Basic Information | |
---|---|
Family ID | F097630 |
Family Type | Metagenome |
Number of Sequences | 104 |
Average Sequence Length | 44 residues |
Representative Sequence | MSAIGPKRTSLVAPHVSAFGGKADMTVCWSPLSRSLLGVKRT |
Number of Associated Samples | 72 |
Number of Associated Scaffolds | 104 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 79.61 % |
% of genes near scaffold ends (potentially truncated) | 92.31 % |
% of genes from short scaffolds (< 2000 bps) | 84.62 % |
Associated GOLD sequencing projects | 66 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.18 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (77.885 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (23.077 % of family members) |
Environment Ontology (ENVO) | Unclassified (26.923 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.115 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 10.00% β-sheet: 0.00% Coil/Unstructured: 90.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 104 Family Scaffolds |
---|---|---|
PF04392 | ABC_sub_bind | 48.08 |
PF02518 | HATPase_c | 3.85 |
PF01322 | Cytochrom_C_2 | 2.88 |
PF07681 | DoxX | 1.92 |
PF07719 | TPR_2 | 1.92 |
PF13505 | OMP_b-brl | 1.92 |
PF00582 | Usp | 0.96 |
PF05235 | CHAD | 0.96 |
PF14539 | DUF4442 | 0.96 |
PF00211 | Guanylate_cyc | 0.96 |
PF05990 | DUF900 | 0.96 |
PF14023 | DUF4239 | 0.96 |
PF04519 | Bactofilin | 0.96 |
PF07690 | MFS_1 | 0.96 |
PF10009 | DUF2252 | 0.96 |
PF13557 | Phenol_MetA_deg | 0.96 |
PF13492 | GAF_3 | 0.96 |
PF03466 | LysR_substrate | 0.96 |
PF00536 | SAM_1 | 0.96 |
PF13185 | GAF_2 | 0.96 |
PF12806 | Acyl-CoA_dh_C | 0.96 |
PF03734 | YkuD | 0.96 |
COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
---|---|---|---|
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 48.08 |
COG3909 | Cytochrome c556 | Energy production and conversion [C] | 2.88 |
COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 1.92 |
COG4270 | Uncharacterized membrane protein | Function unknown [S] | 1.92 |
COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 0.96 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.96 |
COG3025 | Inorganic triphosphatase YgiF, contains CYTH and CHAD domains | Inorganic ion transport and metabolism [P] | 0.96 |
COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
COG4782 | Esterase/lipase superfamily enzyme | General function prediction only [R] | 0.96 |
COG5607 | CHAD domain, binds inorganic polyphosphates | Function unknown [S] | 0.96 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 77.88 % |
Unclassified | root | N/A | 22.12 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2228664021|ICCgaii200_c0727149 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
3300000041|ARcpr5oldR_c001168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2704 | Open in IMG/M |
3300000041|ARcpr5oldR_c001819 | All Organisms → cellular organisms → Bacteria | 2059 | Open in IMG/M |
3300000363|ICChiseqgaiiFebDRAFT_14294989 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300000559|F14TC_101705723 | All Organisms → cellular organisms → Bacteria | 1284 | Open in IMG/M |
3300000655|AF_2010_repII_A100DRAFT_1012602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1612 | Open in IMG/M |
3300000955|JGI1027J12803_100605281 | Not Available | 1441 | Open in IMG/M |
3300000955|JGI1027J12803_103836488 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
3300001431|F14TB_100634837 | All Organisms → cellular organisms → Bacteria | 1234 | Open in IMG/M |
3300004058|Ga0055498_10156568 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300004156|Ga0062589_100337181 | Not Available | 1188 | Open in IMG/M |
3300004157|Ga0062590_100297831 | Not Available | 1253 | Open in IMG/M |
3300004157|Ga0062590_102999004 | Not Available | 506 | Open in IMG/M |
3300005332|Ga0066388_102278290 | Not Available | 979 | Open in IMG/M |
3300005332|Ga0066388_102357872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 964 | Open in IMG/M |
3300005332|Ga0066388_102823615 | Not Available | 887 | Open in IMG/M |
3300005332|Ga0066388_103798719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 771 | Open in IMG/M |
3300005332|Ga0066388_106262797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 600 | Open in IMG/M |
3300005332|Ga0066388_106519366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 588 | Open in IMG/M |
3300005338|Ga0068868_100070983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2777 | Open in IMG/M |
3300005437|Ga0070710_10768578 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
3300005546|Ga0070696_101237693 | Not Available | 632 | Open in IMG/M |
3300005713|Ga0066905_100286754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1285 | Open in IMG/M |
3300005713|Ga0066905_100718204 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
3300005713|Ga0066905_101573494 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300005713|Ga0066905_101700972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca → Stigmatella aurantiaca DW4/3-1 | 580 | Open in IMG/M |
3300005713|Ga0066905_101857440 | Not Available | 557 | Open in IMG/M |
3300005713|Ga0066905_101879620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 554 | Open in IMG/M |
