Basic Information | |
---|---|
Family ID | F097096 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 104 |
Average Sequence Length | 44 residues |
Representative Sequence | PVAAFGKLFLTLPLARSQTDLYVEMVGLVRPGDGVSFDVVQLYR |
Number of Associated Samples | 83 |
Number of Associated Scaffolds | 104 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 98.08 % |
Associated GOLD sequencing projects | 80 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (98.077 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (31.731 % of family members) |
Environment Ontology (ENVO) | Unclassified (42.308 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.885 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 11.36% β-sheet: 22.73% Coil/Unstructured: 65.91% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 104 Family Scaffolds |
---|---|---|
PF07811 | TadE | 86.54 |
PF04392 | ABC_sub_bind | 2.88 |
PF13701 | DDE_Tnp_1_4 | 0.96 |
PF12697 | Abhydrolase_6 | 0.96 |
COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
---|---|---|---|
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 2.88 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.08 % |
Unclassified | root | N/A | 1.92 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000597|AF_2010_repII_A1DRAFT_10075709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium nodulans | 848 | Open in IMG/M |
3300000655|AF_2010_repII_A100DRAFT_1064038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 650 | Open in IMG/M |
3300000793|AF_2010_repII_A001DRAFT_10038186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium nodulans | 1106 | Open in IMG/M |
3300000893|AP72_2010_repI_A001DRAFT_1027710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium nodulans | 899 | Open in IMG/M |
3300005363|Ga0008090_15598411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 669 | Open in IMG/M |
3300005447|Ga0066689_10444812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 813 | Open in IMG/M |
3300005558|Ga0066698_10183176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1428 | Open in IMG/M |
3300005558|Ga0066698_10273746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 1168 | Open in IMG/M |
3300005598|Ga0066706_10677198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 819 | Open in IMG/M |
3300005614|Ga0068856_101405558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 712 | Open in IMG/M |
3300005713|Ga0066905_102275062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 506 | Open in IMG/M |
3300005764|Ga0066903_100260467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2690 | Open in IMG/M |
3300005764|Ga0066903_101524043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 1263 | Open in IMG/M |
3300005764|Ga0066903_106341195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 617 | Open in IMG/M |
3300005764|Ga0066903_106372138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 616 | Open in IMG/M |
3300005764|Ga0066903_107582121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 559 | Open in IMG/M |
3300006028|Ga0070717_10472538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 1132 | Open in IMG/M |
3300006034|Ga0066656_10849793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 584 | Open in IMG/M |
3300006046|Ga0066652_101491831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 628 | Open in IMG/M |
