NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F096969

Metagenome / Metatranscriptome Family F096969

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F096969
Family Type Metagenome / Metatranscriptome
Number of Sequences 104
Average Sequence Length 50 residues
Representative Sequence VATKTTRFGQGNIDPQRWDRLKTILGEALEQNSSAARIALVERRCGEDTD
Number of Associated Samples 97
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 82.69 %
% of genes near scaffold ends (potentially truncated) 98.08 %
% of genes from short scaffolds (< 2000 bps) 95.19 %
Associated GOLD sequencing projects 95
AlphaFold2 3D model prediction Yes
3D model pTM-score0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(19.231 % of family members)
Environment Ontology (ENVO) Unclassified
(36.538 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(39.423 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 37.18%    β-sheet: 0.00%    Coil/Unstructured: 62.82%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF07638Sigma70_ECF 96.15
PF00561Abhydrolase_1 0.96
PF00903Glyoxalase 0.96
PF02965Met_synt_B12 0.96
PF00069Pkinase 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 96.15
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.85
COG1410Methionine synthase I, cobalamin-binding domainAmino acid transport and metabolism [E] 0.96

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000955|JGI1027J12803_107363739All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300005179|Ga0066684_10778263All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300005181|Ga0066678_10499796All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium808Open in IMG/M
3300005293|Ga0065715_10044440All Organisms → cellular organisms → Bacteria998Open in IMG/M
3300005293|Ga0065715_10538037All Organisms → cellular organisms → Bacteria750Open in IMG/M
3300005328|Ga0070676_10211101All Organisms → cellular organisms → Bacteria1278Open in IMG/M
3300005332|Ga0066388_105816435All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300005367|Ga0070667_102022038All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300005451|Ga0066681_10660447All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300005451|Ga0066681_10833459All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300005467|Ga0070706_101276852All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300005468|Ga0070707_101549258All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300005548|Ga0070665_102658709All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300005549|Ga0070704_101942159All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300005553|Ga0066695_10525638All Organisms → cellular organisms → Bacteria723Open in IMG/M
3300005554|Ga0066661_10519161All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300005614|Ga0068856_100909610All Organisms → cellular organisms → Bacteria899Open in IMG/M
3300005713|Ga0066905_100428377All Organisms → cellular organisms → Bacteria1081Open in IMG/M
3300005713|Ga0066905_100579514All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium946Open in IMG/M
3300005764|Ga0066903_103088082All Organisms → cellular organisms → Bacteria901Open in IMG/M
3300005844|Ga0068862_102385121All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300006028|Ga0070717_10445388All Organisms → cellular organisms → Bacteria1167Open in IMG/M
3300006031|Ga0066651_10346099All Organisms → cellular organisms → Bacteria797Open in IMG/M
