NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F097440

Metagenome Family F097440

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F097440
Family Type Metagenome
Number of Sequences 104
Average Sequence Length 43 residues
Representative Sequence MYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAF
Number of Associated Samples 84
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 21.36 %
% of genes near scaffold ends (potentially truncated) 95.19 %
% of genes from short scaffolds (< 2000 bps) 70.19 %
Associated GOLD sequencing projects 79
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.077 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(8.654 % of family members)
Environment Ontology (ENVO) Unclassified
(38.462 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(63.462 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 16.28%    Coil/Unstructured: 83.72%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF01761DHQ_synthase 41.35
PF02880PGM_PMM_III 24.04
PF00408PGM_PMM_IV 14.42
PF04545Sigma70_r4 5.77
PF04546Sigma70_ner 2.88
PF07949YbbR 2.88
PF01545Cation_efflux 1.92
PF01713Smr 1.92
PF13662Toprim_4 0.96
PF13905Thioredoxin_8 0.96
PF02457DAC 0.96
PF06723MreB_Mbl 0.96
PF02518HATPase_c 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG0033Phosphoglucomutase/phosphomannomutaseCarbohydrate transport and metabolism [G] 38.46
COG1109PhosphomannomutaseCarbohydrate transport and metabolism [G] 38.46
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 2.88
COG4856Cyclic di-AMP synthase regulator CdaR, YbbR domainSignal transduction mechanisms [T] 2.88
COG0053Divalent metal cation (Fe/Co/Zn/Cd) efflux pumpInorganic ion transport and metabolism [P] 1.92
COG1230Co/Zn/Cd efflux system componentInorganic ion transport and metabolism [P] 1.92
COG3965Predicted Co/Zn/Cd cation transporter, cation efflux familyInorganic ion transport and metabolism [P] 1.92
COG1077Cell shape-determining ATPase MreB, actin-like superfamilyCell cycle control, cell division, chromosome partitioning [D] 0.96

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.04 %
UnclassifiedrootN/A0.96 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002120|C687J26616_10053486All Organisms → cellular organisms → Bacteria1394Open in IMG/M
3300003324|soilH2_10148514All Organisms → cellular organisms → Bacteria1443Open in IMG/M
3300005331|Ga0070670_100809212All Organisms → cellular organisms → Bacteria846Open in IMG/M
3300005331|Ga0070670_100838394All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium831Open in IMG/M
3300005332|Ga0066388_100031243All Organisms → cellular organisms → Bacteria5009Open in IMG/M
3300005332|Ga0066388_108403560All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300005334|Ga0068869_101564622All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium586Open in IMG/M
3300005335|Ga0070666_10056837All Organisms → cellular organisms → Bacteria2643Open in IMG/M
3300005336|Ga0070680_100822566All Organisms → cellular organisms → Bacteria800Open in IMG/M
3300005345|Ga0070692_10712624All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium676Open in IMG/M
3300005347|Ga0070668_101992254All Organisms → cellular organisms → Archaea535Open in IMG/M
3300005367|Ga0070667_100857561All Organisms → cellular organisms → Bacteria844Open in IMG/M
3300005440|Ga0070705_100009694All Organisms → cellular organisms → Bacteria4796Open in IMG/M
3300005458|Ga0070681_10408002All Organisms → cellular organisms → Bacteria → Acidobacteria1270Open in IMG/M
3300005544|Ga0070686_100012118All Organisms → cellular organisms → Bacteria4906Open in IMG/M
3300005564|Ga0070664_100048673All Organisms → cellular organisms → Bacteria3582Open in IMG/M
3300005614|Ga0068856_102514517All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300005615|Ga0070702_100806210All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300005617|Ga0068859_100295352All Organisms → cellular organisms → Bacteria1713Open in IMG/M
3300005841|Ga0068863_101093957All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium801Open in IMG/M
3300005843|Ga0068860_100090019All Organisms → cellular organisms → Bacteria2922Open in IMG/M
3300006028|Ga0070717_11503848All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300006046|Ga0066652_100895715All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium847Open in IMG/M
3300006049|Ga0075417_10450849All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300006358|Ga0068871_100356152All Organisms → cellular organisms → Bacteria1295Open in IMG/M
3300006806|Ga0079220_12044913All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica512Open in IMG/M
3300006852|Ga0075433_10192061All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1816Open in IMG/M
3300006852|Ga0075433_11381113All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium609Open in IMG/M
3300006876|Ga0079217_10196734All Organisms → cellular organisms → Bacteria1026Open in IMG/M
3300006880|Ga0075429_100163495All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1949Open in IMG/M
