NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F097254

Metagenome Family F097254

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F097254
Family Type Metagenome
Number of Sequences 104
Average Sequence Length 71 residues
Representative Sequence MSEQDVTAYEELLPAIERGRLNRHESRDMYAIFNRTFNANERPCNCTGKNKSMVEKLQRAYEYTCKP
Number of Associated Samples 83
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Viruses
% of genes with valid RBS motifs 25.96 %
% of genes near scaffold ends (potentially truncated) 68.27 %
% of genes from short scaffolds (< 2000 bps) 82.69 %
Associated GOLD sequencing projects 68
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group unclassified viruses (55.769 % of family members)
NCBI Taxonomy ID 12429
Taxonomy All Organisms → Viruses → unclassified viruses

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(43.269 % of family members)
Environment Ontology (ENVO) Unclassified
(67.308 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(94.231 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 65.67%    β-sheet: 0.00%    Coil/Unstructured: 34.33%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF05766NinG 11.54
PF00145DNA_methylase 8.65
PF02195ParBc 4.81
PF13508Acetyltransf_7 2.88
PF04466Terminase_3 1.92
PF08291Peptidase_M15_3 0.96
PF02954HTH_8 0.96
PF00583Acetyltransf_1 0.96
PF13443HTH_26 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG0270DNA-cytosine methylaseReplication, recombination and repair [L] 8.65
COG1783Phage terminase large subunitMobilome: prophages, transposons [X] 1.92

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms69.23 %
UnclassifiedrootN/A30.77 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10266780All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.529Open in IMG/M
3300002930|Water_100132All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.17473Open in IMG/M
3300002930|Water_100365All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.10059Open in IMG/M
3300002930|Water_101975All Organisms → Viruses → Predicted Viral3662Open in IMG/M
3300006026|Ga0075478_10249901All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.532Open in IMG/M
3300006027|Ga0075462_10200222Not Available601Open in IMG/M
3300006637|Ga0075461_10036513All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1610Open in IMG/M
3300006734|Ga0098073_1011755All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1455Open in IMG/M
3300006789|Ga0098054_1158385All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.834Open in IMG/M
3300006802|Ga0070749_10381802All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.779Open in IMG/M
3300006869|Ga0075477_10333125All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.598Open in IMG/M
3300006874|Ga0075475_10380041All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.571Open in IMG/M
3300006916|Ga0070750_10166666All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.990Open in IMG/M
3300006916|Ga0070750_10238583All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.793Open in IMG/M
3300006916|Ga0070750_10387607Not Available585Open in IMG/M
3300006916|Ga0070750_10487882All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.506Open in IMG/M
3300006919|Ga0070746_10059182All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1980Open in IMG/M
3300006920|Ga0070748_1264862Not Available616Open in IMG/M
3300006920|Ga0070748_1305206Not Available565Open in IMG/M
3300006924|Ga0098051_1127781All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.676Open in IMG/M
