NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F097096

Metagenome / Metatranscriptome Family F097096

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F097096
Family Type Metagenome / Metatranscriptome
Number of Sequences 104
Average Sequence Length 44 residues
Representative Sequence PVAAFGKLFLTLPLARSQTDLYVEMVGLVRPGDGVSFDVVQLYR
Number of Associated Samples 83
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 98.08 %
Associated GOLD sequencing projects 80
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.077 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(31.731 % of family members)
Environment Ontology (ENVO) Unclassified
(42.308 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(52.885 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 11.36%    β-sheet: 22.73%    Coil/Unstructured: 65.91%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF07811TadE 86.54
PF04392ABC_sub_bind 2.88
PF13701DDE_Tnp_1_4 0.96
PF12697Abhydrolase_6 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 2.88


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.08 %
UnclassifiedrootN/A1.92 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000597|AF_2010_repII_A1DRAFT_10075709All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium nodulans848Open in IMG/M
3300000655|AF_2010_repII_A100DRAFT_1064038All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium650Open in IMG/M
3300000793|AF_2010_repII_A001DRAFT_10038186All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium nodulans1106Open in IMG/M
3300000893|AP72_2010_repI_A001DRAFT_1027710All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium nodulans899Open in IMG/M
3300005363|Ga0008090_15598411All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium669Open in IMG/M
3300005447|Ga0066689_10444812All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales813Open in IMG/M
3300005558|Ga0066698_10183176All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1428Open in IMG/M
3300005558|Ga0066698_10273746All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.1168Open in IMG/M
3300005598|Ga0066706_10677198All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.819Open in IMG/M
3300005614|Ga0068856_101405558All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium712Open in IMG/M
3300005713|Ga0066905_102275062All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium506Open in IMG/M
3300005764|Ga0066903_100260467All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2690Open in IMG/M
3300005764|Ga0066903_101524043All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.1263Open in IMG/M
3300005764|Ga0066903_106341195All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium617Open in IMG/M
3300005764|Ga0066903_106372138All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium616Open in IMG/M
3300005764|Ga0066903_107582121All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium559Open in IMG/M
3300006028|Ga0070717_10472538All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.1132Open in IMG/M
3300006034|Ga0066656_10849793All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium584Open in IMG/M
3300006046|Ga0066652_101491831All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium628Open in IMG/M
3300006755|Ga0079222_10387975All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.965Open in IMG/M
3300006852|Ga0075433_10950791All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium749Open in IMG/M
3300006853|Ga0075420_101520651All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium574Open in IMG/M
3300006854|Ga0075425_100617585All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.1247Open in IMG/M
3300007076|Ga0075435_101501088All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium591Open in IMG/M