3300006880|Ga0075429_100180418All Organisms → cellular organisms → Bacteria1850Open in IMG/M
3300006881|Ga0068865_100700438All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium865Open in IMG/M
3300006954|Ga0079219_10628487All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium795Open in IMG/M
3300006954|Ga0079219_11618872All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium595Open in IMG/M
3300006969|Ga0075419_10155777All Organisms → cellular organisms → Bacteria → Acidobacteria1496Open in IMG/M
3300007004|Ga0079218_13755562All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300009093|Ga0105240_10819626All Organisms → cellular organisms → Bacteria1007Open in IMG/M
3300009098|Ga0105245_10362407All Organisms → cellular organisms → Bacteria1439Open in IMG/M
3300009101|Ga0105247_10025552All Organisms → cellular organisms → Bacteria3564Open in IMG/M
3300009156|Ga0111538_10037002All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes6306Open in IMG/M
3300009156|Ga0111538_10189981All Organisms → cellular organisms → Bacteria2607Open in IMG/M
3300009157|Ga0105092_10303498All Organisms → cellular organisms → Bacteria901Open in IMG/M
3300009162|Ga0075423_12608799All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300009174|Ga0105241_10106344All Organisms → cellular organisms → Bacteria2239Open in IMG/M
3300009174|Ga0105241_10465310All Organisms → cellular organisms → Bacteria1121Open in IMG/M
3300009174|Ga0105241_12051562All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300009177|Ga0105248_10024469All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes6713Open in IMG/M
3300009551|Ga0105238_10130168All Organisms → cellular organisms → Bacteria2495Open in IMG/M
3300009553|Ga0105249_11147601All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium848Open in IMG/M
3300010040|Ga0126308_10564683All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium773Open in IMG/M
3300010041|Ga0126312_10669672All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium748Open in IMG/M
3300010045|Ga0126311_10119169All Organisms → cellular organisms → Bacteria1839Open in IMG/M
3300010047|Ga0126382_10664179All Organisms → cellular organisms → Bacteria868Open in IMG/M
3300010166|Ga0126306_11142895All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium638Open in IMG/M
3300010375|Ga0105239_10454965All Organisms → cellular organisms → Bacteria1452Open in IMG/M
3300010399|Ga0134127_10020217All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes5146Open in IMG/M
3300010399|Ga0134127_10387896All Organisms → cellular organisms → Bacteria1377Open in IMG/M
3300010399|Ga0134127_10580512All Organisms → cellular organisms → Bacteria1146Open in IMG/M
3300010399|Ga0134127_10650789All Organisms → cellular organisms → Bacteria1088Open in IMG/M
3300010399|Ga0134127_10771535All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium1008Open in IMG/M
3300010399|Ga0134127_11348256All Organisms → cellular organisms → Bacteria783Open in IMG/M
3300011270|Ga0137391_10064230All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes3146Open in IMG/M
3300012045|Ga0136623_10021297All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes2760Open in IMG/M
3300012093|Ga0136632_10240604All Organisms → cellular organisms → Bacteria820Open in IMG/M
3300012200|Ga0137382_11335057All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300012208|Ga0137376_10725354All Organisms → cellular organisms → Bacteria857Open in IMG/M
3300012354|Ga0137366_10137693All Organisms → cellular organisms → Bacteria1840Open in IMG/M
3300012532|Ga0137373_10010776All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes9529Open in IMG/M
3300012922|Ga0137394_11026605All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300012923|Ga0137359_11489390All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300012986|Ga0164304_10976641All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300013297|Ga0157378_10397385All Organisms → cellular organisms → Bacteria1357Open in IMG/M
3300013308|Ga0157375_10281252All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1827Open in IMG/M
3300015371|Ga0132258_10298495All Organisms → cellular organisms → Bacteria3961Open in IMG/M
3300015371|Ga0132258_10848255All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes2305Open in IMG/M
3300015373|Ga0132257_100078872All Organisms → cellular organisms → Bacteria3744Open in IMG/M
3300015374|Ga0132255_102286779All Organisms → cellular organisms → Bacteria825Open in IMG/M
3300015374|Ga0132255_105476087All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300017792|Ga0163161_10011294All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes6189Open in IMG/M
3300018061|Ga0184619_10020761All Organisms → cellular organisms → Bacteria → Acidobacteria2697Open in IMG/M
3300018061|Ga0184619_10102240All Organisms → cellular organisms → Bacteria1288Open in IMG/M
3300018061|Ga0184619_10129552All Organisms → cellular organisms → Bacteria1145Open in IMG/M
3300018061|Ga0184619_10493176All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300018429|Ga0190272_10047537All Organisms → cellular organisms → Bacteria2459Open in IMG/M