3300007229|Ga0075468_10182967All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.619Open in IMG/M
3300007231|Ga0075469_10108479All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.775Open in IMG/M
3300007236|Ga0075463_10052733All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1315Open in IMG/M
3300007276|Ga0070747_1113024All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.995Open in IMG/M
3300007344|Ga0070745_1149483Not Available886Open in IMG/M
3300007344|Ga0070745_1245175All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.649Open in IMG/M
3300007345|Ga0070752_1189298All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.826Open in IMG/M
3300007346|Ga0070753_1243136Not Available655Open in IMG/M
3300007539|Ga0099849_1291075Not Available591Open in IMG/M
3300007540|Ga0099847_1080757All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1001Open in IMG/M
3300007540|Ga0099847_1087281All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.957Open in IMG/M
3300008012|Ga0075480_10178086All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1137Open in IMG/M
3300008012|Ga0075480_10226964Not Available975Open in IMG/M
3300009026|Ga0102829_1106842All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.876Open in IMG/M
3300009071|Ga0115566_10437236All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.749Open in IMG/M
3300009435|Ga0115546_1019568All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.2889Open in IMG/M
3300009476|Ga0115555_1217959All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.782Open in IMG/M
3300009495|Ga0115571_1027423All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2821Open in IMG/M
3300009496|Ga0115570_10040039All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.2575Open in IMG/M
3300009497|Ga0115569_10019755All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes4166Open in IMG/M
3300009507|Ga0115572_10292785Not Available924Open in IMG/M
3300013010|Ga0129327_10051145All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.2065Open in IMG/M
3300017697|Ga0180120_10089064All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1351Open in IMG/M
3300017697|Ga0180120_10314006All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.625Open in IMG/M
3300017727|Ga0181401_1044886All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1226Open in IMG/M
3300017753|Ga0181407_1044261All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1174Open in IMG/M
3300017782|Ga0181380_1006022All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.4865Open in IMG/M
3300017824|Ga0181552_10210396Not Available999Open in IMG/M
3300017950|Ga0181607_10694424All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.529Open in IMG/M
3300017951|Ga0181577_10296789All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1050Open in IMG/M
3300017951|Ga0181577_10426048Not Available840Open in IMG/M
3300017963|Ga0180437_10249976All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1369Open in IMG/M
3300018048|Ga0181606_10201384Not Available1156Open in IMG/M
3300018080|Ga0180433_10766103All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.714Open in IMG/M
3300018413|Ga0181560_10311594All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.735Open in IMG/M
3300018415|Ga0181559_10117785Not Available1600Open in IMG/M
3300018415|Ga0181559_10342859All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.827Open in IMG/M
3300018416|Ga0181553_10451408All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.692Open in IMG/M
3300018417|Ga0181558_10289315Not Available899Open in IMG/M