3300009012|Ga0066710_103756351All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium570Open in IMG/M
3300009137|Ga0066709_101624310All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium923Open in IMG/M
3300009143|Ga0099792_10487681All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium770Open in IMG/M
3300009143|Ga0099792_11059238All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium544Open in IMG/M
3300009156|Ga0111538_10186962All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2630Open in IMG/M
3300009839|Ga0116223_10352889All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria871Open in IMG/M
3300010043|Ga0126380_10173354All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1412Open in IMG/M
3300010047|Ga0126382_10789359All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria808Open in IMG/M
3300010047|Ga0126382_11368335All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium644Open in IMG/M
3300010335|Ga0134063_10099578All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1318Open in IMG/M
3300010358|Ga0126370_10944223All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium782Open in IMG/M
3300010358|Ga0126370_11888844All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium580Open in IMG/M
3300010359|Ga0126376_12549815All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium559Open in IMG/M
3300010360|Ga0126372_11392067All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium734Open in IMG/M
3300010361|Ga0126378_10498516All Organisms → cellular organisms → Bacteria1333Open in IMG/M
3300010376|Ga0126381_104130319All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300010398|Ga0126383_12967099All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium554Open in IMG/M
3300012209|Ga0137379_11000366All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium741Open in IMG/M
3300012356|Ga0137371_10669871All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium795Open in IMG/M
3300012361|Ga0137360_10805841All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium808Open in IMG/M
3300012930|Ga0137407_11010577All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium788Open in IMG/M
3300012971|Ga0126369_11064436All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales897Open in IMG/M
3300012971|Ga0126369_11248973All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium833Open in IMG/M
3300012971|Ga0126369_13257593All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium532Open in IMG/M
3300013503|Ga0120127_10163591All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium538Open in IMG/M
3300015371|Ga0132258_12475998All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1299Open in IMG/M
3300016294|Ga0182041_11249396All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium678Open in IMG/M
3300016341|Ga0182035_10169639All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1697Open in IMG/M
3300016371|Ga0182034_10586381All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium nodulans939Open in IMG/M
3300016387|Ga0182040_10328404All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1179Open in IMG/M
3300016387|Ga0182040_11286817All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium617Open in IMG/M
3300016445|Ga0182038_11275948All Organisms → cellular organisms → Bacteria → Proteobacteria656Open in IMG/M
3300020579|Ga0210407_11135366All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium591Open in IMG/M
3300021560|Ga0126371_11643268All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium768Open in IMG/M
3300021560|Ga0126371_12455826All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium631Open in IMG/M
3300021560|Ga0126371_12740913All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium597Open in IMG/M
