgrass RhizosphereMIVQSLVTAFAFAFLATAALGHVLLLQVAFAPSNNPKSGKAAERPSGRAPITGAGIAS
Ga0207652_1041524033300025921Corn RhizosphereMIVQSLVTAFAFAFLATAALGHVLLLQAAFAPSNNPKSGKAAQRPSGRAPIAGAGIAT
Ga0207690_1074392033300025932Corn RhizosphereEGAMIVQSLVTAFTIAFLATAMFGHVLLLRAIFVPANNRKSGRAAERASGRTPIAGPGIA
Ga0207686_1035574023300025934Miscanthus RhizosphereMIVQSLVTAFAFAFLATAALGHVLLLQAAFAPSNNPKSGKAAERPSGRAPITGAGIAS
Ga0207640_1046323513300025981Corn RhizosphereDERSGPQLEGVMIVQSLVTAFAFAFLATAALGHVLLLQAAFAPSNNPKWGKAAQRPSGRAPITGAGIAP
Ga0207658_1127208323300025986Switchgrass RhizosphereMIVQSLVTAFAFAFLATAALGHMLLLQAAFAPSNNPKSGKAAERPSGRAPITGAGIAS
Ga0207674_1009079863300026116Corn RhizosphereMIVQSLVTAFAFAFLATAALGHVLLLQAAFAPRNNPKPGKAAERPSGRAPITGAGIAS
Ga0207698_1104040513300026142Corn RhizosphereFAFAFLATAALGHVLLLQAAFAPSNNPKSGKAAQRPSGRAPITGAGIAP
Ga0208761_102108823300026995SoilMIVQSLVTAFAFAFLATAALGHVLLLQAAFAPSNNPKSGKAAEGPSGRAPITGAGIAP
Ga0208993_102679133300027480Forest SoilMIVQSLVTAFTIAFLATAVFGHVLLLRAAFAPTNNAKSGKAAERPSGRAPIAGAGIAA
Ga0208984_100170053300027546Forest SoilMIIQSLVTAFTIAFLATVVFGHVLLLRAAFAPTNNPKSGKAAERPSGRAPIAGAGIAA
Ga0209813_1004322023300027866Populus EndosphereMIVQSLVTAFAFAFLAPAALGHVLLLQAAFAPSNNPKSGKAAQRPSGRTPISGAGIAP
Ga0209488_1085622333300027903Vadose Zone SoilMIVQSLVMAFTIAFIATAVLGHVLLLRAALVPAKNPKSGRAAERPSGRTPIASAGIAA
Ga0268266_1182649023300028379Switchgrass RhizosphereMIVQSLVTAFAFAFLATAALGHLLLLQGTFAPSNNPKSGKAAQRPSGRAPIT
Ga0268265_1089636333300028380Switchgrass RhizosphereMIVQSLVTAFAFAFLATAALGHVLLLQAAFAPSNNPKSGKAAERPSGRAPITGAGIAP
Ga0247822_1085017913300028592SoilMIVQSLVTAFAFAFLATAALGHVLLLQAAFAPSNNPKSGKAAERPSGRAPITGAG
Ga0307295_1006340823300028708SoilMIVQSLVTAFAFAFLATAALGHVLLLQAAFAPRNNPKSGKAAQRPSGRAPITGAGIAP
Ga0307322_1001048723300028710SoilMIVQSLVTAFAFAFLATAVLGHVLLLQAAFAPSNNPKSGKAAKRPSGRAPITCAGIAP
Ga0307303_1000646413300028713SoilSGPQLEGAMIVQSLVTAFAFAFLATAVLGHVLLLQAAFAPSNNPKSGKAAKRPSGRAPITGAGIAP
Ga0307309_1006453113300028714SoilMIVQSLVMAFTIAFIATAVLGHVLLLRAAFVPAKNPKSGRAAERPSGRTPIAGAGIAA
Ga0307316_1027482813300028755SoilLVTAFAFAFLATAALGHVLLLQAAFAPSNNPKSGKAAERPSGRAPITGVGIAP
Ga0307280_1000926613300028768SoilAMIVQSLVTAFAFAFLATAVLGHVLLLQAAFAPSNNPKSGKAAKRPSGRAPITGAGIAP