3300018420|Ga0181563_10430291Not Available749Open in IMG/M
3300020169|Ga0206127_1302007Not Available532Open in IMG/M
3300020176|Ga0181556_1133265Not Available1053Open in IMG/M
3300020176|Ga0181556_1224698Not Available695Open in IMG/M
3300020187|Ga0206130_10080666All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.2035Open in IMG/M
3300021364|Ga0213859_10533664All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.507Open in IMG/M
3300021371|Ga0213863_10095393All Organisms → cellular organisms → Bacteria1433Open in IMG/M
3300021373|Ga0213865_10008863All Organisms → Viruses5831Open in IMG/M
3300021373|Ga0213865_10392557All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.619Open in IMG/M
3300021379|Ga0213864_10324541All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.781Open in IMG/M
3300021957|Ga0222717_10371381All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.798Open in IMG/M
3300021957|Ga0222717_10596867All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.580Open in IMG/M
3300021957|Ga0222717_10626242All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon560Open in IMG/M
3300021959|Ga0222716_10246135All Organisms → Viruses → Predicted Viral1106Open in IMG/M
3300021960|Ga0222715_10231393All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1087Open in IMG/M
3300022168|Ga0212027_1036498Not Available641Open in IMG/M
3300022169|Ga0196903_1012117All Organisms → cellular organisms → Bacteria1065Open in IMG/M
3300022178|Ga0196887_1005757All Organisms → Viruses4383Open in IMG/M
3300022183|Ga0196891_1070965Not Available621Open in IMG/M
3300022220|Ga0224513_10035294All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1844Open in IMG/M
3300022929|Ga0255752_10398536Not Available543Open in IMG/M
3300023116|Ga0255751_10226815Not Available1025Open in IMG/M
3300025543|Ga0208303_1091983Not Available654Open in IMG/M
3300025610|Ga0208149_1096740All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.712Open in IMG/M
3300025630|Ga0208004_1014535All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.2555Open in IMG/M
3300025645|Ga0208643_1087055All Organisms → cellular organisms → Bacteria879Open in IMG/M
3300025652|Ga0208134_1180281All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.507Open in IMG/M
3300025671|Ga0208898_1090850Not Available954Open in IMG/M
3300025759|Ga0208899_1007733All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.6273Open in IMG/M
3300025809|Ga0209199_1164586Not Available811Open in IMG/M
3300025840|Ga0208917_1244816All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.577Open in IMG/M
3300025853|Ga0208645_1096814Not Available1232Open in IMG/M
3300025876|Ga0209223_10119723Not Available1402Open in IMG/M
3300025889|Ga0208644_1055329All Organisms → Viruses → Predicted Viral2171Open in IMG/M
3300025889|Ga0208644_1080363All Organisms → cellular organisms → Bacteria1671Open in IMG/M
3300025889|Ga0208644_1163167All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1007Open in IMG/M
3300025889|Ga0208644_1187301Not Available911Open in IMG/M
3300027315|Ga0208949_1004846All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.3440Open in IMG/M
3300027315|Ga0208949_1019516Not Available1387Open in IMG/M
3300027406|Ga0208965_1084583All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.644Open in IMG/M
3300027572|Ga0208964_1017760Not Available1904Open in IMG/M
3300032277|Ga0316202_10010876All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.4693Open in IMG/M
3300032277|Ga0316202_10017995All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.3491Open in IMG/M