3300006049|Ga0075417_10275678All Organisms → cellular organisms → Bacteria811Open in IMG/M
3300006796|Ga0066665_11699485All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales500Open in IMG/M
3300006854|Ga0075425_100239517All Organisms → cellular organisms → Bacteria2088Open in IMG/M
3300007255|Ga0099791_10410651All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300009038|Ga0099829_10695862All Organisms → cellular organisms → Bacteria844Open in IMG/M
3300009094|Ga0111539_13188354All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300009094|Ga0111539_13295608All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300009156|Ga0111538_13384488All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300009802|Ga0105073_1015922All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300010041|Ga0126312_10503883All Organisms → cellular organisms → Bacteria866Open in IMG/M
3300010047|Ga0126382_10172427All Organisms → cellular organisms → Bacteria1508Open in IMG/M
3300010159|Ga0099796_10205623All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300010375|Ga0105239_12641190All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300010376|Ga0126381_103968468All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300010398|Ga0126383_13552870All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300010399|Ga0134127_10058663All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium3216Open in IMG/M
3300010400|Ga0134122_10603194All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1015Open in IMG/M
3300010401|Ga0134121_10571337All Organisms → cellular organisms → Bacteria1053Open in IMG/M
3300011271|Ga0137393_10870250All Organisms → cellular organisms → Bacteria769Open in IMG/M
3300011444|Ga0137463_1368829All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300012202|Ga0137363_11760110All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus512Open in IMG/M
3300012361|Ga0137360_11651318All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300012362|Ga0137361_11535003All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus588Open in IMG/M
3300012484|Ga0157333_1038941All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus506Open in IMG/M
3300012582|Ga0137358_10293896All Organisms → cellular organisms → Bacteria1103Open in IMG/M
3300012895|Ga0157309_10137910All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300012922|Ga0137394_11282526All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300012960|Ga0164301_11470213All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300012971|Ga0126369_11781220All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300013105|Ga0157369_12168740All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300013306|Ga0163162_10614291All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus1213Open in IMG/M
3300014969|Ga0157376_10192993All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus1869Open in IMG/M
3300015053|Ga0137405_1211920All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus1504Open in IMG/M
3300016371|Ga0182034_11854800All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300018072|Ga0184635_10217033All Organisms → cellular organisms → Bacteria761Open in IMG/M
3300018076|Ga0184609_10200889All Organisms → cellular organisms → Bacteria928Open in IMG/M
3300019882|Ga0193713_1038436All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus1390Open in IMG/M