3300006755|Ga0079222_10387975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 965 | Open in IMG/M |
3300006852|Ga0075433_10950791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 749 | Open in IMG/M |
3300006853|Ga0075420_101520651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 574 | Open in IMG/M |
3300006854|Ga0075425_100617585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 1247 | Open in IMG/M |
3300007076|Ga0075435_101501088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 591 | Open in IMG/M |
3300009012|Ga0066710_103756351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 570 | Open in IMG/M |
3300009137|Ga0066709_101624310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 923 | Open in IMG/M |
3300009143|Ga0099792_10487681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 770 | Open in IMG/M |
3300009143|Ga0099792_11059238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 544 | Open in IMG/M |
3300009156|Ga0111538_10186962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2630 | Open in IMG/M |
3300009839|Ga0116223_10352889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 871 | Open in IMG/M |
3300010043|Ga0126380_10173354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1412 | Open in IMG/M |
3300010047|Ga0126382_10789359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 808 | Open in IMG/M |
3300010047|Ga0126382_11368335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 644 | Open in IMG/M |
3300010335|Ga0134063_10099578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1318 | Open in IMG/M |
3300010358|Ga0126370_10944223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 782 | Open in IMG/M |
3300010358|Ga0126370_11888844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 580 | Open in IMG/M |
3300010359|Ga0126376_12549815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 559 | Open in IMG/M |
3300010360|Ga0126372_11392067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 734 | Open in IMG/M |
3300010361|Ga0126378_10498516 | All Organisms → cellular organisms → Bacteria | 1333 | Open in IMG/M |
3300010376|Ga0126381_104130319 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300010398|Ga0126383_12967099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 554 | Open in IMG/M |
3300012209|Ga0137379_11000366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 741 | Open in IMG/M |
3300012356|Ga0137371_10669871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 795 | Open in IMG/M |
3300012361|Ga0137360_10805841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 808 | Open in IMG/M |
3300012930|Ga0137407_11010577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 788 | Open in IMG/M |
3300012971|Ga0126369_11064436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 897 | Open in IMG/M |
3300012971|Ga0126369_11248973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 833 | Open in IMG/M |
3300012971|Ga0126369_13257593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 532 | Open in IMG/M |
3300013503|Ga0120127_10163591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 538 | Open in IMG/M |
3300015371|Ga0132258_12475998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1299 | Open in IMG/M |
3300016294|Ga0182041_11249396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 678 | Open in IMG/M |
3300016341|Ga0182035_10169639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1697 | Open in IMG/M |