3300034374|Ga0348335_121274Not Available774Open in IMG/M
3300034418|Ga0348337_189501Not Available526Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous43.27%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh14.42%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine7.69%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater4.81%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water4.81%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine3.85%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine2.88%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient2.88%
Estuary WaterEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuary Water2.88%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater2.88%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat1.92%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater1.92%
Hypersaline Lake SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment1.92%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.96%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.96%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.96%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300002930Estuary water microbial communities from Pearl Estuary, Zhujiang, ChinaEnvironmentalOpen in IMG/M
3300006026Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006637Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNAEnvironmentalOpen in IMG/M
3300006734Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006869Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006874Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300007229Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300007231Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007236Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007344Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4EnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300008012Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300009026Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009435Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413EnvironmentalOpen in IMG/M
3300009476Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407EnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009496Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524EnvironmentalOpen in IMG/M
3300009497Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503EnvironmentalOpen in IMG/M
3300009507Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607EnvironmentalOpen in IMG/M
3300013010Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNAEnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017727Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20EnvironmentalOpen in IMG/M
3300017753Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017824Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017950Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017963Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaGEnvironmentalOpen in IMG/M
3300018048Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018080Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaGEnvironmentalOpen in IMG/M
3300018413Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018415Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018416Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018417Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020169Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1EnvironmentalOpen in IMG/M
3300020176Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011505AT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020187Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1EnvironmentalOpen in IMG/M
3300021364Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304EnvironmentalOpen in IMG/M
3300021371Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497EnvironmentalOpen in IMG/M
3300021373Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282EnvironmentalOpen in IMG/M
3300021379Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300022168Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v2)EnvironmentalOpen in IMG/M
3300022169Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022178Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3)EnvironmentalOpen in IMG/M
3300022183Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3)EnvironmentalOpen in IMG/M
3300022220Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_21EnvironmentalOpen in IMG/M
3300022929Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaGEnvironmentalOpen in IMG/M
3300023116Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaGEnvironmentalOpen in IMG/M
3300025543Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025610Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025630Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025645Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes)EnvironmentalOpen in IMG/M
3300025652Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes)EnvironmentalOpen in IMG/M
3300025671Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025809Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes)EnvironmentalOpen in IMG/M
3300025840Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025853Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)EnvironmentalOpen in IMG/M
3300025876Pelagic Microbial community sample from North Sea - COGITO 998_met_06 (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300027315Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_03_M0_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027406Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_07_M0_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027572Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_08_M0_20 (SPAdes)EnvironmentalOpen in IMG/M
3300032277Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotiteEnvironmentalOpen in IMG/M
3300034374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4)EnvironmentalOpen in IMG/M
3300034418Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1026678013300000101MarineERQKKLNELFPGRGVAMSEEDVPLFEELLPSIEKGRLTRPESKKMYAIYNRTFNANAKPCNCTGKNQRMVTKLQQAYEHRCKI*
Water_100132223300002930Estuary WaterMDPTDVTAFEELLPAIKSGRLNRAESRTMYDIFNRTFNAKERPCSCTGKNKRMVDQLQRAYEYSCR*
Water_100365113300002930Estuary WaterMSEEDVPLFEELLPSIEKGRLTRPESKKMYAIYNRTFNANAKPCNCTGKNQRMVTKLQQAYEHRCKI*
Water_10197553300002930Estuary WaterMFPGRNVEMDAHDVTAFEELLPAIERGRLNRSQSRTMYDIFNRTFNAKEKPCNCTGKNKRMVEKLQRAYEFSCR*
Ga0075478_1024990113300006026AqueousMSEEDVTAYEELLPAIQRGRLNRHESRDMYAIFNRTFNANERPCNCTGKNKSMVEKLQRAYEYTCKP*
Ga0075462_1020022213300006027AqueousEQDVTAYEELLPAIESGRLNRHQSRDMYAIFNRTFNANERPCNCTGKNKSMVEKLQRAYEYTCKP*
Ga0075461_1003651343300006637AqueousMSEQDVTAYEELLPAIESGRLNRHQSRDMYAIFNRTFNANERPCNCTGKNKSMVEKLQRAYEYTCKP*
Ga0098073_101175513300006734MarineGLKEARDRGKLNRQEGKTMYQIFNRTFNANEKPCSCTGKNRQMVEKLERAYEFSCR*
Ga0098054_115838523300006789MarineMSEADVPLFEELLPSIERGRLSRPESKKMYAIYNRTFNANAKPCNCTGKNQRMVTKLQQAYEHRCKI*
Ga0070749_1038180223300006802AqueousMSEADVTAYEEMLPSIEYSKKSGTRLSRAQWRDIYGIFNRTFNANERPCNCTGKNKSMVEKLQRAYEYTCKP*