3300018466|Ga0190268_10333427All Organisms → cellular organisms → Bacteria933Open in IMG/M
3300018466|Ga0190268_11443699All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium593Open in IMG/M
3300018920|Ga0190273_11518904All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300019360|Ga0187894_10000827All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes41663Open in IMG/M
3300019487|Ga0187893_10038490All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes5175Open in IMG/M
3300021073|Ga0210378_10080159All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1278Open in IMG/M
3300022534|Ga0224452_1185594All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium640Open in IMG/M
3300022694|Ga0222623_10279840All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300025899|Ga0207642_10027030All Organisms → cellular organisms → Bacteria2344Open in IMG/M
3300025912|Ga0207707_10000335All Organisms → cellular organisms → Bacteria49647Open in IMG/M
3300025925|Ga0207650_10732694All Organisms → cellular organisms → Bacteria836Open in IMG/M
3300025935|Ga0207709_10660815All Organisms → cellular organisms → Bacteria833Open in IMG/M
3300025936|Ga0207670_10229757All Organisms → cellular organisms → Bacteria1424Open in IMG/M
3300025938|Ga0207704_11461670All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300026116|Ga0207674_10000077All Organisms → cellular organisms → Bacteria104302Open in IMG/M
3300027637|Ga0209818_1000011All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes47171Open in IMG/M
3300027637|Ga0209818_1047612All Organisms → cellular organisms → Bacteria1030Open in IMG/M
3300027639|Ga0209387_1000131All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes22013Open in IMG/M
3300031949|Ga0214473_10025867All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes6877Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere8.65%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil7.69%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.73%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil5.77%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere5.77%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere5.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.81%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere4.81%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.85%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil3.85%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.85%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.88%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.88%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.88%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.88%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand1.92%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.92%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.92%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.92%
Microbial Mat On RocksEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks1.92%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.92%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.96%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.96%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.96%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.96%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002120Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2EnvironmentalOpen in IMG/M
3300003324Sugarcane bulk soil Sample H2EnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012045Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06)EnvironmentalOpen in IMG/M
3300012093Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06)EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019360White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaGEnvironmentalOpen in IMG/M
3300019487White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaGEnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300022534Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1EnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027637Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027639Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes)EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
C687J26616_1005348613300002120SoilVAMYIVGQERRLVDPPSQVVAGVRTVTTNMNGRDALPR*
soilH2_1014851423300003324Sugarcane Root And Bulk SoilLHGTVVAVYIAGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFA
Ga0070670_10080921223300005331Switchgrass RhizosphereMYSVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFA
Ga0070670_10083839413300005331Switchgrass RhizosphereQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFKD*
Ga0066388_10003124353300005332Tropical Forest SoilVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFST*
Ga0066388_10840356013300005332Tropical Forest SoilMYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFA
Ga0068869_10156462213300005334Miscanthus RhizosphereIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAI*