3300016371|Ga0182034_10586381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium nodulans | 939 | Open in IMG/M |
3300016387|Ga0182040_10328404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1179 | Open in IMG/M |
3300016387|Ga0182040_11286817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 617 | Open in IMG/M |
3300016445|Ga0182038_11275948 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 656 | Open in IMG/M |
3300020579|Ga0210407_11135366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 591 | Open in IMG/M |
3300021560|Ga0126371_11643268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 768 | Open in IMG/M |
3300021560|Ga0126371_12455826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 631 | Open in IMG/M |
3300021560|Ga0126371_12740913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 597 | Open in IMG/M |
3300021560|Ga0126371_13007418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 571 | Open in IMG/M |
3300021560|Ga0126371_13682477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 517 | Open in IMG/M |
3300025939|Ga0207665_10527236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 915 | Open in IMG/M |
3300026088|Ga0207641_10618574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium nodulans | 1062 | Open in IMG/M |
3300026309|Ga0209055_1155163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 765 | Open in IMG/M |
3300031544|Ga0318534_10788101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 534 | Open in IMG/M |
3300031546|Ga0318538_10433612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 711 | Open in IMG/M |
3300031564|Ga0318573_10283354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 886 | Open in IMG/M |
3300031713|Ga0318496_10631568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 591 | Open in IMG/M |
3300031723|Ga0318493_10170624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1136 | Open in IMG/M |
3300031724|Ga0318500_10598520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 558 | Open in IMG/M |
3300031736|Ga0318501_10774473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 530 | Open in IMG/M |
3300031744|Ga0306918_10774660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 749 | Open in IMG/M |
3300031763|Ga0318537_10324519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 569 | Open in IMG/M |
3300031764|Ga0318535_10450243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 573 | Open in IMG/M |
3300031769|Ga0318526_10127509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium nodulans | 1028 | Open in IMG/M |
3300031771|Ga0318546_10239301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1247 | Open in IMG/M |
3300031793|Ga0318548_10293101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 799 | Open in IMG/M |
3300031794|Ga0318503_10240980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 587 | Open in IMG/M |
3300031797|Ga0318550_10319960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 752 | Open in IMG/M |
3300031821|Ga0318567_10290538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium nodulans | 921 | Open in IMG/M |
3300031821|Ga0318567_10774094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 544 | Open in IMG/M |
3300031833|Ga0310917_10662545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 707 | Open in IMG/M |