Ga0075477_1033312523300006869AqueousVKDCGCEERRAKLNAIFPGRNVEMAEEDFQAFGELLPSIEDSKKSGARLSRAQWRDIYGIFNRTFNANERPCNCTGKN
Ga0075475_1038004123300006874AqueousVEMSEEDVTAYEELLPAIERGRLNRHESRDMYAIFNRTFNANERPCNCTGKNKSMVEKLQRAYEYSCSK*
Ga0070750_1016666613300006916AqueousMAAEDFQAFGELLPSIEDSKKSGARLSRAQWRDIYGIFNRTFNANERPCNCTGKNKSMVEKLQRAYEYTCKP*
Ga0070750_1023858323300006916AqueousMSEQDVTAYEELLPSIEDSKKSGRRLSRAQWRDIYGIFNRTFNANERPCNCTGKNKSMVEKLQRAYEYTCKI*
Ga0070750_1038760733300006916AqueousLPSIEYSKKSGTRLSRAQWRDIYGIFNRTFNANERPCNCTGKNKSMVEKLQRAYEYTCKP
Ga0070750_1048788213300006916AqueousMAEEDFQAFGELLPAIEDSKKSGARLSRAQWRDIYGIFNRTFNANESPCNCTGKNRSMVEKLERAYEY
Ga0070746_1005918253300006919AqueousVVKDCGCEERRAKLNAIFPGRNVEMAAEDFQAFGELLPSIEDSKKSGARLSRAQWRDIYGIFNRTFNANERPCNCTGKNKSMVEKLQRAYEYTCKP*
Ga0070748_126486223300006920AqueousEDCGCEERRAKLNAQFPGRNVEMSAEDVSAFAELLPAIDKGVLNRAETRTMYDIFNQTFSANERPCSCAGKNKRMVKKLRRAYEYSCKP*
Ga0070748_130520613300006920AqueousDVTAYEELLPAIESGRLNRHQSRDMYAIFNRTFNANERPCNCTGKNKSMVEKLQRAYEYTCKI*
Ga0098051_112778113300006924MarineHAVAEDCGCEERRAKLNAQFPGRNVEMSAPDVEAFAQLLPAIDRGVLNRSETRTMYDIFNRTFDANEKPCSCAGKNKRMVKKLRRAYEYSCTT*
Ga0075468_1018296713300007229AqueousDKLVHAVVEDCGCEERRAKLNAQFPGRNVEMSAEDVSAFAELLPAIDKGVLNRAETRTMYDIFNQTFSANERPCSCAGKNKRMVKKLRRAYEYSCKP*
Ga0075469_1010847923300007231AqueousMSAEDVSAFAELLPSIDKGVLNRAETRTMYDIFNQTFSANERPCSCAGKNKRMVKKLRRAYEYS
Ga0075463_1005273323300007236AqueousVKAVVKDCGCEERRAKLNAIFPGRNVEMSEADVTAYEEMLPSIEYSKKSGTRLSRAQWRDIYGIFNRTFNANERPCNCTGKNKSMVEKLQRAYEYTCKP*
Ga0070747_111302433300007276AqueousMSPEDVSAFAELLPAIDKGVLNRAETRTMYDIFNQTFSANERPCSCAGKNKRMVKKLRRAYEYSCKP*
Ga0070745_114948333300007344AqueousFPGRNVEMAEEDFQAFGELLPSIEDSKKSGARLSRAQWRDIYGIFNRTFNANERPCNCTGKNKSMVEKLQRAYEYTCKP*
Ga0070745_124517523300007344AqueousMSPEDVSAFANLLPSIDKGVLNRAETRTMYDIFNRTFSANERPCSCAGKNKRM
Ga0070752_118929813300007345AqueousRRAKLNAIFPGRNVEMSEEDVTAYEELLPAIERGRLNRHESRDMYAIFNRTFNANERPCNCTGKNKSMVEKLQRAYEYSCSK*
Ga0070753_124313613300007346AqueousPGRNVEMSEEDVTAYEELLPAIQRGRLNRHESRDMYAIFNRTFNANERPCNCTGKNKSMVEKLQRAYEYTCKP*
Ga0099849_129107513300007539AqueousALFPGRNVEMSEQDVTAYEELLPAIKSGRLNRHQSRDMYAIFNRTFNANERPCNCTGKNKSMVEKLQRAYEYTCKP*
Ga0099847_108075733300007540AqueousVKDCGCEERRAQLNAIFPGRNVEMAKEDFQAFGELLPSIEDSKKSGARLSRAQWRDIYGIFNRTFNANERPCNCTGKNKSMVEKLQRAYEYTCKP*
Ga0099847_108728133300007540AqueousMDPTDVTAFEKLLPAIKSGRLNRAESRTMYDIFNRTFNAKERPCSCTGKNKRMVEQLQRAYEYSCKS*
Ga0075480_1017808613300008012AqueousVKDCGCEERRAKLNAIFPGRNVEMAEEDFQAFGELLPSIEDSKKSGARLSRAQWRDIYGIFNRTFNANERPCNCT
Ga0075480_1022696413300008012AqueousAIFPGRNVEMSEQDVTAYEELLPAIESGRLNRHQSRDMYAIFNRTFNANERPCNCTGKNKSMVEKLQRAYEYTCKP*
Ga0102829_110684233300009026EstuarineMAARDVEAFAQLLPAVDRGVLNRSETRTMYDIFNRTFDANEKPCSCAGKNKRMV
Ga0115566_1043723613300009071Pelagic MarineMTPEDVELFATLLPAIKSGRLRRPESRTMYNIFNRTFNANEKPCNCTGKNKRMVEKLQRAYEYS
Ga0115546_101956863300009435Pelagic MarineMTPEDVELFATLLPAIKSGRLRRPESRTMYNIFNRTFNANEKPCNCTGKNKRMVEKLQRAYEYSCKI*
Ga0115555_121795913300009476Pelagic MarineMSPEDVSAFAELLPSIDKGVLNRAETRTMYDIFNQTFSANERPCSCAGKNKRM
Ga0115571_102742313300009495Pelagic MarineDKLVHAVVEDCGCEERRAKLNAQFPGRNVEMSAEDVSAFAELLPSIDKGVLNRAETRTMYDIFNQTFSANERPCSCAGKNKRMVKKLRRAYEYSCKS*
Ga0115570_1004003953300009496Pelagic MarineMIPEDVELFATLLPAIKSGRLRRPESRTMYNIFNRTFNANEKPCNCTGKNKRMVEKLQRAYEYSCKI*
Ga0115569_1001975583300009497Pelagic MarineLLPAIKSGRLRRPESRTMYNIFNRTFNANEKPCNCTGKNKRMVEKLQRAYEYSCKS*
Ga0115572_1029278533300009507Pelagic MarineTLLPAIKSGRLRRPESRTMYNIFNRTFNANEKPCNCTGKNKRMVEKLQRAYEYSCKS*