3300019883|Ga0193725_1133754All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300019886|Ga0193727_1016436All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus2724Open in IMG/M
3300019886|Ga0193727_1156063All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300019890|Ga0193728_1120649All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus1188Open in IMG/M
3300019996|Ga0193693_1072651All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300020002|Ga0193730_1159792All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300020004|Ga0193755_1113509All Organisms → cellular organisms → Bacteria849Open in IMG/M
3300020004|Ga0193755_1175709All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus631Open in IMG/M
3300020010|Ga0193749_1088528All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300021413|Ga0193750_1002292All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus5140Open in IMG/M
3300021415|Ga0193694_1009308All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus1316Open in IMG/M
3300025315|Ga0207697_10545085All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300025549|Ga0210094_1026101All Organisms → cellular organisms → Bacteria962Open in IMG/M
3300025901|Ga0207688_10864585All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300025906|Ga0207699_11167799All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300025917|Ga0207660_11490088All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300025923|Ga0207681_11499111All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300025927|Ga0207687_10715927All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia850Open in IMG/M
3300025933|Ga0207706_10355544All Organisms → cellular organisms → Bacteria1273Open in IMG/M
3300025933|Ga0207706_11144200All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300025945|Ga0207679_10255824All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1491Open in IMG/M
3300026306|Ga0209468_1033883All Organisms → cellular organisms → Bacteria1774Open in IMG/M
3300026314|Ga0209268_1114045All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300026323|Ga0209472_1028831All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2556Open in IMG/M
3300026324|Ga0209470_1111493All Organisms → cellular organisms → Bacteria1220Open in IMG/M
3300026528|Ga0209378_1116162All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1157Open in IMG/M
3300026538|Ga0209056_10166143All Organisms → cellular organisms → Bacteria1664Open in IMG/M
3300026548|Ga0209161_10158517All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1300Open in IMG/M
3300026716|Ga0208344_100811All Organisms → cellular organisms → Bacteria786Open in IMG/M
3300027876|Ga0209974_10034231All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1687Open in IMG/M
3300028796|Ga0307287_10393001All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300028819|Ga0307296_10085177All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1686Open in IMG/M
3300028828|Ga0307312_10647590All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300028884|Ga0307308_10128248All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1213Open in IMG/M
3300030844|Ga0075377_10011922All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1015Open in IMG/M
3300030847|Ga0075405_12058265All Organisms → cellular organisms → Bacteria868Open in IMG/M
3300031128|Ga0170823_15060330All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300031446|Ga0170820_13249231All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium929Open in IMG/M