3300031833|Ga0310917_10694104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 689 | Open in IMG/M |
3300031879|Ga0306919_10277201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1267 | Open in IMG/M |
3300031879|Ga0306919_10843074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 703 | Open in IMG/M |
3300031879|Ga0306919_11424996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 522 | Open in IMG/M |
3300031893|Ga0318536_10622174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 539 | Open in IMG/M |
3300031897|Ga0318520_10182258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1232 | Open in IMG/M |
3300031897|Ga0318520_10218693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1129 | Open in IMG/M |
3300031897|Ga0318520_10640042 | Not Available | 662 | Open in IMG/M |
3300031910|Ga0306923_10998160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 909 | Open in IMG/M |
3300031942|Ga0310916_10695700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium nodulans | 860 | Open in IMG/M |
3300031947|Ga0310909_11621701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 512 | Open in IMG/M |
3300032025|Ga0318507_10312542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 684 | Open in IMG/M |
3300032041|Ga0318549_10277861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 754 | Open in IMG/M |
3300032044|Ga0318558_10536672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 584 | Open in IMG/M |
3300032054|Ga0318570_10143804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1064 | Open in IMG/M |
3300032055|Ga0318575_10580694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 568 | Open in IMG/M |
3300032066|Ga0318514_10622340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 575 | Open in IMG/M |
3300032068|Ga0318553_10137718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1260 | Open in IMG/M |
3300032174|Ga0307470_11860176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 511 | Open in IMG/M |
3300032261|Ga0306920_100424115 | Not Available | 1977 | Open in IMG/M |
3300033289|Ga0310914_10431593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1192 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 31.73% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 17.31% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.54% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.73% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.77% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.77% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.81% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.85% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.92% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.92% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.96% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.96% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.96% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.96% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.96% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.96% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.96% |
Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.96% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
3300000893 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001 | Environmental | Open in IMG/M |
3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013503 | Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