Ga0129327_1005114543300013010Freshwater To Marine Saline GradientMSAEDVSAFAELLPSIDKGVLNRAETRTMYDIFNQTFSANERPCSCAGKNKRMVKKLRRAYEFSCR*
Ga0180120_1008906453300017697Freshwater To Marine Saline GradientSAFANLLPAIDKGVLNRAETRTMYDIFNQTFSANERPCSCAGKNKRMVKKLRRAYEFSCR
Ga0180120_1031400623300017697Freshwater To Marine Saline GradientCDERQKKLNELFPGRGVAMSEEDVPLFEELLPSIEKGRLTRPESKKMYAIYNRTFNANAKPCNCTGKNQRMVTKLQQAYEHRCKI
Ga0181401_104488633300017727SeawaterMSAPDVEAFAQLLPAVDRGVLNRSETRTMYDIFNRTFDANEKPCSCAGKNKRMVKKLRRAYEYSCK
Ga0181407_104426113300017753SeawaterKLNAQFPGRNVEMTALDVEAFAQLLPAIDRGVLNRSETRTMYDIFNRTFDANEKPCSCAGKNKRMVKKLRRAYEYSCK
Ga0181380_1006022123300017782SeawaterMSEEDIPKYEELIPSIDKGRLSRFESRRMYDIYNRTFNANAKPCNCTGQNRRIVSKLKQAYEYRCKI
Ga0181552_1021039643300017824Salt MarshFEELLPAIERGRLNRSQSRTMYDIFNRTFNAREKPCNCTGKNKRMVEKLQRAYEYSCKI
Ga0181607_1069442423300017950Salt MarshERRAKLNAIFPGRNVEMSEQDVTAYKELLPAIKRGRLNRHESRDMYAIFNRTFNANERPCNCTGKNKSMVEKLQRAYEYTCKP
Ga0181577_1029678923300017951Salt MarshMTEQDVKAYEELLPAIERGRLNRHQSRDMYAIFNRTFNAMEKPCNCTGKNKRMVEKLQQAYDYTCKP
Ga0181577_1042604813300017951Salt MarshMSEEDVTAYEELLPAIERGKLNRHQSRDMYAIFNRTFNANERPCNCTGKNKSMVEKLQRAYEYTCKP
Ga0180437_1024997633300017963Hypersaline Lake SedimentMSEADVTAFEELLPAIERGRLNRYQSRDMYAIFNRTFNANERPCNCTGKNKSMVEKLQRAYEYTCKP
Ga0181606_1020138413300018048Salt MarshGRNVEMTEQDVTAYEELLPAIERGSLNRHQSRDMYAIFNRTFNANERPCNCTGKNKSMVEKLQRAYEYTCKP
Ga0180433_1076610313300018080Hypersaline Lake SedimentCGCEERRAKLNALFPGRNVEMSEEDVTAFEELLPAIEYSKKSGTRLSRAQWRDIYGIFNRTFNANERPCNCTGKNKSMVEKLQRAYEYTCKP
Ga0181560_1031159423300018413Salt MarshMSEEDVTAYEELLPAIERGNLNRHQSRDMYAIFNRTFNANERPCNCTGKNKSMVEKLQRAYEYTCKP
Ga0181559_1011778543300018415Salt MarshGRNVEMSEQDVTAYEELLPSIEDSKKSGRRMTRSQWRDIYGIFNRTFNANERPCNCTGKNKSMVEKLQRAYEYSCSK
Ga0181559_1034285913300018415Salt MarshMSEQDVTAFEELLPAIERGRLNRHQSRDMYAIFNRTFNANERPCNCTGKNKSMVEKLQRAYEYT
Ga0181553_1045140823300018416Salt MarshMSEQDVTAYEELLPAIERGRLNRHESRDMYAIFNRTFNANERPCNCTGKNKSMVEKLQRAYEYTCKP
Ga0181558_1028931513300018417Salt MarshPGRNVEMSEQDVTAYEELLPAIERGRLNRHESRDMYAIFNRTFNANERPCNCTGKNKSMVEKLQRAYEYSCSK
Ga0181563_1043029113300018420Salt MarshKLNAIFPGRNVEMSKQDVTAYEELLPAIERGRLNRSQSRTMYDIFNRTFNANERPCNCTGKNRSMVEKLERAYEYTCKP
Ga0206127_130200723300020169SeawaterKLNALFPGRNVEMDPTDVTAFEELLPAIKSGRLNRAESRTMYDIFNRTFNAKERPCSCTGKNKRMVDQLQRAYEYSCKS
Ga0181556_113326513300020176Salt MarshNAIFPGRNVEMSEQDVTAYEELLPAIQRGRLNRHESRDMYAIFNRTFNANERPCNCTGKNKSMVEKLQRAYEYTCKP
Ga0181556_122469813300020176Salt MarshDVTAYEELLPAIERGRLNRSQSRTMYDIFNRTFNANERPCNCTGKNRSMVEKLERAYEYTCKP
Ga0206130_1008066613300020187SeawaterMSAEDVSAFAELLPAIDKGVLNRAETRTMYDIFNQTFSANERPCSCAGKNKRMVKKLRRAYEYSCKP
Ga0213859_1053366413300021364SeawaterEGCGCDERRAKLNAMFPGRNVEMSAQDVTAFEELLPAIERGRLNRSQSRTMYDIFNRTFNAREKPCNCTGKNKRMVEKLQRAYEYSCKI
Ga0213863_1009539313300021371SeawaterPGRGVAMSEEDVPLFEELLPAIEKGRLTRPESKKMYAIYNRTFNANAKPCNCTGKNQRMVTKLQQAYEHRCKI
Ga0213865_10008863123300021373SeawaterEMSAQDVTEFEELLPAIERGRLNRSQSRTMYDIFNRTFNAREKPCNCTGKNKRMVEKLQRAYEYSCKI
Ga0213865_1039255713300021373SeawaterMSEEDVTAYEELLPAIERGRLNRHESRDMYAIFNRTSNANERPCNCTGKNKSMVEKLQRAYEYTCKP
Ga0213864_1032454123300021379SeawaterMAEEDFQAFGELLPSIKDSKKSGARLSRAQWRDIYGIFNRTFNANERPCNCTGKNKSMVEKLQRAYEYTCKP
Ga0222717_1037138113300021957Estuarine WaterMSEADVPLFEELLPSIEKGRLNRPESKKMYAIYNRTFNANAKPCNCTGKNQRMVTKLQQA
Ga0222717_1059686713300021957Estuarine WaterVAEDCGCEERRAKLNAQFPGRNVEMIAPDVEAFAQLLPAIDRGVLNRSETRTMYDIFNRTFDAKEKPCSCAGKNKRMVKKLRRAYEYSCKS
Ga0222717_1062624213300021957Estuarine WaterVPLFEELLPSIERGRLNRPESKKMYAIYNRTFNANAKPCNCTGKNQRMVTKLKQAYEYSC