3300031716|Ga0310813_11185233All Organisms → cellular organisms → Bacteria703Open in IMG/M
3300031890|Ga0306925_11947022All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300031897|Ga0318520_10344428All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium904Open in IMG/M
3300031954|Ga0306926_11153365All Organisms → cellular organisms → Bacteria913Open in IMG/M
3300032180|Ga0307471_100554008All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1304Open in IMG/M
3300032261|Ga0306920_101079625All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca1165Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil19.23%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil15.38%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil9.62%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.81%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.81%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.85%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.85%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.88%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.88%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.88%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.92%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere1.92%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.92%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.96%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.96%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.96%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.96%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.96%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.96%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.96%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009802Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_50_60EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300011444Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2EnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012484Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.old.190510EnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012895Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2EnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015053Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300019882Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2EnvironmentalOpen in IMG/M
3300019883Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2EnvironmentalOpen in IMG/M
3300019886Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2EnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300019996Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a2EnvironmentalOpen in IMG/M
3300020002Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1EnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300020010Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2EnvironmentalOpen in IMG/M
3300021413Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c1EnvironmentalOpen in IMG/M
3300021415Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s1EnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025549Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026306Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes)EnvironmentalOpen in IMG/M
3300026314Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes)EnvironmentalOpen in IMG/M
3300026323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)EnvironmentalOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026528Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300026716Grasslands soil microbial communities from Kansas, USA, that are Nitrogen fertilized - NN592 (SPAdes)EnvironmentalOpen in IMG/M
3300027876Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300030844Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030847Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI1027J12803_10736373923300000955SoilVSTRTSRFPLENFDSQRWNRLKTILGEALEQNSSAARIALVEQRCGEDTDLLEEAES
Ga0066684_1077826313300005179SoilVTTKTNRFGQGKVDPQRWDRLKTILGEALEQNSSAARIAL
Ga0066678_1049979623300005181SoilVSTKTTRFGQGNIDPRRWDRLKIILGEALEQNSSAARIAL
Ga0065715_1004444023300005293Miscanthus RhizosphereLQFSVATKSTEFRQGNIDPQRWDRLKTILGEALEQNSSAARIALVER
Ga0065715_1053803723300005293Miscanthus RhizosphereVATKTTRFGQANTDPQRWDRLKTILGDALEQNSLADRMAFVEKSCGGDTDLLGEA
Ga0070676_1021110113300005328Miscanthus RhizosphereVATNTTQFGQGNIDPHRWDRLKTILGEALEQNSSAARIALVERCCG
Ga0066388_10581643513300005332Tropical Forest SoilVATKTTRFGQGNFDPQRWNRLKTVLGEALEQKSSAARIALVERRCGQDTDLLEEA
Ga0070667_10202203813300005367Switchgrass RhizosphereVATKTTRFRQGNIDPQHWDRLKTILGEALEQNSSAARIALVER
Ga0066681_1066044713300005451SoilVSTKTTRFGQGNIDPRRWDRLKIILGEALEQDSSAARIALVER
Ga0066681_1083345913300005451SoilVSTKTTRFGQGNIDPRRWDRLKIILGEALEQDSSAARIALVERRCGEDTDLLEEA
Ga0070706_10127685213300005467Corn, Switchgrass And Miscanthus RhizosphereVATKSTEFGQGNIDPQRWDRLKTILGEALEQDSSAARIALVEKRCGQDTDLLEEAES
Ga0070707_10154925823300005468Corn, Switchgrass And Miscanthus RhizosphereVSTKTTQFGQGNIDPRRWDRLKIILGEVLEQNSSAARIALVERR
Ga0070665_10265870913300005548Switchgrass RhizosphereVTTRTTRFRQEKIDPQRWDRLKTILGEALEQNSSSARIALVEKRCGQDTDLLEEAES
Ga0070704_10194215923300005549Corn, Switchgrass And Miscanthus RhizosphereMSTKTTRFRQEKIDPQRWDRLKTILGEALEQNSSAARIALVEQRCG
Ga0066695_1052563823300005553SoilVATKTTRFGQGNIDPQRWDRLKTILGEALEQNSSAARIALVEQRCGQDTDLLEEAESLL
Ga0066661_1051916113300005554SoilVSTKTTRFGQGNIDPRRWDRLKIILGEALEQDSSAARIALVERRCGEDTD
Ga0068856_10090961013300005614Corn RhizosphereVATKTTRFRQGNIDPQHWDRLKIILGEALEQNSSAA
Ga0066905_10042837723300005713Tropical Forest SoilMPTRTTRFRQGNIDPQRWDRLKTILCEALEQNSSAARIAVVERRCGHDTDLLEEAESLLV
Ga0066905_10057951413300005713Tropical Forest SoilVATKITRFSQGNIDPQRWDRLKTILGEALEQSSSAARTALVERRCGQDT
Ga0066903_10308808223300005764Tropical Forest SoilVATNTTRFGQGNIDPQRWDRLKTILGEALEQNSSAARIA
Ga0068862_10238512113300005844Switchgrass RhizosphereVATNTTQFGQGNIDPHRWDRLKTILGEALEQNSSAARIALVERRCG
Ga0070717_1044538813300006028Corn, Switchgrass And Miscanthus RhizosphereVTTRTTRFRQAKIDPQRWDRLKTILGEALEQNSSSARIALVEKRCGHDTDLLEEAE
Ga0066651_1034609923300006031SoilVATNTTQLGQGNIDPERWDRLKTILGEALEQHSSAGRIALVERRCGQDTD
Ga0075417_1027567823300006049Populus RhizosphereVATNTTQFGQENIDPQRWNRLKTILGEALEQNSSAARIAVVEQRCGQDT
Ga0066665_1169948513300006796SoilVSTKTTRFGQGNIDPRRWDRLKIILGEALEQDSSAARIALVERRCGEDTDLLEEAESL
Ga0075425_10023951713300006854Populus RhizosphereVATKTTRFGQGNIDPQRWDRLKTILGEALEQNSSAARIAW
Ga0099791_1041065123300007255Vadose Zone SoilVATNTTRFGQGNIDPQRWDRLKTILGEALEQDSSAARIALVERRCGQDTDLLEE
Ga0099829_1069586213300009038Vadose Zone SoilVSTKTTRFRQGNIDPQRWDCLKNILGEALEQNSSAARMALVERRCGQDTDLLEEAGSL
Ga0111539_1318835413300009094Populus RhizosphereVATNTTRFGQGNIDPQRWDRLKTILGEALEQNSSAARIAFV
Ga0111539_1329560813300009094Populus RhizosphereVATKTTRFRQGNIDPQHWDRLKIILGEALEQNSSAARIALVEQRCGQDTDLLEE
Ga0111538_1338448823300009156Populus RhizosphereVATRTTRFPQGTIDPQRWNRLKTILGEALEQNSSAARIALVETRCGQDTDLLEEAESLL