AF_2010_repII_A1DRAFT_100757093 | 3300000597 | Forest Soil | FFLTLPLQRSQTDLYVELVGLVQPGDGVSFDVVQLYR* |
AF_2010_repII_A100DRAFT_10640381 | 3300000655 | Forest Soil | PVAAFGKFFLTLPLGRSQTDLYVEMVGLVRPGDGVSYDVVQLYR* |
AF_2010_repII_A001DRAFT_100381861 | 3300000793 | Forest Soil | KFFLTLPLGRSQTDLYVEMVGLVRPGDGVSFDVVQLYR* |
AP72_2010_repI_A001DRAFT_10277103 | 3300000893 | Forest Soil | QAHVPVAAFGKFFLTLPLQQSQTDLYVELVGLVQPGDGVSFDVVQLYR* |
Ga0008090_155984112 | 3300005363 | Tropical Rainforest Soil | GKFFLTLPLARAQTDLYVEMVGLVRPGDGVSYDVVQLYR* |
Ga0066689_104448123 | 3300005447 | Soil | QSNIPVAAFGKLFLTLPLAQSQTDLYVELVGLVQPGDGVSYDVVQLYR* |
Ga0066698_101831761 | 3300005558 | Soil | AFGKFFLTLPLARAQTDLYVEMVGLVRPGDGVSYDVVQLYR* |
Ga0066698_102737463 | 3300005558 | Soil | AFGKLFLTLPLQRSQTDLYAELIGLVKPGDDGNFDMVQLYR* |
Ga0066706_106771983 | 3300005598 | Soil | TLPLAQSQTDLYVELVGLVQPGDGVSYDVVQLYR* |
Ga0068856_1014055581 | 3300005614 | Corn Rhizosphere | FLTLPLQRSQTDLYVEALGFVTPGDIVNYDMVQLYR* |
Ga0066905_1022750621 | 3300005713 | Tropical Forest Soil | AAFGKLFLTLPLARSQTDLYVELVGLVRPGDGVSFDVVQLYR* |
Ga0066903_1002604671 | 3300005764 | Tropical Forest Soil | TQSDIPVAAFGKFFLTLPLSRSQTDLYVELVGLVRPGDGVSYDVVQLYR* |
Ga0066903_1015240431 | 3300005764 | Tropical Forest Soil | QFNVPVAAFGKLFLTLPLARSQTDLYVELVGLVRPGDGVSFDVVQLYR* |
Ga0066903_1063411951 | 3300005764 | Tropical Forest Soil | QSNVPVAAFGKLFLTLPLSRSQTDLYVEMAGLVQPGDGVSFDVVQLYR* |
Ga0066903_1063721381 | 3300005764 | Tropical Forest Soil | PVAAFGKFFLTLPLAPAQSDLYVEMIGLVRPGDGVSFDVIQLYR* |
Ga0066903_1075821211 | 3300005764 | Tropical Forest Soil | PVAAFGKLFLTLPLERSQTDLYVEMVGLVRPGDGVSYDVVQLYR* |
Ga0070717_104725381 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | FLTLPLARSQTDLYVELVGLVRPGDGVSYDVVQLYR* |
Ga0066656_108497932 | 3300006034 | Soil | FLTLPLAQSQTDLYVELVGLVRPGDGVSFDVVQLYR* |
Ga0066652_1014918312 | 3300006046 | Soil | VAAFGKFFLTLPLSRAQTDLYVELVGLVRPGDGVSYDVVQLYR* |
Ga0079222_103879753 | 3300006755 | Agricultural Soil | PVAAFGKLFLTLPLGRSQTDLYVEMVGLVRPGDGVSFDVVQLYR* |
Ga0075433_109507913 | 3300006852 | Populus Rhizosphere | FLTLPLARSQTDLYVEMVGLVRPGDGVSFDVVQLYR* |
Ga0075420_1015206511 | 3300006853 | Populus Rhizosphere | PVAAFGKFFLTLPLARAQTDLYVEMVGLVRPGDGVSFDVVQLYR* |
Ga0075425_1006175853 | 3300006854 | Populus Rhizosphere | AAFGKLFLTLPLAQSQTDLYVELVGLVRPGDGVSFDVVQLYR* |
Ga0075435_1015010882 | 3300007076 | Populus Rhizosphere | KFFLTLPLAHAQTDLYVEMVGLVRPGDGVSFDVVQLYR* |
Ga0066710_1037563511 | 3300009012 | Grasslands Soil | VAAFGKFFLTLPLSRAQTDLYVELVGLVRPGDGVSYDVVQLYR |
Ga0066709_1016243103 | 3300009137 | Grasslands Soil | LDGEAQSNVPVAAFSKFFLTLPLTRAQTDLYVEMVGLVRPGDGVSYDVVQLYR* |
Ga0099792_104876811 | 3300009143 | Vadose Zone Soil | TVPVAAFGKLFLTLPLARSQTDLYVEMVGLVRPGDGVSFDVVQLYR* |
Ga0099792_110592381 | 3300009143 | Vadose Zone Soil | TLPLARSQTDLYVEPVALVRPGDPVNFDLVQLYR* |
Ga0111538_101869621 | 3300009156 | Populus Rhizosphere | PVAAFGKFFLTLPLAHAQTDLYVEMVGLVRPGDGVSFDVVQLYR* |
Ga0116223_103528891 | 3300009839 | Peatlands Soil | NLSRGESAMTNIPVAAFGKFFLTLPLMPSQTDLYVEIVGLVVPGDGTPDFETVQLYR* |
Ga0126380_101733543 | 3300010043 | Tropical Forest Soil | AFAKLFLTLPLQPSQTDLYVELNGLVKPGDGSNFDMVQLYR* |
Ga0126382_107893591 | 3300010047 | Tropical Forest Soil | PVAAFGKLFLTLPLARSQTDLYVEMVGLVRPGDGVSFDVVQLYR* |
Ga0126382_113683351 | 3300010047 | Tropical Forest Soil | LFLTLPLGRSQTDLYVEMVGLVRPGDGVSFDVVQLYR* |