Ga0222716_1024613513300021959Estuarine WaterVVKDCGCEERRAKLNAIFPGRNVEMSEQDVTAYEELLPAIESGRLNRHQSRDMYAVFDRTFNANERPCNCTGKNKSMVEKLQRAYEYTCKI
Ga0222715_1023139333300021960Estuarine WaterMTEQDVTAYEELLPAIESGRLNRHQSRDMYAIFNRTFNANERPCNCTGKNKSMVEKLQRAYEYTCKP
Ga0212027_103649813300022168AqueousAYEELLPSIEYSKKSGTRLSRAQWRDIYGIFNRTFNANERPCNCTGKNKSMVEKLQRAYEYTCKP
Ga0196903_101211713300022169AqueousEELLPAIERGRLNRSQSRTMYDIFNRTFNAREKPCNCTGKNKRMVEKLQRAYEYSCKI
Ga0196887_100575733300022178AqueousMSEEDVPLFEELLPAIEKGRLTRPESKKMYAIYNRTFNANAKPCNCTGKNQRMVTKLQQAYEHRCKI
Ga0196891_107096513300022183AqueousMAAEDFQAFGELLPSIEDSKKSGARLSRAQWRDIYGIFNRTFNANERPCNCTGKNKSMVEKLQRAYEYTCKP
Ga0224513_1003529433300022220SedimentVKDCGCEERRAKLNAIFPGRNVEMSEQDVTAYEELLPSIEYSKKSGARLSRAQWRDIYGIFNRTFNANERPCNCTGKNKSMVEKLQRAYEYTCKP
Ga0255752_1039853623300022929Salt MarshPGRNVEMTEQDVKAYEELLPAIERGRLNRHQSRDMYAIFNRTFNAMEKPCNCTGKNKRMVEKLQQAYDYTCKP
Ga0255751_1022681513300023116Salt MarshEMSEEDVTAYEELLPAIQRGSLNRHESRDMYAIFNRTFNANERPCNCTGKNKSMVEKLQRAYEYTCKP
Ga0208303_109198333300025543AqueousFPGRNVEMDPTDVTAFEELLPAIKSGRLNRAESRTMYDIFNRTFNAKERPCSCTGKNKRMVDQLQRAYEYSCKS
Ga0208149_109674013300025610AqueousMSEEDVTAYEELLPSIEYSKKSGTRLSRAQWRDIYGIFNRTFNANERPCNCTGKNKSMVEKLQRA
Ga0208004_101453513300025630AqueousVKAVVKDCGCEERRAKLNAIFPGRNVEMSEADVTAYEEMLPSIEYSKKSGTRLSRAQWRDIYGIFNRTFNANERPCNCTGKNKSMVEKLQRAYEYTCKP
Ga0208643_108705533300025645AqueousELLPAIDKGVLNRAETRTMYDIFNQTFSANERPCSCAGKNKRMVKKLRRAYEYSCKP
Ga0208134_118028123300025652AqueousNELFPGRGVAMSEEDVPLFEELLPSIEKGRLTRPESKKMYAIYNRTFNANAKPCNCTGKNQRMVTKLQQAYEHRCKI
Ga0208898_109085033300025671AqueousFPGRNVEMAEEDFQAFGELLPSIEDSKKSGARLSRAQWRDIYGIFNRTFNANERPCNCTGKNKSMVEKLQRAYEYTCKP
Ga0208899_100773383300025759AqueousVKDCGCEERRAKLNAIFPGRNVEMAAEDFQAFGELLPSIEDSKKSGARLSRAQWRDIYGIFNRTFNANERPCNCTGKNKSMVEKLQRAYEYTCKP
Ga0209199_116458613300025809Pelagic MarineRRAKLNALFPGRNVEMDPTDVTAFEELLPAIKSGRLNRAESRTMYDIFNRTFNAKERPCSCTGKNKRMVDQLQRAYEYSCKS
Ga0208917_124481613300025840AqueousNVEMSEEDVTAYEELLPAIERGRLNRHESRDMYAIFNRTFNANERPCNCTGKNKSMVEKLQRAYEYSCSK
Ga0208645_109681453300025853AqueousAKLNAIFPGRNVEMSEEDVTAYEELLPAIQRGRLNRHESRDMYAIFNRTFNANERPCNCTGKNKSMVEKLQRAYEYTCKP
Ga0209223_1011972343300025876Pelagic MarineLNALFPGRNVEMDPTDVTAFEELLPAIKSGRLNRAESRTMYDIFNRTFNAKERPCSCTGKNKRMVDQLQRAYEYSCKS
Ga0208644_105532953300025889AqueousLNAIFPGRNVEMSEQDVTAYEELLPAIESGRLNRHQSRDMYAIFNRTFNANERPCNCTGKNKSMVEKLKRAYEYTCKP
Ga0208644_108036313300025889AqueousRNVEMSEEDVTAYEELLPAIERGRLNRHESRDMYAIFNRTFNANERPCNCTGKNKSMVEKLQRAYEYTCKP
Ga0208644_116316733300025889AqueousMSEQDVTAYEELLPAIERGRLNRHESRDMYAIFNRTFNANERPCNCTGKNKSMVEK
Ga0208644_118730153300025889AqueousEELLPAIESGRLNRHQSRDMYAIFNRTFNANERPCNCTGKNKSMVEKLKRAYEYTCKP
Ga0208949_100484693300027315MarineMSAPDVEAFAQLLPAVDRGVLNRSETRTMYDIFNRTFDANEKPCSCAGKNKRMVKKLRRAYEYSCKS
Ga0208949_101951643300027315MarineDVEAFAQLMPAVDRGVLNRSETRTMYDIFNRTFDAKEKPCSCAGKNKRMVKKLRRAYEYSCKS
Ga0208965_108458323300027406MarineMSEADVPLFEELLPAIEKGRLNRPESKKMYTIYNRTFNANAKPCNCTGKN
Ga0208964_101776053300027572MarineAPDVEAFAQLMPAVDRGVLNRSETRTMYDIFNRTFDANEKPCSCAGKNKRMVKKLRRAYEYSCKS
Ga0316202_1001087673300032277Microbial MatMIAPDVEAFAQLLPAIDRGVLNRSETRTMYDIFNRTFDANEKPCSCAGKNKRMVKKLRRAYEYSCKS
Ga0316202_10017995103300032277Microbial MatMSPEDVSAFAELLPAIDKGVLNRAETRTMYDIFNQTFSANERPCSCAGKNKRMVKKL
Ga0348335_121274_604_7743300034374AqueousLLPAIERGRLNRHQSRDMYAIFNRTFNANERPCNCTGKNKSMVEKLQRAYEYTCKP
Ga0348337_189501_5_2083300034418AqueousMSEEDVTAYEELLPAIQRGRLNRHESRDMYAIFNRTFNANERPCNCTGKNKSMVEKLQRAYEYTCKP

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.