NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F096139

Metagenome Family F096139

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F096139
Family Type Metagenome
Number of Sequences 105
Average Sequence Length 48 residues
Representative Sequence VNGLLARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRRVRELDKR
Number of Associated Samples 92
Number of Associated Scaffolds 105

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 76.19 %
% of genes near scaffold ends (potentially truncated) 28.57 %
% of genes from short scaffolds (< 2000 bps) 91.43 %
Associated GOLD sequencing projects 81
AlphaFold2 3D model prediction Yes
3D model pTM-score0.52

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (85.714 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(10.476 % of family members)
Environment Ontology (ENVO) Unclassified
(30.476 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(49.524 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 54.67%    β-sheet: 0.00%    Coil/Unstructured: 45.33%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.52
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 105 Family Scaffolds
PF03100CcmE 37.14
PF01578Cytochrom_C_asm 32.38
PF03379CcmB 2.86
PF16327CcmF_C 1.90
PF04632FUSC 0.95
PF02272DHHA1 0.95
PF13858DUF4199 0.95
PF07676PD40 0.95
PF01571GCV_T 0.95
PF01174SNO 0.95

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 105 Family Scaffolds
COG2332Cytochrome c biogenesis protein CcmEPosttranslational modification, protein turnover, chaperones [O] 37.14
COG2386ABC-type transport system involved in cytochrome c biogenesis, permease componentPosttranslational modification, protein turnover, chaperones [O] 2.86
COG0118Imidazoleglycerol phosphate synthase glutamine amidotransferase subunit HisHAmino acid transport and metabolism [E] 0.95
COG0311Pyridoxal 5'-phosphate synthase subunit PdxT (glutamine amidotransferase)Coenzyme transport and metabolism [H] 0.95
COG1289Uncharacterized membrane protein YccCFunction unknown [S] 0.95

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms85.71 %
UnclassifiedrootN/A14.29 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_110655359All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300000956|JGI10216J12902_111460487All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300000956|JGI10216J12902_114467385All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300004114|Ga0062593_100945880All Organisms → cellular organisms → Bacteria877Open in IMG/M
3300004114|Ga0062593_101993557All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300004156|Ga0062589_101547571All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300004480|Ga0062592_101156323All Organisms → cellular organisms → Bacteria720Open in IMG/M
3300004778|Ga0062383_10691249All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300005093|Ga0062594_100812929All Organisms → cellular organisms → Bacteria866Open in IMG/M
3300005331|Ga0070670_100017870All Organisms → cellular organisms → Bacteria → Acidobacteria6087Open in IMG/M
3300005340|Ga0070689_101229454All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300005354|Ga0070675_100439582All Organisms → cellular organisms → Bacteria1169Open in IMG/M
3300005364|Ga0070673_102320584All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300005365|Ga0070688_100955585All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300005365|Ga0070688_101640170All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300005367|Ga0070667_101068808All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300005456|Ga0070678_100185020All Organisms → cellular organisms → Bacteria1709Open in IMG/M
3300005468|Ga0070707_100674582All Organisms → cellular organisms → Bacteria996Open in IMG/M
3300005471|Ga0070698_100469276All Organisms → cellular organisms → Bacteria1195Open in IMG/M
3300005518|Ga0070699_101132125All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300005518|Ga0070699_101357596All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300005536|Ga0070697_100379516All Organisms → cellular organisms → Bacteria1224Open in IMG/M
3300005564|Ga0070664_100113358All Organisms → cellular organisms → Bacteria2368Open in IMG/M