3300021560|Ga0126371_13007418All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium571Open in IMG/M
3300021560|Ga0126371_13682477All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium517Open in IMG/M
3300025939|Ga0207665_10527236All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium915Open in IMG/M
3300026088|Ga0207641_10618574All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium nodulans1062Open in IMG/M
3300026309|Ga0209055_1155163All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium765Open in IMG/M
3300031544|Ga0318534_10788101All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales534Open in IMG/M
3300031546|Ga0318538_10433612All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium711Open in IMG/M
3300031564|Ga0318573_10283354All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales886Open in IMG/M
3300031713|Ga0318496_10631568All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium591Open in IMG/M
3300031723|Ga0318493_10170624All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1136Open in IMG/M
3300031724|Ga0318500_10598520All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium558Open in IMG/M
3300031736|Ga0318501_10774473All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium530Open in IMG/M
3300031744|Ga0306918_10774660All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium749Open in IMG/M
3300031763|Ga0318537_10324519All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium569Open in IMG/M
3300031764|Ga0318535_10450243All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium573Open in IMG/M
3300031769|Ga0318526_10127509All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium nodulans1028Open in IMG/M
3300031771|Ga0318546_10239301All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1247Open in IMG/M
3300031793|Ga0318548_10293101All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium799Open in IMG/M
3300031794|Ga0318503_10240980All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium587Open in IMG/M
3300031797|Ga0318550_10319960All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium752Open in IMG/M
3300031821|Ga0318567_10290538All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium nodulans921Open in IMG/M
3300031821|Ga0318567_10774094All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium544Open in IMG/M
3300031833|Ga0310917_10662545All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria707Open in IMG/M
3300031833|Ga0310917_10694104All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium689Open in IMG/M
3300031879|Ga0306919_10277201All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1267Open in IMG/M
3300031879|Ga0306919_10843074All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium703Open in IMG/M
3300031879|Ga0306919_11424996All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium522Open in IMG/M
3300031893|Ga0318536_10622174All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium539Open in IMG/M
3300031897|Ga0318520_10182258All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1232Open in IMG/M
3300031897|Ga0318520_10218693All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1129Open in IMG/M
3300031897|Ga0318520_10640042Not Available662Open in IMG/M
3300031910|Ga0306923_10998160All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium909Open in IMG/M
3300031942|Ga0310916_10695700All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium nodulans860Open in IMG/M
3300031947|Ga0310909_11621701All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium512Open in IMG/M
3300032025|Ga0318507_10312542All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium684Open in IMG/M
3300032041|Ga0318549_10277861All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium754Open in IMG/M