Ga0070666_1005683713300005335Switchgrass RhizosphereYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPSAI*
Ga0070680_10082256613300005336Corn RhizosphereMYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAF
Ga0070692_1071262423300005345Corn, Switchgrass And Miscanthus RhizosphereGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFKD*
Ga0070668_10199225413300005347Switchgrass RhizosphereMYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPS
Ga0070667_10085756123300005367Switchgrass RhizosphereMYSVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRP
Ga0070705_10000969463300005440Corn, Switchgrass And Miscanthus RhizosphereLHGTGIAMYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMS
Ga0070681_1040800223300005458Corn RhizosphereLHGTGVAVYIAGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFVGE*
Ga0070686_10001211813300005544Switchgrass RhizosphereVAMYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPSAI*
Ga0070664_10004867343300005564Corn RhizosphereMYSVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRM
Ga0068856_10251451723300005614Corn RhizosphereLHGTGIAMYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDAL
Ga0070702_10080621023300005615Corn, Switchgrass And Miscanthus RhizosphereLHGTGVAVYIAGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFA
Ga0068859_10029535213300005617Switchgrass RhizosphereGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAF*
Ga0068863_10109395723300005841Switchgrass RhizosphereGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFVLM*
Ga0068860_10009001943300005843Switchgrass RhizosphereGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAL*
Ga0070717_1150384823300006028Corn, Switchgrass And Miscanthus RhizosphereMYIVGQERRLVNPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFSVALHSTQQDTAQT
Ga0066652_10089571513300006046SoilVAMYIVGQERRLVDPPSQVVAGVRTVTTKNEWARRTPTLSRPFALF*
Ga0075417_1045084923300006049Populus RhizosphereMYSVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPR
Ga0068871_10035615213300006358Miscanthus RhizosphereGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFLANSFSS*
Ga0079220_1204491323300006806Agricultural SoilMYSVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAF
Ga0075433_1019206133300006852Populus RhizosphereMYSVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMS
Ga0075433_1138111313300006852Populus RhizosphereGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFY*
Ga0079217_1019673423300006876Agricultural SoilAGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAI*
Ga0075429_10016349513300006880Populus RhizosphereLLHGTGVAMYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAF*
Ga0075429_10018041843300006880Populus RhizosphereAVYIAGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFVYKIP*
Ga0068865_10070043813300006881Miscanthus RhizosphereVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFVLM*
Ga0079219_1062848713300006954Agricultural SoilIAGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFVGE*
Ga0079219_1161887213300006954Agricultural SoilYIAGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAI*
Ga0075419_1015577733300006969Populus RhizosphereYIAGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFVYKIP*
Ga0079218_1375556213300007004Agricultural SoilMYIVGQEETVGESSVSVVAGVRTVTTNMNGRDVLPRLSRPFA
Ga0105240_1081962613300009093Corn RhizosphereIAGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAF*
Ga0105245_1036240723300009098Miscanthus RhizosphereMYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPSAI*
Ga0105247_1002555243300009101Switchgrass RhizosphereLHGTGVAVYIAGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFK
Ga0111538_1003700263300009156Populus RhizosphereVAMYIVGQERRLVDPPSQVVAGVRTVTTNMNGRDALPRMSRPFAFY*
Ga0111538_1018998143300009156Populus RhizosphereIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAL*
Ga0105092_1030349813300009157Freshwater SedimentMRLAGYIVGQERRLVNPPSQVVAGVRTVTTNMDGRDALPRMSRPF
Ga0075423_1260879923300009162Populus RhizosphereMYIVGQERRLVNPPSQVVAGVRTVTTNMDGRDALPSMSRPFALSA
Ga0105241_1010634413300009174Corn RhizosphereVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAL*
Ga0105241_1046531013300009174Corn RhizosphereIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFIQQPT*
Ga0105241_1205156213300009174Corn RhizosphereMYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALP
Ga0105242_1099757713300009176Miscanthus RhizosphereMHQTFLRGMRVAMYIVGQERRLVNPPSQVVAGVRTVTTNMDGRDVLPR
Ga0105248_1002446913300009177Switchgrass RhizosphereYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAI*
Ga0105238_1013016813300009551Corn RhizosphereVAMYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAL*
Ga0105249_1114760113300009553Switchgrass RhizosphereIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFVLM*
Ga0126308_1056468323300010040Serpentine SoilIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFALSTIPV*
Ga0126312_1066967213300010041Serpentine SoilLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAF*
Ga0126311_1011916943300010045Serpentine SoilIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFALSTIR*