3300005618|Ga0068864_100863851All Organisms → cellular organisms → Bacteria892Open in IMG/M
3300005713|Ga0066905_101286654All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300005841|Ga0068863_102487304All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300006163|Ga0070715_10096713All Organisms → cellular organisms → Bacteria1369Open in IMG/M
3300006755|Ga0079222_11512534All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300006806|Ga0079220_11834944All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300006846|Ga0075430_101566964All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300006871|Ga0075434_101655931All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300006876|Ga0079217_10843549All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300006881|Ga0068865_100860184All Organisms → cellular organisms → Bacteria786Open in IMG/M
3300006918|Ga0079216_11616423All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300006930|Ga0079303_10514921All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300007004|Ga0079218_10135446All Organisms → cellular organisms → Bacteria1768Open in IMG/M
3300007004|Ga0079218_10143853All Organisms → cellular organisms → Bacteria1728Open in IMG/M
3300007004|Ga0079218_11487460All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300009012|Ga0066710_103499846Not Available594Open in IMG/M
3300009094|Ga0111539_11737652Not Available723Open in IMG/M
3300009111|Ga0115026_11531962Not Available556Open in IMG/M
3300009156|Ga0111538_10818042All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum1180Open in IMG/M
3300009177|Ga0105248_10586106All Organisms → cellular organisms → Bacteria1258Open in IMG/M
3300009553|Ga0105249_11356634Not Available783Open in IMG/M
3300009610|Ga0105340_1365513Not Available640Open in IMG/M
3300011400|Ga0137312_1052397Not Available677Open in IMG/M
3300012212|Ga0150985_113210516Not Available522Open in IMG/M
3300012212|Ga0150985_122209578All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum551Open in IMG/M
3300012910|Ga0157308_10389016Not Available538Open in IMG/M
3300012944|Ga0137410_11029940All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300014326|Ga0157380_11221354All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300014326|Ga0157380_11483752All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300014969|Ga0157376_11498854Not Available707Open in IMG/M
3300015201|Ga0173478_10498327All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300017965|Ga0190266_10179142Not Available989Open in IMG/M
3300017965|Ga0190266_10232958All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum909Open in IMG/M
3300018067|Ga0184611_1078638All Organisms → cellular organisms → Bacteria1129Open in IMG/M
3300018073|Ga0184624_10352175Not Available659Open in IMG/M
3300018081|Ga0184625_10427162All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum681Open in IMG/M
3300018422|Ga0190265_10568577All Organisms → cellular organisms → Bacteria1251Open in IMG/M
3300018476|Ga0190274_11336729All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300018481|Ga0190271_10637265All Organisms → cellular organisms → Bacteria1186Open in IMG/M
3300018481|Ga0190271_13235971Not Available546Open in IMG/M
3300019361|Ga0173482_10265376All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum738Open in IMG/M
3300019362|Ga0173479_10663052All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium556Open in IMG/M
3300021445|Ga0182009_10538951All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300022756|Ga0222622_10018369All Organisms → cellular organisms → Bacteria3508Open in IMG/M
3300022880|Ga0247792_1068186All Organisms → cellular organisms → Bacteria692Open in IMG/M
3300025905|Ga0207685_10185090All Organisms → cellular organisms → Bacteria968Open in IMG/M
3300025918|Ga0207662_11347644All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300025922|Ga0207646_11596951Not Available563Open in IMG/M
3300025925|Ga0207650_10027862All Organisms → cellular organisms → Bacteria4047Open in IMG/M
3300025926|Ga0207659_10165727All Organisms → cellular organisms → Bacteria1739Open in IMG/M