3300032044|Ga0318558_10536672All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium584Open in IMG/M
3300032054|Ga0318570_10143804All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1064Open in IMG/M
3300032055|Ga0318575_10580694All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium568Open in IMG/M
3300032066|Ga0318514_10622340All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales575Open in IMG/M
3300032068|Ga0318553_10137718All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1260Open in IMG/M
3300032174|Ga0307470_11860176All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium511Open in IMG/M
3300032261|Ga0306920_100424115Not Available1977Open in IMG/M
3300033289|Ga0310914_10431593All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1192Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil31.73%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil17.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.73%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.77%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil5.77%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.81%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil3.85%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.92%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.92%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.96%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.96%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.96%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.96%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.96%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.96%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.96%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000597Forest soil microbial communities from Amazon forest - 2010 replicate II A1EnvironmentalOpen in IMG/M
3300000655Forest soil microbial communities from Amazon forest - 2010 replicate II A100EnvironmentalOpen in IMG/M
3300000793Forest soil microbial communities from Amazon forest - 2010 replicate II A001EnvironmentalOpen in IMG/M
3300000893Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001EnvironmentalOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013503Permafrost microbial communities from Nunavut, Canada - A23_5cm_12MEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
AF_2010_repII_A1DRAFT_1007570933300000597Forest SoilFFLTLPLQRSQTDLYVELVGLVQPGDGVSFDVVQLYR*
AF_2010_repII_A100DRAFT_106403813300000655Forest SoilPVAAFGKFFLTLPLGRSQTDLYVEMVGLVRPGDGVSYDVVQLYR*
AF_2010_repII_A001DRAFT_1003818613300000793Forest SoilKFFLTLPLGRSQTDLYVEMVGLVRPGDGVSFDVVQLYR*
AP72_2010_repI_A001DRAFT_102771033300000893Forest SoilQAHVPVAAFGKFFLTLPLQQSQTDLYVELVGLVQPGDGVSFDVVQLYR*
Ga0008090_1559841123300005363Tropical Rainforest SoilGKFFLTLPLARAQTDLYVEMVGLVRPGDGVSYDVVQLYR*
Ga0066689_1044481233300005447SoilQSNIPVAAFGKLFLTLPLAQSQTDLYVELVGLVQPGDGVSYDVVQLYR*
Ga0066698_1018317613300005558SoilAFGKFFLTLPLARAQTDLYVEMVGLVRPGDGVSYDVVQLYR*
Ga0066698_1027374633300005558SoilAFGKLFLTLPLQRSQTDLYAELIGLVKPGDDGNFDMVQLYR*
Ga0066706_1067719833300005598SoilTLPLAQSQTDLYVELVGLVQPGDGVSYDVVQLYR*
Ga0068856_10140555813300005614Corn RhizosphereFLTLPLQRSQTDLYVEALGFVTPGDIVNYDMVQLYR*
Ga0066905_10227506213300005713Tropical Forest SoilAAFGKLFLTLPLARSQTDLYVELVGLVRPGDGVSFDVVQLYR*
Ga0066903_10026046713300005764Tropical Forest SoilTQSDIPVAAFGKFFLTLPLSRSQTDLYVELVGLVRPGDGVSYDVVQLYR*
Ga0066903_10152404313300005764Tropical Forest SoilQFNVPVAAFGKLFLTLPLARSQTDLYVELVGLVRPGDGVSFDVVQLYR*
Ga0066903_10634119513300005764Tropical Forest SoilQSNVPVAAFGKLFLTLPLSRSQTDLYVEMAGLVQPGDGVSFDVVQLYR*
Ga0066903_10637213813300005764Tropical Forest SoilPVAAFGKFFLTLPLAPAQSDLYVEMIGLVRPGDGVSFDVIQLYR*
Ga0066903_10758212113300005764Tropical Forest SoilPVAAFGKLFLTLPLERSQTDLYVEMVGLVRPGDGVSYDVVQLYR*