3300005713|Ga0066905_102262225 | Not Available | 508 | Open in IMG/M |
3300005764|Ga0066903_100492150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2073 | Open in IMG/M |
3300005764|Ga0066903_101243542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1386 | Open in IMG/M |
3300005764|Ga0066903_102540105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 992 | Open in IMG/M |
3300005764|Ga0066903_103536844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 842 | Open in IMG/M |
3300006049|Ga0075417_10093062 | Not Available | 1359 | Open in IMG/M |
3300006196|Ga0075422_10308264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 680 | Open in IMG/M |
3300006237|Ga0097621_100595902 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1010 | Open in IMG/M |
3300006844|Ga0075428_100239991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1955 | Open in IMG/M |
3300006844|Ga0075428_100575361 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1204 | Open in IMG/M |
3300006844|Ga0075428_102528322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 525 | Open in IMG/M |
3300006845|Ga0075421_100138778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3042 | Open in IMG/M |
3300006847|Ga0075431_102060429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 525 | Open in IMG/M |
3300006852|Ga0075433_10371687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1262 | Open in IMG/M |
3300006852|Ga0075433_10564985 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
3300006853|Ga0075420_101739991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 534 | Open in IMG/M |
3300006903|Ga0075426_10934452 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
3300007076|Ga0075435_100091187 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2515 | Open in IMG/M |
3300009094|Ga0111539_10673141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1205 | Open in IMG/M |
3300009094|Ga0111539_12310664 | Not Available | 624 | Open in IMG/M |
3300009100|Ga0075418_10197577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2142 | Open in IMG/M |
3300009147|Ga0114129_10565618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1477 | Open in IMG/M |
3300009147|Ga0114129_10636594 | All Organisms → cellular organisms → Bacteria | 1378 | Open in IMG/M |
3300009156|Ga0111538_10755017 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
3300010043|Ga0126380_10391603 | Not Available | 1028 | Open in IMG/M |
3300010047|Ga0126382_11646029 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 597 | Open in IMG/M |
3300010361|Ga0126378_10301669 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1705 | Open in IMG/M |
3300010362|Ga0126377_10291565 | All Organisms → cellular organisms → Bacteria | 1605 | Open in IMG/M |
3300010362|Ga0126377_11454121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 759 | Open in IMG/M |
3300010362|Ga0126377_13002971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 544 | Open in IMG/M |
3300010366|Ga0126379_13329977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 538 | Open in IMG/M |
3300010371|Ga0134125_10496428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1352 | Open in IMG/M |
3300010375|Ga0105239_11435204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 797 | Open in IMG/M |
3300011119|Ga0105246_10383697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1162 | Open in IMG/M |
3300012958|Ga0164299_10652079 | Not Available | 728 | Open in IMG/M |
3300012960|Ga0164301_10055788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2063 | Open in IMG/M |
3300012960|Ga0164301_10805663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 719 | Open in IMG/M |
3300012961|Ga0164302_10177391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1286 | Open in IMG/M |
3300012971|Ga0126369_10073609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3006 | Open in IMG/M |
3300012971|Ga0126369_10856868 | Not Available | 993 | Open in IMG/M |
3300012984|Ga0164309_10742362 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
3300012985|Ga0164308_10357008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1181 | Open in IMG/M |
3300014326|Ga0157380_13324699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 514 | Open in IMG/M |
3300015371|Ga0132258_10915952 | Not Available | 2213 | Open in IMG/M |
3300015371|Ga0132258_12386615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1325 | Open in IMG/M |
3300015372|Ga0132256_100805579 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
3300015374|Ga0132255_100937749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 174 | 1296 | Open in IMG/M |
3300015374|Ga0132255_101391039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1060 | Open in IMG/M |
3300016422|Ga0182039_12109442 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300017947|Ga0187785_10274995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 764 | Open in IMG/M |
3300018060|Ga0187765_11333852 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300025916|Ga0207663_10142540 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1671 | Open in IMG/M |
3300025936|Ga0207670_10779513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 796 | Open in IMG/M |