3300025930|Ga0207701_11282391All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300025936|Ga0207670_10565093All Organisms → cellular organisms → Bacteria931Open in IMG/M
3300025945|Ga0207679_10011743All Organisms → cellular organisms → Bacteria5688Open in IMG/M
3300025960|Ga0207651_11735871All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum562Open in IMG/M
3300025986|Ga0207658_10366979All Organisms → cellular organisms → Bacteria1258Open in IMG/M
3300026023|Ga0207677_12125873All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300026075|Ga0207708_11907023Not Available521Open in IMG/M
3300026088|Ga0207641_10946892All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum856Open in IMG/M
3300026089|Ga0207648_10891235All Organisms → cellular organisms → Bacteria831Open in IMG/M
3300027843|Ga0209798_10547816All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300027886|Ga0209486_10020126All Organisms → cellular organisms → Bacteria3112Open in IMG/M
3300027886|Ga0209486_10485069All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300027899|Ga0209668_10000963All Organisms → cellular organisms → Bacteria12104Open in IMG/M
3300027909|Ga0209382_12079580All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300028812|Ga0247825_11284190All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300030336|Ga0247826_11038040All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300030336|Ga0247826_11069884All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300031834|Ga0315290_10164710All Organisms → cellular organisms → Bacteria1913Open in IMG/M
3300031854|Ga0310904_10291961All Organisms → cellular organisms → Bacteria1029Open in IMG/M
3300031997|Ga0315278_10542703All Organisms → cellular organisms → Bacteria1194Open in IMG/M
3300032144|Ga0315910_10031846All Organisms → cellular organisms → Bacteria3866Open in IMG/M
3300032173|Ga0315268_11039654All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium826Open in IMG/M
3300032275|Ga0315270_10416718All Organisms → cellular organisms → Bacteria858Open in IMG/M
3300032397|Ga0315287_11294275All Organisms → cellular organisms → Bacteria834Open in IMG/M
3300033408|Ga0316605_12490483Not Available503Open in IMG/M
3300033418|Ga0316625_100387022All Organisms → cellular organisms → Bacteria1048Open in IMG/M
3300033433|Ga0326726_10890502All Organisms → cellular organisms → Bacteria863Open in IMG/M
3300033482|Ga0316627_102122349All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300033488|Ga0316621_10109799All Organisms → cellular organisms → Bacteria1570Open in IMG/M
3300033550|Ga0247829_10047534All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Selenomonadales → Sporomusaceae2997Open in IMG/M
3300034075|Ga0373895_049302All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300034080|Ga0373897_092360All Organisms → cellular organisms → Bacteria596Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil10.48%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil8.57%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere8.57%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere5.71%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment4.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil4.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.76%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere4.76%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.76%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.81%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.86%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.86%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.86%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment1.90%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.90%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere1.90%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.90%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.90%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.90%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.90%