Ga0134063_100995783 | 3300010335 | Grasslands Soil | GKFFLTLPLARAQTDLYVEMVGLVRPGDGVSYDVVQLFR* |
Ga0126370_109442233 | 3300010358 | Tropical Forest Soil | PSMDDTQASVPVAAFGKFFLTLPLQQSQTDLYVELVGLVQPGDGVSFDVVQLYR* |
Ga0126370_118888442 | 3300010358 | Tropical Forest Soil | AFAKLFLTLPLGSKTDLYVELVGLVRPGDGVSYDVVQLYR* |
Ga0126376_125498152 | 3300010359 | Tropical Forest Soil | NVPVVAFGKFFLTLPLGRSQTDLYVEMVGLVRPGDGVSFDVVQLYR* |
Ga0126372_113920673 | 3300010360 | Tropical Forest Soil | FLTLPLQGSQTDLYAELIGLVKPGDDSNFEMVQLYR* |
Ga0126378_104985164 | 3300010361 | Tropical Forest Soil | FAKLFLTLPLGSKTDLYVELVGLVRPGDGVSYDVVQLYR* |
Ga0126381_1041303191 | 3300010376 | Tropical Forest Soil | LFLTLPLGSKTDLYVELVGLVRPGDGVSYDVVQLYR* |
Ga0126383_129670992 | 3300010398 | Tropical Forest Soil | VAAFGKFFLTLPLAQSQTDLYVEMVGLVRPGDGVSFDVVQLYR* |
Ga0137379_110003661 | 3300012209 | Vadose Zone Soil | PVAAFGKFFLTLPLARAQTDLYVEMVGLVRPGDGVSYDVVQLYR* |
Ga0137371_106698713 | 3300012356 | Vadose Zone Soil | AFGKFFLTLPLVRGQTDLYVEMVGLVRPGDGVSYDVVQLYR* |
Ga0137360_108058411 | 3300012361 | Vadose Zone Soil | QYNVPVADFSNPLLTLPSAQSQTDLYVELVGLVRPGDGVSFDVVQLYR* |
Ga0137407_110105771 | 3300012930 | Vadose Zone Soil | VAAFGKLFLTLPLPQSQTDLYVELVGLVQPGDGVSYDVVQLYR* |
Ga0126369_110644361 | 3300012971 | Tropical Forest Soil | FLTLPLQQSQTDLYVELVGLVQPGDGVSFDVVQLYR* |
Ga0126369_112489731 | 3300012971 | Tropical Forest Soil | NVPVAAFGKLFLTLPLSRSQTDLYVEMAGLVQPGDGVSFDVVQLYR* |
Ga0126369_132575931 | 3300012971 | Tropical Forest Soil | AFGKFFLTLPLGRSQTDLYVEMVGLVRPGDGVSFDVVQLYR* |
Ga0120127_101635911 | 3300013503 | Permafrost | LFLALPLQRSQTDLYVETVGLVRPGDSVNYDMVQLYR* |
Ga0132258_124759981 | 3300015371 | Arabidopsis Rhizosphere | KFFLTLPLARSQTDLYVELVGLVRPGDGVSYDVVQLYR* |
Ga0182041_112493962 | 3300016294 | Soil | LTLPLARSQTDLYVELVGLVRPGDGVSFDVVQLYR |
Ga0182035_101696394 | 3300016341 | Soil | VQFKVPVAAFAKLFLTLPLGSQTDLYVEMVGLVHPGDGVSFDVVQLYR |
Ga0182034_105863813 | 3300016371 | Soil | FFLTLPLERSQTDLYVEMVGLVRPGDGVSFDVVQLYR |
Ga0182040_103284041 | 3300016387 | Soil | GEVQFKVPVAAFAKLFLTLPLGSQTDLYVEMVGLVHPGDGVSFDVVQLYR |
Ga0182040_112868171 | 3300016387 | Soil | KLFLTLPLERSQTDLYVEMVGLVRPGDGVSYDVVQLYR |
Ga0182038_112759482 | 3300016445 | Soil | LTLPLARSQTDLYVEMVGLVRPGDGVSFDVVQLYR |
Ga0210407_111353662 | 3300020579 | Soil | PVAAFGKFFLTLPLQPPQTDLYVELVGLVQPGDGVSFDVVQLYR |
Ga0126371_116432681 | 3300021560 | Tropical Forest Soil | PVAAFGKLFLTLPLARSQTDLYVELVGLVRPGDGVSFDVVQLYR |
Ga0126371_124558261 | 3300021560 | Tropical Forest Soil | QVAAFGKFFLTLPLGRSQTDLYVEMVGLVRPGDGVSFDVVQLYR |
Ga0126371_127409132 | 3300021560 | Tropical Forest Soil | FAKFFLTLPLERSQTDLYVEMVGLVRPGDGVSFDVIQLYR |
Ga0126371_130074182 | 3300021560 | Tropical Forest Soil | PVAAFAKLFLTLPLERSQTDLYVEMVGLVRPGDGVSYDVVQLYR |
Ga0126371_136824771 | 3300021560 | Tropical Forest Soil | AAFGKLFLTLPLERSQTDLYVEMVGLVRPGDGVSYDVVQLYR |
Ga0207665_105272361 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | NIPVAAFGKLFLTLPLSRSQTDLYVELVDLVKPGDHVNLDLVQLYR |
Ga0207641_106185743 | 3300026088 | Switchgrass Rhizosphere | RTVRYSCPAFGKFFLTLPLARSQTDLYVELVGLVRPGDGVSYDVVQLYR |
Ga0209055_11551631 | 3300026309 | Soil | KLFLTLPLAQSQTDLYVELVGLVRPGDGVSFDVVQLYR |
Ga0318534_107881011 | 3300031544 | Soil | PVAAFGKLFLALPLARSQTDLYVELVGLVRPGDGVSFDVVQLYR |
Ga0318538_104336122 | 3300031546 | Soil | GKLFLTLPLERSQTDLYVEMVGLVRPGDGVSYDVVQLYR |