Ga0105073_101592223300009802Groundwater SandVATKTTRFGQGNIDPQRWDRLKTILGEALEQNSSAARIALVERRCGQDTDLLEEAE
Ga0126312_1050388323300010041Serpentine SoilVVAKSTEFGQGNIDPQRWDRLKTILGEALEQNSSAARTAVVERRCGEDTHLLE*
Ga0126382_1017242733300010047Tropical Forest SoilVATNTTRFGQGNIDPQRWDRLKTILGEALEQNSSAARIALVEKR
Ga0099796_1020562313300010159Vadose Zone SoilVATKTNRFGQGNIDPQRWDRLKIILGEALEQNSSGARITLVEQRCGQDTDLLEEAESLLD
Ga0105239_1264119023300010375Corn RhizosphereVATKTTRFGQANTDPQRWDRLKTILGDALEQNSLADRMAFVEKSCGGDTDLLGEAEALLA
Ga0126381_10396846823300010376Tropical Forest SoilMITRTTRFRQGNIDPQHWDRLKTILGEALEQNSSAARFALIETRCGEDTD
Ga0126383_1355287013300010398Tropical Forest SoilVITRATRFRQGNIDPQRWDRLKTILGEALEQNSSAARIALVERCCGQDTDLLEEAESL
Ga0134127_1005866313300010399Terrestrial SoilVATKTTQFGQANIDPQRWNRLKTILGEALEENTSAA
Ga0134122_1060319433300010400Terrestrial SoilVSTKTTRFRQGNIDPQRWDRLKIILGEALEQNSSAARIALVE
Ga0134121_1057133713300010401Terrestrial SoilVATKTTRFGQGNIDPQRWDRLKTILGEALEQNSSAARIALVERRCAQD
Ga0137393_1087025023300011271Vadose Zone SoilVSTKTTRFGQGNIDPRRWDRLKIILGEALEQNSSAARIALVERRCGEDTDLLEEAES
Ga0137463_136882913300011444SoilVATKTTRFGQGNIDPQRWDRLKTILGEALEQNSSAARI
Ga0137363_1176011023300012202Vadose Zone SoilMATRTTRFGQWNIDPQRWDRLKTILGEALEQNSSAARIALVERRCGQDTDLLEEAESLL
Ga0137360_1165131823300012361Vadose Zone SoilVSTKTTRFGQGNIDPRRWDRLKIILGEALEQNSSAARIALVERRCGEDTDLLEEA
Ga0137361_1153500323300012362Vadose Zone SoilVTTRTTRFRQEKVDPQRWDRLKTILGEALEQNSLAARIALVEKRCGQDTDLLEEAESL
Ga0157333_103894113300012484SoilVSTKTTRFGQGNIDPRRWDRLKIILGEALEQNSSAARGALVERRCGEDTDLLEEAESLL
Ga0137358_1029389633300012582Vadose Zone SoilVTTNATRFGQGNIDPRRWDRLKTILGEALEQNSSAARIALVERRCGQDTDLLEEAE
Ga0157309_1013791023300012895SoilVTTKTTRFRQGNIDPQRWDRLKTILGEALEQNASAARIALVEQRCGQDTDLVE
Ga0137394_1128252623300012922Vadose Zone SoilVATKSTEFGQGNIDPQRWDRLKTILGEALEQNSSAAR
Ga0164301_1147021323300012960SoilVTTRTTRFPQEKIDPQRWDRLKTILGEALEQNSSAARIAFVERRCGQ
Ga0126369_1178122023300012971Tropical Forest SoilVATNTTRFGQGNIDPQRWDRLKTILGEALEQNSSAARIALVE
Ga0157369_1216874023300013105Corn RhizosphereVTTRTTRFRQEKIDPQRWDRLKTILGEALEQNSSAARIALVEQRCGED
Ga0163162_1061429133300013306Switchgrass RhizosphereVAANTTQFGQGNIDPHRWDRLKTILGEALEQNSSAARIALVERRCGEDTDLLQEAESLL
Ga0157376_1019299313300014969Miscanthus RhizosphereVATKTTRFRQGNIDPQHWDRLKIILGEALEQNSSAALIALVEQRCGQD
Ga0137405_121192013300015053Vadose Zone SoilVATKTTQFGQGNIDPQRWDHLKTILGEALEENSSAARIALVERRCGEDTD
Ga0182034_1185480023300016371SoilVATKTTRFRQTNLDAQRWDLLKTILGEALEQDSSAARIALLERR
Ga0184635_1021703313300018072Groundwater SedimentVATKTTRFGQGNIDPQRWDRLKTILGEALEQNSSAARIALVERRCGEDTD
Ga0184609_1020088923300018076Groundwater SedimentMSTKTTRFRQEKIDPQRWDRLKTILGEALEQNSSADRIALVER
Ga0193713_103843633300019882SoilVSTKTTRFGQGNIDPRRWDRLKIILGEALEQNSSAARIALVERRCGEDTDLLEEAESLLV
Ga0193725_113375413300019883SoilVATKTTRFGQGNIDPQRWDRLKTILGEALEQNSSAARIALVE
Ga0193727_101643643300019886SoilVAINTTQFGQGNIDPQRWDRLKTILGEALEENSSAARIALVEKR
Ga0193727_115606323300019886SoilVATKTTRSGNIDPQRWNRLKTILGEALEQNSSAARVAVVEQRCGQDTDLLYEA
Ga0193728_112064913300019890SoilMATRTTRFRQEKVDPQRWDRLKTILGEALEQNSSAARIALVERRCGED
Ga0193693_107265123300019996SoilVATKSTEFGQGNIDPQRWDRLKTILGEALEQNSSAARIALVERCCGEDTD
Ga0193730_115979213300020002SoilVTTNATRFGQGNIDPRRWDRLKTILGEALEQNSSAARIALVERRCGQDTDLLEE
Ga0193755_111350913300020004SoilVATKSTEFGQGNIDPQRWDRLKTILGEALEQNSSAARIALVERCCGQDTD
Ga0193755_117570913300020004SoilVATRTTRFRQGNIDPQHWDRLKTILGEALEQNSSAARIALVEKRCGEDTDLLEEAESLL