Sediment SlurryEngineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry1.90%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.95%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.95%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.95%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.95%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.95%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.95%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.95%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface0.95%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.95%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004778Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3FreshEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300006930Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWCEnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009111Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1EnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300011400Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT133_2EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022880Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027843Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300032144Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soilEnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300032275Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottomEnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300033408Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCTEnvironmentalOpen in IMG/M
3300033418Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_AEnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033482Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_CEnvironmentalOpen in IMG/M
3300033488Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_CEnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300034075Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A4A4.2EngineeredOpen in IMG/M
3300034080Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A5A4.1EngineeredOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_11065535923300000956SoilVSEVLGRTIGDRIVADYVVMVVALVVWGAIFLYLMRLDRKVRELDKR*
JGI10216J12902_11146048723300000956SoilMNEALGRTIGDRIAADYVVMVVALVVWGAVFLYLLRLDKKVRELDKR*
JGI10216J12902_11446738523300000956SoilGERIAADYVVMVVALVVWGAVFLYLMRLDRKVRELDKR*
Ga0062593_10094588023300004114SoilMERDRKGSRGVNGLLARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRRVRELDKR*
Ga0062593_10199355723300004114SoilVNELLGRPIGDRIAADYVVMVVALVVWGAVFFYLMRLERKVRELDKR*
Ga0062589_10154757113300004156SoilRPIGDRIGADMVVMVVALVVWGAVFLYLLRLDKRVRELDKR*
Ga0062592_10115632313300004480SoilGRAARGRRLDRKGSRGVNGLLARPIGDRIGADMVVMVVALVVWGAVFLYLLRLDKRVRELDKR*
Ga0062383_1069124913300004778Wetland SedimentMNEFLGRSIGERIAADYVVMVVALVVWGAVFLYLMRLDRKVRELDKR*
Ga0062594_10081292923300005093SoilVNELLGRPIGDRIAADYVVMVVALLVWGAVFFYLMRLERKVRELDKR*
Ga0070670_10001787033300005331Switchgrass RhizosphereMDRDRKGSRGVNGLLARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRQVRELDKR*
Ga0070689_10122945423300005340Switchgrass RhizosphereMDRDRKGSRGVNGMLARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRRVRELDKR*
Ga0070675_10043958223300005354Miscanthus RhizosphereMDRDRKGSRGVNGMLARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRQVRELDKR*
Ga0070673_10232058413300005364Switchgrass RhizosphereVNGLLARPIGDRIGADMVVMVVALVVWGAVFLYLLRLDKRVR
Ga0070688_10095558523300005365Switchgrass RhizosphereLARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRQVRELDKR*
Ga0070688_10164017023300005365Switchgrass RhizosphereMERDRKGSRGVNGLLARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRQVRELDKR*
Ga0070667_10106880823300005367Switchgrass RhizosphereVNGLLARPIGDRIGADMVVMVVALVVWGALFLYLLKLDHRVRELDKR*
Ga0070678_10018502023300005456Miscanthus RhizosphereMDRDRKGSRGVNGLLARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRRVRELDKR*
Ga0070707_10067458233300005468Corn, Switchgrass And Miscanthus RhizosphereEFLARPIGERIGADWVVMIVALVVWGAVFFYLMRLDRRVRELDKR*
Ga0070698_10046927633300005471Corn, Switchgrass And Miscanthus RhizosphereMDEDGKGSRRVNEFLARPIGERIGADWVVMIVALVVWGAVFFYLMRLDRRVRELDKR*
Ga0070699_10113212523300005518Corn, Switchgrass And Miscanthus RhizosphereVNEFLARPIGERIGADWVVMIVALVVWGAVFFYLMRLDRRVRELDKR*
Ga0070699_10135759623300005518Corn, Switchgrass And Miscanthus RhizosphereMDRDRKGSRGVNGFLARPIGDRIGADWVVMVVALVVWGALFLYLLRLDRRVRELDKR*