Ga0318573_102833541 | 3300031564 | Soil | LEGEVQFNVPVAAFGKLFLTLPLERSQTDLYVEMVGLVRPGDGVSFDVVQLYR |
Ga0318496_106315681 | 3300031713 | Soil | VQFKVPVAAFAKFFLTLPLERSQTDLYVEMVGLVRPGDGVSFDVVQLYR |
Ga0318493_101706241 | 3300031723 | Soil | QFNVPVAAFGKLFLTLPLERSQTDLYVEMVGLVRPGDGVSFDVVQLYR |
Ga0318500_105985201 | 3300031724 | Soil | LEGEEFKVPVAAFAKLFLTLPLGSKTDLYVELVGLVRPGDGVSYDVVQLYR |
Ga0318501_107744732 | 3300031736 | Soil | LTLPLERSQTDLYVEMVGLVRPGDGVSFDVVQLYR |
Ga0306918_107746601 | 3300031744 | Soil | EGEVQFKVPVAAFAKLFLTLPLGSKTDLYVELVGLVRPGDGVSYDVVQLYR |
Ga0318537_103245192 | 3300031763 | Soil | VPVAAFGKLFLTLPLERSQTDLYVEMVGLVRPGDGVSFDVVQLYR |
Ga0318535_104502431 | 3300031764 | Soil | LFLTLPLARSQTDLYVELVGLVRPGDGVSFDVVQLYR |
Ga0318526_101275091 | 3300031769 | Soil | EQQYNVPVAAFGKLFLTLPLARSQTDLYVEMVGLVRPGDGVSFDVVQLYR |
Ga0318546_102393015 | 3300031771 | Soil | VPVVAFAKLFLTLPLGSKTDLYVELVGLVRPGDGVSYDVVQLYR |
Ga0318548_102931013 | 3300031793 | Soil | AFGKLFLTLPLERSQTDLYVEMVGLVRPGDGVSFDVVQLYR |
Ga0318503_102409802 | 3300031794 | Soil | GEVQSTVAVAAFGKLFLTLPLARSQTDLYVEMVGLVRPGDGVSFDVVQLYR |
Ga0318550_103199602 | 3300031797 | Soil | DYVVQFNVPVAAFGKLFLTLPLARSQTDLYVEMVGLVRPGDGVSFDVVQLYR |
Ga0318567_102905383 | 3300031821 | Soil | QLEGEVQFKVPVAAFGKLFLTLPLERSQTDLYVEMVGLVRPGDGVSFDVVQLYR |
Ga0318567_107740942 | 3300031821 | Soil | NVPVAAFGKLFLTLPLGRSQTDLYVEMVGLVRPGDGVSFDVVQLYR |
Ga0310917_106625452 | 3300031833 | Soil | AKLFLTLPLGSKTDLYVELVGLVRPGDGVSYDVVQLYR |
Ga0310917_106941042 | 3300031833 | Soil | EVQFNVPVAAFGKLFLTLPLERSQTDLYVEMVGLVRPGDGVSFDVVQLYR |
Ga0306919_102772013 | 3300031879 | Soil | QSSVPVAAFGKLFLTLPLARSQTDLYVELVGLVRPGDGVSFDVVQLYR |
Ga0306919_108430742 | 3300031879 | Soil | FLTLPLERSQTDLYVEMVGLVRPGDGVSYDVVQLYR |
Ga0306919_114249962 | 3300031879 | Soil | AFAKLFLTLPLGSKTDLYVELVGLVRPGDGVSYDVVQLYR |
Ga0318536_106221742 | 3300031893 | Soil | STVPVAAFGKLFLTLPLARSQTDLYVELVGLVRPGDGVSFDVVQLYR |
Ga0318520_101822583 | 3300031897 | Soil | KVPVAAFAKLFLTLPLGSQTDLYVEMVGLVRPGDGVSFDVVQLYR |
Ga0318520_102186931 | 3300031897 | Soil | FNVPVAAFGKLFLTLPLERSQTDLYVEMVGLVRPGDGVSFDVVQLYR |
Ga0318520_106400421 | 3300031897 | Soil | VPVAAFGKLFLTLPLARSQTDLYVEMVGLVRPGDGVSFDVVQLYR |
Ga0306923_109981603 | 3300031910 | Soil | FKVPVAAFAKLFLTLPLGSKTDLYVELVGLVRPGDGVSYDVVQLYR |
Ga0310916_106957003 | 3300031942 | Soil | FLTLPLARSQTDLYVELVGLVRPGDGVSFDVVQLYR |
Ga0310909_116217012 | 3300031947 | Soil | VPSMDDTQASVPVAAFGKFFLTLPLQQSQTDLYVELVGLVQPGDGVSFDVVQLYR |
Ga0318507_103125422 | 3300032025 | Soil | QLEGEVQFNVPVAAFGKLFLTLPLERSQTDLYVEMVGLVRPGDGVSFDVVQLYR |
Ga0318549_102778613 | 3300032041 | Soil | PVAAFGKLFLTLPLARSQTDLYVEMVGLVRPGDGVSFDVVQLYR |
Ga0318558_105366721 | 3300032044 | Soil | QLESEAQFNVPVAAFGKLFLTLPLARSQTDLYVELVGLVRPGDGVSFDVVQLYR |
Ga0318570_101438043 | 3300032054 | Soil | QLEGEEFKVPVAAFAKLFLTLPLGSKTDLYVELVGLVRPGDGVSYDVVQLYR |
Ga0318575_105806941 | 3300032055 | Soil | GKLFLTLPLARSQTDLYVELVGLVRPGDGVSFDVVQLYR |
Ga0318514_106223402 | 3300032066 | Soil | LVGEVQSTVAVAAFGKLFLTLPLARSQTDLYVEMVGLVRPGDGVSFDVVQLYR |
Ga0318553_101377184 | 3300032068 | Soil | QSEGEVQFKVPVAAFAKLFLTLPLGSKTDLYVELVGLVRPGDGVSYDVVQLYR |
Ga0307470_118601762 | 3300032174 | Hardwood Forest Soil | FGKLFLTLPLQRSQTDLYVELVGLVRPSDDGNFEMVQLYR |
Ga0306920_1004241154 | 3300032261 | Soil | VAAFGKFFLTLPLARSQTDLYVELVGLVRPGDGVSFDVVQLYR |
Ga0310914_104315931 | 3300033289 | Soil | FLTLPLGSKTDLYVELVGLVRPGDGVSYDVVQLYR |
⦗Top⦘ |