Ga0126382_1066417923300010047Tropical Forest SoilLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFVFLL*
Ga0126306_1114289523300010166Serpentine SoilLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFALSASR*
Ga0105239_1045496523300010375Corn RhizosphereQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAI*
Ga0134127_1002021713300010399Terrestrial SoilMYIVGQERRLVNPPSQVVAGVRTVTTKMNGRDALPRMS
Ga0134127_1038789623300010399Terrestrial SoilYIAGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAICNGPW*
Ga0134127_1058051223300010399Terrestrial SoilVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFKD*
Ga0134127_1065078913300010399Terrestrial SoilMRVAMYIVGQERRLVNPPSQVVAGVRTVTTNMDGRDVLPRLSRPF
Ga0134127_1077153523300010399Terrestrial SoilVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFIQQPT*
Ga0134127_1134825633300010399Terrestrial SoilVGQERRLVNPPSQVVAGVRTVTTNMDGRDVLPRLSRPF
Ga0137391_1006423023300011270Vadose Zone SoilMRVAMYIVGQERRLVNPPSQVVAGVRTVTTNMDGRDVLPRLSRPFAF*
Ga0136623_1002129713300012045Polar Desert SandMYIVGQERRLVNPPSQVVAGVRTVTTNMDGRDALPRMSRPFAF
Ga0136632_1024060423300012093Polar Desert SandMYIAGQERRLVNPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFGRAFRLH
Ga0137382_1133505723300012200Vadose Zone SoilMYIVGQERRLVNPPSQVVAGVRTVTTNMDGRDVLPRLSRP
Ga0137376_1072535413300012208Vadose Zone SoilMYIVGQERRLVNPPSQVVAGVRTVTTNMDGRDVLPR
Ga0137366_1013769333300012354Vadose Zone SoilVAMYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFALLTTRSPTLNP*
Ga0137373_1001077623300012532Vadose Zone SoilMYIVGQERRLVNPPSQVVAGVRTVTTNMNGRDALPRMSRPFAFLAAF*
Ga0137394_1102660513300012922Vadose Zone SoilMYIVGQEETVGESSVSVVAGVRTVTTNMDGRDVLPRLSRPFAF
Ga0137359_1148939023300012923Vadose Zone SoilMYIVGQERRLVNPPSQVVAGVRTVTTNMDGRDALPRMSR
Ga0164304_1097664113300012986SoilMYIVGQERRLVNPPSQVVAGVRTVTTNMNGRDVLPR
Ga0157378_1039738513300013297Miscanthus RhizosphereIHVAMYIVGQERRLVNPPSQVVAGVRTVTTNMDGRDVLPRLSRPFAF*
Ga0157375_1028125233300013308Miscanthus RhizosphereGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAI*
Ga0132258_1029849553300015371Arabidopsis RhizosphereVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFKS*
Ga0132258_1084825543300015371Arabidopsis RhizosphereVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFLANSFSS*
Ga0132257_10007887253300015373Arabidopsis RhizosphereIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPLMSRPFAFKS*
Ga0132255_10228677913300015374Arabidopsis RhizosphereMYIVGQERRLVDPPSQVVAGVRTVTTNMNGRDALPRMSRPFAFLEAFS
Ga0132255_10547608723300015374Arabidopsis RhizosphereMYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFLATP
Ga0163161_1001129463300017792Switchgrass RhizosphereMYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPSAI
Ga0184619_1002076113300018061Groundwater SedimentMRVAMYIVGQERRLVNPPSQVVAGVRTVTTNMDGRDVLPRLSR
Ga0184619_1010224013300018061Groundwater SedimentMRVAMYIVGQEETVGESSVSVVAGVRTVTTNMDGRDVLPRL
Ga0184619_1012955223300018061Groundwater SedimentMYIVGQERRLVNPPSQVVAGVRTVTTNMDGRDVLPRLSR
Ga0184619_1049317623300018061Groundwater SedimentMYIVGQEETVGESSVSVVAGVRTVTTNMDGRDVLPRL
Ga0190272_1004753713300018429SoilVGQERRLVNPPSQVVAGVRTVTTNMNGRDVLPRLSRPFAFFL
Ga0190268_1033342713300018466SoilMYIVGQERRLVNPPSQVVAGVRTVTTKMDGRDALPRMS
Ga0190268_1144369913300018466SoilIAVYIAGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAF
Ga0190273_1151890423300018920SoilVAMYIVGQERRLVNPPSQVVAGVRTVTTNMDGRDALPRLSRPFAFLIQPF
Ga0187894_1000082713300019360Microbial Mat On RocksMYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMS
Ga0187893_1003849013300019487Microbial Mat On RocksMYIVGQERRLVNPPSQVVAGVRTVTTNMNGRDALPRMSRPFAF
Ga0210378_1008015923300021073Groundwater SedimentMYIVGQEETAGESSVSVVAGVRTVTTNMDGRDVLPRLSRPFAFITPS
Ga0224452_118559413300022534Groundwater SedimentMYIVGQEETVGESSVSVVAGVRTVTTNMDGRDVLPRLSRPFAFSTAIQTSI
Ga0222623_1027984023300022694Groundwater SedimentMYIVGQERRLVNPPSQVVAGVRTVTTNMDGRDVLPRLSRPFA
Ga0207642_1002703043300025899Miscanthus RhizosphereAMYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPSAI
Ga0207707_10000335393300025912Corn RhizosphereMYSVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFALSANASVLS
Ga0207650_1073269413300025925Switchgrass RhizosphereMYSVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSR
Ga0207709_1066081523300025935Miscanthus RhizosphereMYIVGQEEAVGESSVSVVAGVRTVTTNMDRRDALPRLSRLFAFLSS
Ga0207670_1022975713300025936Switchgrass RhizosphereMYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSR
Ga0207704_1146167023300025938Miscanthus RhizosphereMYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRM
Ga0207674_10000077823300026116Corn RhizosphereMYSVGQERRLVDPPSQVVAGVRTVTTNMDGRDALP
Ga0209818_100001113300027637Agricultural SoilIAGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAIYNG
Ga0209818_104761213300027637Agricultural SoilIAGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAI
Ga0209387_1000131173300027639Agricultural SoilYIAGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAICNG
Ga0214473_1002586713300031949SoilVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRLSRPFAFYA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.