Ga0070697_10037951633300005536Corn, Switchgrass And Miscanthus RhizosphereLLARPIGERIGADWVVMIVALVVWGAVFFYLMRLDRRVRELDKR*
Ga0070664_10011335833300005564Corn RhizosphereVNGMLARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRQVRELDKR*
Ga0068864_10086385123300005618Switchgrass RhizosphereVNGLLARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRQVRELDKR*
Ga0066905_10128665423300005713Tropical Forest SoilMNEALGRTIGDRIAADYVVMIVALVVWGAVFLYLMRLDRKVRELEKR*
Ga0068863_10248730423300005841Switchgrass RhizosphereMERDRKGSRGVNGILARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRQVRELDKR*
Ga0070715_1009671333300006163Corn, Switchgrass And Miscanthus RhizosphereVNEILGRTVGERIAADWVVMIVALVVWGALFFYLMRLDRRVRELEKS*
Ga0079222_1151253413300006755Agricultural SoilLNSLLARPIGDRIGADWVVMFVALVVWGAVFFYLLRLERRVRELDKR*
Ga0079220_1183494423300006806Agricultural SoilVNQFLGRPIGDRIMADMVVMVVALVVWGAVFFYLMRLDRRVRELDKR*
Ga0075430_10156696423300006846Populus RhizosphereMERDRKGCCGVNGLLARPIGDRIGADMVVMVVTLVVWGALFLYLLRLDRRVRELDKR*
Ga0075434_10165593123300006871Populus RhizosphereMDRDRKGSCGVNGLLARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRRVRELDKR*
Ga0079217_1084354923300006876Agricultural SoilMNEALGRTIGERIAADYVVMIVALVVWGAVFLYLLRLDKKVRELDKP*
Ga0068865_10086018433300006881Miscanthus RhizosphereRAPRGRRMDRDRKGSRGVNGLLARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRRVRELDKR*
Ga0079216_1161642323300006918Agricultural SoilMNEVLGRTVGERIVADYVVMVVALVVWGAVFLYLMRLDRKVRELDKR*
Ga0079303_1051492123300006930Deep SubsurfaceVNETLGRAVGDRIVADYVVMIVALVVWGAIFLYLMKLDRKVRELDKR*
Ga0079218_1013544633300007004Agricultural SoilMNELMGRTVGERIVADYVVMTVALVVWGAVFLYLMRLDRKVRELDKR*
Ga0079218_1014385333300007004Agricultural SoilMNEALGRTIGERIAADYVVMVVALVVWGAVFLYLLRLDKKVRELDKP*
Ga0079218_1148746033300007004Agricultural SoilRLNELLGRTVGDRIVADYVVMVVALVVWGGIFLYLKRLDRKVRELDKP*
Ga0066710_10349984623300009012Grasslands SoilVTQLLGRTVGERIVADYVVMVVALLVWAGIFFYLVRLDRRVRRLDKR
Ga0111539_1173765233300009094Populus RhizosphereLARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRRVRELDKR*
Ga0115026_1153196213300009111WetlandVGDRIVADYVVMIVALVVWGAIFLYLMKLDRKVRELDKR*
Ga0111538_1081804223300009156Populus RhizosphereVNGLLARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRRVRELDKR*
Ga0105248_1058610613300009177Switchgrass RhizosphereVNGLLARPIGDRIGADMVVMVVALVVWGALFLYLLKLDHR
Ga0105249_1135663413300009553Switchgrass RhizosphereRGVNGLLARPIGDRIGADMVVMVVALVVWGAVFLYLLRLDKRVRELDKR*
Ga0105340_136551333300009610SoilRTIGDRIVADYVVMVVALVVWGAIFLYLMRLDRKVRELDKR*
Ga0137312_105239713300011400SoilPIGDRIGADMVVMVVALVVWGALFLYLLRLDRRVRELDKR*
Ga0150985_11321051623300012212Avena Fatua RhizosphereLNPILGRPIGDRIMADLVVMVVALVVWGAVFLYLMRLDRRVREIDKR*
Ga0150985_12220957823300012212Avena Fatua RhizosphereVNGLLARPIGDRIGADMVVMVVALVVWGAVFFYLLRLDKRVRELDKR*
Ga0157308_1038901613300012910SoilRKMIAAMVVMVVALVVWGALFLYLLRLDRRVRELDKR*
Ga0137410_1102994023300012944Vadose Zone SoilVNAFLGRPIGDRIMADAVVMVVALVVWGALFFYLMRLDKRVRELDRR*
Ga0157380_1122135423300014326Switchgrass RhizosphereMLGRTIGERIAADYVVMAVALVCWIAVFLYLVRLERRVKELEKS*
Ga0157380_1148375223300014326Switchgrass RhizosphereVNEVLGRTIGDRIVADYVVMVVALVVWGAIFLYLMRLDRKVRELDKR*
Ga0157376_1149885423300014969Miscanthus RhizosphereMLARPIGDRIGADMVVMVVALVVWGALFLYLLKLDHRVRELDKR*
Ga0173478_1049832723300015201SoilVNGLLARPIGDRIGADMVVMVVARVVWGALFLYLLRLDGRVRELDKR*
Ga0190266_1017914213300017965SoilMDGDRKGSRGVNGLLARPIGDRIGADMVVMVVALVVWGALFLYLLKLDRRVRELDKR
Ga0190266_1023295823300017965SoilVNEVLGRTIGDRIVADYVVMIVALVVWGAIFLYLMRLDRKVRELDKR
Ga0184611_107863823300018067Groundwater SedimentVNGILARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRRVRELDKR
Ga0184624_1035217513300018073Groundwater SedimentRMDGDRKGSRGVNGLLARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRRVRELDKR
Ga0184625_1042716223300018081Groundwater SedimentVNGILARPIGDRIGADMVVMVVALVVWGALFLYLLKLDRRVRELDKR
Ga0190265_1056857723300018422SoilVVGHGEGSRGMNEFMGRTVGERIAADYVVMAVALVVWGAVFLYLMRLDRKVRELDKR
Ga0190274_1133672923300018476SoilVNGLLARPIGDRIGADMVVMVVALVVWGALFLYLLKLDRRVRELDKR
Ga0190271_1063726523300018481SoilVNEVLGRTIGDRIVADYVVMVVALVVWGAVFLYLMRLDRKVRELDKR
Ga0190271_1323597113300018481SoilIGDRIVADYVVMVVALVVWGAIFLYLMRLDRKVRELDRR