Ga0307306_1009238823300028782SoilMIVQSLVTAFAFAFLATAALGHVLLLQAAFAPSNNPKSGKAAQRPSGRAPITGA
Ga0307282_1005067533300028784SoilMIVQSLVTAFAFAFLAIAALGHVLLLQAALAPSNNPKSGKTAERPSGRAPITGAGIAP
Ga0307323_1010014833300028787SoilMIVQSLVTAFAFAFLATAALGHVLLLQAAFAPSNNPKSGKAAERPSGRAPITGVGIAP
Ga0307292_1008049513300028811SoilEGAMIVQSLVTAFAFAFLATAVLGHVLLLQAAFAPSNNPKSGKAAKRPSGRAPITGAGIA
Ga0307312_1035262333300028828SoilMIVQALVTAFAFAFLATAALGHILLLQAAFAPSNNPKSGKAAERPSGRAPITSVGIAP
Ga0307314_1002715023300028872SoilMIVQSLVTAFAFAFLATAVLGHVLLLQAAFAPSNNPKSGKAAERPSGRAPITGVGIAP
Ga0307300_1006224813300028880SoilMIVQSLVMAFTIAFIATAVLGHVLLLRAAFVPAKNPKSGRAAERPSGRTPIAGAGI
Ga0307304_1022745813300028885SoilMIVQALVTAFAFAFLATAALGHILLLQAAFAPSNNPKSGKAAERPSGRAPITGVGIAP
Ga0247827_1103778633300028889SoilLEGVMIVQSLVTAFAFAFLATAALGHVLLLQAAFAPSNNPKWGKAAQRPSGRAPITGAGIAP
Ga0308198_104315133300030904SoilQLEGAMIVQSLVMAFTIAFIATAVLGHVLLLRAAFVPAKNPKSGRAAERPSGRTPIAGAGIAA
Ga0308190_106727233300030993SoilVQSLVTAFAFAFLATAALGHVLLLQAAFAPSNNPKWGKAAQRPSGRAPITGAGIAP
Ga0308189_1020018013300031058SoilAFAFAFLATAVLGHVLLLQAAFAPSNNPKSGKAAKRPSGRAPITGAGIAP
Ga0308199_105445513300031094SoilMIVQSLVTAFAFAFLATAVLGHVLLLQAAFAPSNNPKSGKAAERPSGRAPITGAGIAP
Ga0308181_104348333300031099SoilQLEGVMIVQSLVTAFAFAFLATAALGHVLLLQAAFAPGNNPKSGKAAERPSGRAPITGAGIAP
Ga0307501_1010491913300031152SoilATAFAFAFLATAALGHGLLLQAALAPSNNPKSGKAAKRPSGRAPITGAGIAP
Ga0307499_1026821523300031184SoilMIIQSLVTAFAFAFLATALGHVLLQAAFAPSNNPKSGKAAERPSGRAPITGAGIAP
Ga0308194_1016106833300031421SoilRDERSGPQLEGVMIVQSLVTAFAFAFVATAALGHVLLLQAAFAPSNNPKSGKTAERPSGRAPITGAGIAP
Ga0310887_1056203023300031547SoilMIVQSLVTAFTIAFLATAMFGHVLLLRAVLVPANNPKSGRAAKRASGRTPIAGPGIAA
Ga0310904_1044297223300031854SoilMIVQSLVTAFTIAFLATAMLGHVLLLRAVFVPANNPKPGRAAERASGRTPIAGPGIAA
Ga0310885_1040805213300031943SoilMIVQSLVTAFAFAFLATAALGHVLLLQAAFAPSNNPKSGKAAQRPSGRAPITGARIAP
Ga0307472_10022238133300032205Hardwood Forest SoilMIVQSLVTAFAFAFLAPAALGHVLLLQAAFAPSNNPKSGKAAKRPSGRAPITGAGIAP
Ga0364925_0292368_3_1703300034147SedimentQSLVTAFAFAFLATAALGHVLLLQAAFAPSNNPKWGKAAQRPSGRAPITGAGIAP
Ga0370548_028721_695_8713300034644SoilMIVQSLVTAFAFAFLATAVLGHVLLLQAAFAPSNNPKSGKAAERPLGRAPITGVGIAP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.