Ga0193749_108852823300020010SoilMPTKTTRFRQTNLDPQRWNLLKTILGEALEQNSSAARIVLLES
Ga0193750_100229213300021413SoilMATRTTRFRQEKVDPQRWDRLKTILGEALEQNSSAARIALVERRCGQD
Ga0193694_100930813300021415SoilMATKSTEFRQGNIDPQRWDRLKTILGEALEQNSSAARIALVERCCGEDTDLLEEAESL
Ga0207697_1054508513300025315Corn, Switchgrass And Miscanthus RhizosphereVATRTTRFRQENIDPQRWDRLKTILGEALEQNSLAARIA
Ga0210094_102610113300025549Natural And Restored WetlandsVATKSTEFGQGNIDPQRWDRLKTILGEALEQGSSAARIALVERRCGEDTDLLEEAESLL
Ga0207688_1086458513300025901Corn, Switchgrass And Miscanthus RhizosphereVTTRTTRFRQEKIDPQRWDRLKTILGEALEQNSSSARIALVEKRCGQDTDLLEE
Ga0207699_1116779913300025906Corn, Switchgrass And Miscanthus RhizosphereMATKITRFRQEKVDPQRWDRLKTILDEALEQNSSAARIALVERRCGQDTDLLEEA
Ga0207660_1149008823300025917Corn RhizosphereVATKTTRFGQANTDPQRWDRLKTILGDALEQNSLADRMAFVEKSCGGDTDLLGEAEALLAEAE
Ga0207681_1149911113300025923Switchgrass RhizosphereVATKTTRFGQGKIDPQRWDRLKTILGEALEQNSSA
Ga0207687_1071592723300025927Miscanthus RhizosphereVTVKTTRFRQGTIDPQRWDRLKTILGQALEQNSSAARIAFVERCCGQDFDLLEEAESLL
Ga0207706_1035554433300025933Corn RhizosphereVATKTTRFGQANTDPQRWDRLKTILGDALEQNSLADRMAFVEKSCGQDTDLLE
Ga0207706_1114420013300025933Corn RhizosphereVATNTTQFGQGNIDPHRWDRLKTILGEALEQNSSAARIALVERCCGEDTDLLQE
Ga0207679_1025582433300025945Corn RhizosphereVATKTTRFGQGNIDPQRWDRLKTILGEALEQNSSAARIALVERCCGQDTDLLEEAESLL
Ga0209468_103388313300026306SoilVATKTTRFGQGNIDPQRWDRLKTILGEALEQDSSAARIALVERQCGQDTDLLEEAESLLVEAEALLKE
Ga0209268_111404523300026314SoilVATKTTRFGQGNIDPQRWDRLKTILGEALEQNSSAARIALVERR
Ga0209472_102883113300026323SoilVATNTTQFGQGNIDPQRWDRLKTILGEALEENSSAARIALVERRCGQDTDLLEEAE
Ga0209470_111149313300026324SoilVATKTTRFGQGNIDPQRWDRLKTILGEALEQDSSAARIALVER
Ga0209378_111616213300026528SoilVSTKTTRFGQGNIDPRRWDRLKIILGEALEQDSSAAR
Ga0209056_1016614333300026538SoilVSTKTTRFGQGNIDPQRWDRLKTILGEALEQNSSAVRIALVERRCGED
Ga0209161_1015851733300026548SoilVSTKTTQFGQGNIDPRRWDRLKIILGEALEQNSSAARIALVERRCGEDTDLLEEAESL
Ga0208344_10081123300026716SoilVATKTTRFGQGNIDPQRWDRLKTILGEAFEQNSSAARIALVERRCGQDTDLLEEA
Ga0209974_1003423113300027876Arabidopsis Thaliana RhizosphereVATKTTRFGQGKIDPQRWDRLKTILGEALEQNSSAARIALVETRC
Ga0307287_1039300113300028796SoilVATKFTDFGQGNSDPQRWDRLKTILGEALEQNSSAA
Ga0307296_1008517713300028819SoilVTTKTTRFGQGNIDPQRWDRLKTILGEALEENSSAARIALVEKRCGQDTD
Ga0307312_1064759023300028828SoilVATRTSRFQQGNIDPQRWDRLKTILGEALEQKSSAARIALVERRCGQDTDLLEEAE
Ga0307308_1012824833300028884SoilVATNTTQFRQGNIDPQRWDRLKTILGEALEENSSAARIALVEKRC
Ga0075377_1001192233300030844SoilVSTKTTRFGQGNIDPRRWDRLKIILGEALEQNSSAARIAFVERRCGEDTDLLEEAESLLVEAE
Ga0075405_1205826513300030847SoilVAAKTTRFGQGNIDPQRWDRLKTILGEALEQDSSAARIALVERQCGQDTDLLEEAESLLVEAEALL
Ga0170823_1506033013300031128Forest SoilVSTKTTRFGQGNIDPRRWDRLKIILGEALEQNSSAARIALVERRCCQDTDLLEEAESLL
Ga0170820_1324923113300031446Forest SoilVSTKTTRFRQGNIDPQRWDRLKTILGEALEQNSSAARIA
Ga0310813_1118523313300031716SoilVSTRTTRFGQGNIDPQRWDRLKTILGEALEQDSSAARIALVEQRCGQDTDL
Ga0306925_1194702223300031890SoilVRTKTTRFRENNIDPQRWDLLKTILGEALEQNSSAARFALIETRCGEDTDL
Ga0318520_1034442813300031897SoilVATRTSRFGHGNIDSQRWDRLKRILGEALEQNSSGARITLVERRCRQDTDLLEEA
Ga0306926_1115336523300031954SoilVATRTSRFQEGNIDPQRWDRLKTILGEALEQNSSADRIALVEQRCGEDTDLLEEAE
Ga0307471_10055400813300032180Hardwood Forest SoilVATKTTQFGQGNIDPQRWDRLKTILGEALEQNSSAARIALVERRCGEDTDLLEEAESLL
Ga0306920_10107962523300032261SoilMATKTTQFGRGNIDPQRWDRLKTILGEALEQNSSAARIAVVEQRCGHDTDLFEEAS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.