Ga0173482_1026537623300019361SoilMERDRKGSRGVNGLLARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRRVRELDKR
Ga0173479_1066305223300019362SoilMDRDRKGSRGVNGMLARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRRVRELDKR
Ga0182009_1053895113300021445SoilGDRITADLVVMVVALVVWGAVFFYLMRLDRRVRELDKR
Ga0222622_1001836913300022756Groundwater SedimentDRIGADMVVMVVALVVWGALFLYLLRLDRRVRELDKR
Ga0247792_106818623300022880SoilVNGLLARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRRVRELDKR
Ga0207685_1018509033300025905Corn, Switchgrass And Miscanthus RhizosphereVNEILGRTVGERIAADWVVMIVALVVWGALFFYLMRLDRRVRELEKS
Ga0207662_1134764423300025918Switchgrass RhizosphereVNGLLARPIGDRIGADMVVMVVALVVWGAVFLYLLRLDKRVRELDKR
Ga0207646_1159695123300025922Corn, Switchgrass And Miscanthus RhizosphereEFLARPIGERIGADWVVMIVALVVWGAVFFYLMRLDRRVRELDKR
Ga0207650_1002786233300025925Switchgrass RhizosphereMDRDRKGSRGVNGLLARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRQVRELDKR
Ga0207659_1016572743300025926Miscanthus RhizosphereMDRDRKGSRGVNGMLARPIGDRIGADMVVMVVALVVWGAVFLYLLRLDKRVRELDKR
Ga0207701_1128239123300025930Corn, Switchgrass And Miscanthus RhizosphereMDRDRKGSRGVNGLLARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRRVRELDKR
Ga0207670_1056509323300025936Switchgrass RhizosphereMERDRKGSRGVNGLLARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRQVRELDKR
Ga0207679_1001174333300025945Corn RhizosphereMDRDRKGSRGVNGMLARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRQVRELDKR
Ga0207651_1173587123300025960Switchgrass RhizosphereMDRDRKGSRGVNGLLARPIGDRIGADMVVMVVALVVWGALFLYLLKLDHRVRELDKR
Ga0207658_1036697913300025986Switchgrass RhizosphereMDRDRKGSCGVNGLLARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRRVRELDKR
Ga0207677_1212587313300026023Miscanthus RhizosphereMERDRKGSRGVNGILARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRRV
Ga0207708_1190702313300026075Corn, Switchgrass And Miscanthus RhizosphereGLLARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRRVRELDKR
Ga0207641_1094689223300026088Switchgrass RhizosphereVNGMLARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRQVRELDKR
Ga0207648_1089123523300026089Miscanthus RhizosphereVNELLGRPIGDRIAADYVVMVVALLVWGAVFFYLMRLERRVR
Ga0209798_1054781623300027843Wetland SedimentMNEFLGRSIGERIAADYVVMVVALVVWGAVFLYLMRLDRKVRELDKR
Ga0209486_1002012633300027886Agricultural SoilMNEALGRTIGERIAADYVVMVVALVVWGAVFLYLLRLDKKVRELDKP
Ga0209486_1048506923300027886Agricultural SoilMNELMGRTVGERIVADYVVMTVALVVWGAVFLYLMRLDRKVRELDKR
Ga0209668_1000096343300027899Freshwater Lake SedimentVNETLGRAVGDRIVADYVVMIVALVVWGAVFFYLMQLDRKVRELDKR
Ga0209382_1207958013300027909Populus RhizosphereMNEALGRTVGERIVADYVVMVVALVVWGAVFLYLMRLDKKVRELDKR
Ga0247825_1128419013300028812SoilMNEALGRTIGERIAADYVVMVVALVVWGAVFLYLL
Ga0247826_1103804013300030336SoilMNEALGRTIGERIAADYVVMVVALVVWGAVFLYLLRLDKKVRELDK
Ga0247826_1106988423300030336SoilMERDRKGSRGVNGILARPIGDRIGADMVVMVVALVVWGALFLYLLKLDRRVRELDKR
Ga0315290_1016471043300031834SedimentVNEILGRTVGERIAADWVVMIVALVVWGALFFYLMRLDRRVRELEKP
Ga0310904_1029196113300031854SoilLLARPIGDRIGADMVVMVVALVVWGAVFLYLLRLDKRVRELDKR
Ga0315278_1054270333300031997SedimentVNEVLGRTVGDRIVADYVVMVVALVVWGALFAYLMQLDRKVRELDKR
Ga0315910_1003184633300032144SoilVNETLGRTIGDRIVADWVVMAVALVVWGAVFLYLMRLDRKVRELEKR
Ga0315268_1103965433300032173SedimentVNEILGRSVGERIAADWVVMIVALVVWGALFFYLMRLDRKVRELEKP
Ga0315270_1041671823300032275SedimentVGRNRKGSGRVNEILGRSVGERIAADWVVMIVALVVWGALFFYLMRLDRKVRELEKP
Ga0315287_1129427523300032397SedimentVNEVLGRTVGERIAADWVVMIVALVVWGALFFYLMRLDRRVRELEKP
Ga0316605_1249048323300033408SoilVNETLGRTVGDRIVADYVVMIVALVVWGAIFLYLMQLDRKVRELDKR
Ga0316625_10038702233300033418SoilTVGDRIVADYVVMIVALVVWGAIFFYLMQLDRKVRELDKR
Ga0326726_1089050223300033433Peat SoilVNQFLGRPIGDRIMADMVVMVVALIVWGAVFFYLMRLDRRVRELDKR
Ga0316627_10212234923300033482SoilVNETLGRTVGDRIVADYVVMIVALVVWGAIFFYLMQLDRKVRELDKR
Ga0316621_1010979933300033488SoilVNETLGRAVGDRIVADYVVMIVALVVWGAVFLYLMKLD
Ga0247829_1004753433300033550SoilMNEVLGRTIGERIAADYVVMVVALVVWGAVFLYLLRLDKKVRELDKP
Ga0373895_049302_3_1283300034075Sediment SlurryVNETLGRAVGDRIVADYVVMIVALVVWGAIFLYLMKLDRKVR
Ga0373897_092360_384_5273300034080Sediment SlurryVNETLGRAVGDRIVADYVVMIVALVVWGAIFLYLMKLDRKVRELDKR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.