Ga0070717_1047253813300006028Corn, Switchgrass And Miscanthus RhizosphereFLTLPLARSQTDLYVELVGLVRPGDGVSYDVVQLYR*
Ga0066656_1084979323300006034SoilFLTLPLAQSQTDLYVELVGLVRPGDGVSFDVVQLYR*
Ga0066652_10149183123300006046SoilVAAFGKFFLTLPLSRAQTDLYVELVGLVRPGDGVSYDVVQLYR*
Ga0079222_1038797533300006755Agricultural SoilPVAAFGKLFLTLPLGRSQTDLYVEMVGLVRPGDGVSFDVVQLYR*
Ga0075433_1095079133300006852Populus RhizosphereFLTLPLARSQTDLYVEMVGLVRPGDGVSFDVVQLYR*
Ga0075420_10152065113300006853Populus RhizospherePVAAFGKFFLTLPLARAQTDLYVEMVGLVRPGDGVSFDVVQLYR*
Ga0075425_10061758533300006854Populus RhizosphereAAFGKLFLTLPLAQSQTDLYVELVGLVRPGDGVSFDVVQLYR*
Ga0075435_10150108823300007076Populus RhizosphereKFFLTLPLAHAQTDLYVEMVGLVRPGDGVSFDVVQLYR*
Ga0066710_10375635113300009012Grasslands SoilVAAFGKFFLTLPLSRAQTDLYVELVGLVRPGDGVSYDVVQLYR
Ga0066709_10162431033300009137Grasslands SoilLDGEAQSNVPVAAFSKFFLTLPLTRAQTDLYVEMVGLVRPGDGVSYDVVQLYR*
Ga0099792_1048768113300009143Vadose Zone SoilTVPVAAFGKLFLTLPLARSQTDLYVEMVGLVRPGDGVSFDVVQLYR*
Ga0099792_1105923813300009143Vadose Zone SoilTLPLARSQTDLYVEPVALVRPGDPVNFDLVQLYR*
Ga0111538_1018696213300009156Populus RhizospherePVAAFGKFFLTLPLAHAQTDLYVEMVGLVRPGDGVSFDVVQLYR*
Ga0116223_1035288913300009839Peatlands SoilNLSRGESAMTNIPVAAFGKFFLTLPLMPSQTDLYVEIVGLVVPGDGTPDFETVQLYR*
Ga0126380_1017335433300010043Tropical Forest SoilAFAKLFLTLPLQPSQTDLYVELNGLVKPGDGSNFDMVQLYR*
Ga0126382_1078935913300010047Tropical Forest SoilPVAAFGKLFLTLPLARSQTDLYVEMVGLVRPGDGVSFDVVQLYR*
Ga0126382_1136833513300010047Tropical Forest SoilLFLTLPLGRSQTDLYVEMVGLVRPGDGVSFDVVQLYR*
Ga0134063_1009957833300010335Grasslands SoilGKFFLTLPLARAQTDLYVEMVGLVRPGDGVSYDVVQLFR*
Ga0126370_1094422333300010358Tropical Forest SoilPSMDDTQASVPVAAFGKFFLTLPLQQSQTDLYVELVGLVQPGDGVSFDVVQLYR*
Ga0126370_1188884423300010358Tropical Forest SoilAFAKLFLTLPLGSKTDLYVELVGLVRPGDGVSYDVVQLYR*
Ga0126376_1254981523300010359Tropical Forest SoilNVPVVAFGKFFLTLPLGRSQTDLYVEMVGLVRPGDGVSFDVVQLYR*
Ga0126372_1139206733300010360Tropical Forest SoilFLTLPLQGSQTDLYAELIGLVKPGDDSNFEMVQLYR*
Ga0126378_1049851643300010361Tropical Forest SoilFAKLFLTLPLGSKTDLYVELVGLVRPGDGVSYDVVQLYR*
Ga0126381_10413031913300010376Tropical Forest SoilLFLTLPLGSKTDLYVELVGLVRPGDGVSYDVVQLYR*
Ga0126383_1296709923300010398Tropical Forest SoilVAAFGKFFLTLPLAQSQTDLYVEMVGLVRPGDGVSFDVVQLYR*
Ga0137379_1100036613300012209Vadose Zone SoilPVAAFGKFFLTLPLARAQTDLYVEMVGLVRPGDGVSYDVVQLYR*
Ga0137371_1066987133300012356Vadose Zone SoilAFGKFFLTLPLVRGQTDLYVEMVGLVRPGDGVSYDVVQLYR*
Ga0137360_1080584113300012361Vadose Zone SoilQYNVPVADFSNPLLTLPSAQSQTDLYVELVGLVRPGDGVSFDVVQLYR*
Ga0137407_1101057713300012930Vadose Zone SoilVAAFGKLFLTLPLPQSQTDLYVELVGLVQPGDGVSYDVVQLYR*
Ga0126369_1106443613300012971Tropical Forest SoilFLTLPLQQSQTDLYVELVGLVQPGDGVSFDVVQLYR*
Ga0126369_1124897313300012971Tropical Forest SoilNVPVAAFGKLFLTLPLSRSQTDLYVEMAGLVQPGDGVSFDVVQLYR*
Ga0126369_1325759313300012971Tropical Forest SoilAFGKFFLTLPLGRSQTDLYVEMVGLVRPGDGVSFDVVQLYR*
Ga0120127_1016359113300013503PermafrostLFLALPLQRSQTDLYVETVGLVRPGDSVNYDMVQLYR*
Ga0132258_1247599813300015371Arabidopsis RhizosphereKFFLTLPLARSQTDLYVELVGLVRPGDGVSYDVVQLYR*
Ga0182041_1124939623300016294SoilLTLPLARSQTDLYVELVGLVRPGDGVSFDVVQLYR
Ga0182035_1016963943300016341SoilVQFKVPVAAFAKLFLTLPLGSQTDLYVEMVGLVHPGDGVSFDVVQLYR
Ga0182034_1058638133300016371SoilFFLTLPLERSQTDLYVEMVGLVRPGDGVSFDVVQLYR
Ga0182040_1032840413300016387SoilGEVQFKVPVAAFAKLFLTLPLGSQTDLYVEMVGLVHPGDGVSFDVVQLYR
Ga0182040_1128681713300016387SoilKLFLTLPLERSQTDLYVEMVGLVRPGDGVSYDVVQLYR
Ga0182038_1127594823300016445SoilLTLPLARSQTDLYVEMVGLVRPGDGVSFDVVQLYR
Ga0210407_1113536623300020579SoilPVAAFGKFFLTLPLQPPQTDLYVELVGLVQPGDGVSFDVVQLYR
Ga0126371_1164326813300021560Tropical Forest SoilPVAAFGKLFLTLPLARSQTDLYVELVGLVRPGDGVSFDVVQLYR
Ga0126371_1245582613300021560Tropical Forest SoilQVAAFGKFFLTLPLGRSQTDLYVEMVGLVRPGDGVSFDVVQLYR
Ga0126371_1274091323300021560Tropical Forest SoilFAKFFLTLPLERSQTDLYVEMVGLVRPGDGVSFDVIQLYR
Ga0126371_1300741823300021560Tropical Forest SoilPVAAFAKLFLTLPLERSQTDLYVEMVGLVRPGDGVSYDVVQLYR
Ga0126371_1368247713300021560Tropical Forest SoilAAFGKLFLTLPLERSQTDLYVEMVGLVRPGDGVSYDVVQLYR
Ga0207665_1052723613300025939Corn, Switchgrass And Miscanthus RhizosphereNIPVAAFGKLFLTLPLSRSQTDLYVELVDLVKPGDHVNLDLVQLYR
Ga0207641_1061857433300026088Switchgrass RhizosphereRTVRYSCPAFGKFFLTLPLARSQTDLYVELVGLVRPGDGVSYDVVQLYR
Ga0209055_115516313300026309SoilKLFLTLPLAQSQTDLYVELVGLVRPGDGVSFDVVQLYR
Ga0318534_1078810113300031544SoilPVAAFGKLFLALPLARSQTDLYVELVGLVRPGDGVSFDVVQLYR
Ga0318538_1043361223300031546SoilGKLFLTLPLERSQTDLYVEMVGLVRPGDGVSYDVVQLYR
Ga0318573_1028335413300031564SoilLEGEVQFNVPVAAFGKLFLTLPLERSQTDLYVEMVGLVRPGDGVSFDVVQLYR
Ga0318496_1063156813300031713SoilVQFKVPVAAFAKFFLTLPLERSQTDLYVEMVGLVRPGDGVSFDVVQLYR
Ga0318493_1017062413300031723SoilQFNVPVAAFGKLFLTLPLERSQTDLYVEMVGLVRPGDGVSFDVVQLYR
Ga0318500_1059852013300031724SoilLEGEEFKVPVAAFAKLFLTLPLGSKTDLYVELVGLVRPGDGVSYDVVQLYR
Ga0318501_1077447323300031736SoilLTLPLERSQTDLYVEMVGLVRPGDGVSFDVVQLYR
Ga0306918_1077466013300031744SoilEGEVQFKVPVAAFAKLFLTLPLGSKTDLYVELVGLVRPGDGVSYDVVQLYR
Ga0318537_1032451923300031763SoilVPVAAFGKLFLTLPLERSQTDLYVEMVGLVRPGDGVSFDVVQLYR
Ga0318535_1045024313300031764SoilLFLTLPLARSQTDLYVELVGLVRPGDGVSFDVVQLYR
Ga0318526_1012750913300031769SoilEQQYNVPVAAFGKLFLTLPLARSQTDLYVEMVGLVRPGDGVSFDVVQLYR
Ga0318546_1023930153300031771SoilVPVVAFAKLFLTLPLGSKTDLYVELVGLVRPGDGVSYDVVQLYR
Ga0318548_1029310133300031793SoilAFGKLFLTLPLERSQTDLYVEMVGLVRPGDGVSFDVVQLYR
Ga0318503_1024098023300031794SoilGEVQSTVAVAAFGKLFLTLPLARSQTDLYVEMVGLVRPGDGVSFDVVQLYR
Ga0318550_1031996023300031797SoilDYVVQFNVPVAAFGKLFLTLPLARSQTDLYVEMVGLVRPGDGVSFDVVQLYR
Ga0318567_1029053833300031821SoilQLEGEVQFKVPVAAFGKLFLTLPLERSQTDLYVEMVGLVRPGDGVSFDVVQLYR
Ga0318567_1077409423300031821SoilNVPVAAFGKLFLTLPLGRSQTDLYVEMVGLVRPGDGVSFDVVQLYR
Ga0310917_1066254523300031833SoilAKLFLTLPLGSKTDLYVELVGLVRPGDGVSYDVVQLYR
Ga0310917_1069410423300031833SoilEVQFNVPVAAFGKLFLTLPLERSQTDLYVEMVGLVRPGDGVSFDVVQLYR
Ga0306919_1027720133300031879SoilQSSVPVAAFGKLFLTLPLARSQTDLYVELVGLVRPGDGVSFDVVQLYR
Ga0306919_1084307423300031879SoilFLTLPLERSQTDLYVEMVGLVRPGDGVSYDVVQLYR
Ga0306919_1142499623300031879SoilAFAKLFLTLPLGSKTDLYVELVGLVRPGDGVSYDVVQLYR
Ga0318536_1062217423300031893SoilSTVPVAAFGKLFLTLPLARSQTDLYVELVGLVRPGDGVSFDVVQLYR
Ga0318520_1018225833300031897SoilKVPVAAFAKLFLTLPLGSQTDLYVEMVGLVRPGDGVSFDVVQLYR
Ga0318520_1021869313300031897SoilFNVPVAAFGKLFLTLPLERSQTDLYVEMVGLVRPGDGVSFDVVQLYR
Ga0318520_1064004213300031897SoilVPVAAFGKLFLTLPLARSQTDLYVEMVGLVRPGDGVSFDVVQLYR
Ga0306923_1099816033300031910SoilFKVPVAAFAKLFLTLPLGSKTDLYVELVGLVRPGDGVSYDVVQLYR
Ga0310916_1069570033300031942SoilFLTLPLARSQTDLYVELVGLVRPGDGVSFDVVQLYR
Ga0310909_1162170123300031947SoilVPSMDDTQASVPVAAFGKFFLTLPLQQSQTDLYVELVGLVQPGDGVSFDVVQLYR
Ga0318507_1031254223300032025SoilQLEGEVQFNVPVAAFGKLFLTLPLERSQTDLYVEMVGLVRPGDGVSFDVVQLYR
Ga0318549_1027786133300032041SoilPVAAFGKLFLTLPLARSQTDLYVEMVGLVRPGDGVSFDVVQLYR
Ga0318558_1053667213300032044SoilQLESEAQFNVPVAAFGKLFLTLPLARSQTDLYVELVGLVRPGDGVSFDVVQLYR
Ga0318570_1014380433300032054SoilQLEGEEFKVPVAAFAKLFLTLPLGSKTDLYVELVGLVRPGDGVSYDVVQLYR
Ga0318575_1058069413300032055SoilGKLFLTLPLARSQTDLYVELVGLVRPGDGVSFDVVQLYR
Ga0318514_1062234023300032066SoilLVGEVQSTVAVAAFGKLFLTLPLARSQTDLYVEMVGLVRPGDGVSFDVVQLYR
Ga0318553_1013771843300032068SoilQSEGEVQFKVPVAAFAKLFLTLPLGSKTDLYVELVGLVRPGDGVSYDVVQLYR
Ga0307470_1186017623300032174Hardwood Forest SoilFGKLFLTLPLQRSQTDLYVELVGLVRPSDDGNFEMVQLYR
Ga0306920_10042411543300032261SoilVAAFGKFFLTLPLARSQTDLYVELVGLVRPGDGVSFDVVQLYR
Ga0310914_1043159313300033289SoilFLTLPLGSKTDLYVELVGLVRPGDGVSYDVVQLYR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.