3300025972|Ga0207668_10557222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 994 | Open in IMG/M |
3300026035|Ga0207703_10984714 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
3300026121|Ga0207683_11705891 | Not Available | 579 | Open in IMG/M |
3300027873|Ga0209814_10248052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 772 | Open in IMG/M |
3300027880|Ga0209481_10036592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2241 | Open in IMG/M |
3300027880|Ga0209481_10188937 | Not Available | 1027 | Open in IMG/M |
3300027909|Ga0209382_10093310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3534 | Open in IMG/M |
3300027909|Ga0209382_10628498 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
3300027909|Ga0209382_11133881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga | 805 | Open in IMG/M |
3300031545|Ga0318541_10769738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 537 | Open in IMG/M |
3300031668|Ga0318542_10758146 | Not Available | 508 | Open in IMG/M |
3300031854|Ga0310904_10018148 | All Organisms → cellular organisms → Bacteria | 3034 | Open in IMG/M |
3300031910|Ga0306923_10533368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1324 | Open in IMG/M |
3300031944|Ga0310884_10138001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1244 | Open in IMG/M |
3300031946|Ga0310910_11518692 | Not Available | 513 | Open in IMG/M |
3300031947|Ga0310909_10445074 | Not Available | 1087 | Open in IMG/M |
3300031981|Ga0318531_10199491 | Not Available | 902 | Open in IMG/M |
3300032003|Ga0310897_10004464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3816 | Open in IMG/M |
3300032052|Ga0318506_10432186 | Not Available | 584 | Open in IMG/M |
3300032076|Ga0306924_10966875 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 937 | Open in IMG/M |
3300032180|Ga0307471_102756477 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300032782|Ga0335082_10074508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3427 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 23.08% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 16.35% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.77% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.77% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 5.77% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.88% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.88% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.92% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.92% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.96% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.96% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.96% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.96% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.96% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.96% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Host-Associated | Open in IMG/M |
3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
3300004058 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
ICCgaii200_07271492 | 2228664021 | Soil | VNGAMSAFGPKQTLPLAPHMSAFGSKADITVCGNP |
ARcpr5oldR_0011681 | 3300000041 | Arabidopsis Rhizosphere | MSGMSAIGPKRTLTSAPHMSAFGGEADMTVCGCLLSRSLLGVK |
ARcpr5oldR_0018191 | 3300000041 | Arabidopsis Rhizosphere | MSAYGPLRTWPLALQMSAFRGRADITFRGGPLSWSLSGVKR |
ICChiseqgaiiFebDRAFT_142949891 | 3300000363 | Soil | VNGAMSAFGPKQTLPLAPHMSAFGSKADITVCGNPLSRSL |
F14TC_1017057232 | 3300000559 | Soil | VNGAMSAFGPKQTLPLAPHMSAFGSKADITVCGNPL |
AF_2010_repII_A100DRAFT_10126022 | 3300000655 | Forest Soil | MNYGMSAFGPKQTSATALHMSAFGGKADMAFCGISLSRSLLGVKRT* |
JGI1027J12803_1006052811 | 3300000955 | Soil | MVDAVHESAIGPKRTCTAAPRMSAFGGKADIAFRGISLSRSLLGVKRTCLIAA |
JGI1027J12803_1027587154 | 3300000955 | Soil | MSAIGPKRTFLFAPHMSALGSKADITFFESPLSRSLL |
JGI1027J12803_1038364883 | 3300000955 | Soil | VNGAMSAFGPKQTLPLAPHMSAFGSKADITVCGNPLSRSLL |
F14TB_1006348372 | 3300001431 | Soil | VIGMMSAIGPKRTYACALHMSAFGGKADMSVCGGPLSRSLL |
Ga0055498_101565682 | 3300004058 | Natural And Restored Wetlands | MSAIGPKQTSLVAPHMSAFGGRADMTLCECPLFRSLLGVKRTGLVA |
Ga0062589_1003371814 | 3300004156 | Soil | MSAIGPSPTFRFALHLSAFGGKADMTFRECLLSRSLLGVK |
Ga0062590_1002978311 | 3300004157 | Soil | MSGMSAIGPKRTLTSAPHMSAFGGEADMTVCGCLLSRSLLGVKRT |
Ga0062590_1029990041 | 3300004157 | Soil | MSAIGPKQTWASALHTSAFGVKADMTVRRSPLSRALLGVERTW |
Ga0066388_1022782903 | 3300005332 | Tropical Forest Soil | VNYAMSAIGPKQTWTVALHMSALGGKADMTVCGCLLSRSLLGVKRTW |
Ga0066388_1023578723 | 3300005332 | Tropical Forest Soil | VMSAFGPKQTWRIALHMSAIGGKADMAFCGISLSRSLLGVKQT |
Ga0066388_1028236152 | 3300005332 | Tropical Forest Soil | MSAFGPKRTFMVASHMSAFGGKADMTLGRCLLLRSLFGVKRTC |
Ga0066388_1037987194 | 3300005332 | Tropical Forest Soil | VTIQIAAVRESAIGSKRTYACAPHMSAFGGKADMTLCGNSLLRSLLGVKR |
Ga0066388_1062627971 | 3300005332 | Tropical Forest Soil | MADKLSVPRMSAIGPKQTWAGALHMSAFRGKADMTVCGCLLSRSLLGAKRTS |
Ga0066388_1065193662 | 3300005332 | Tropical Forest Soil | VNGEMSAIGPKRTSLAALHMSAFGGKADMTFCGNPLSRSLLGVK |
Ga0068868_1000709831 | 3300005338 | Miscanthus Rhizosphere | MQMSAFGPKQTSLVALHMSAFGGKADMTVYRSPLSRSLLGVKRTSL |
Ga0070710_107685782 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MLFAAVHESAFGPKRTSLVALHMSAFGGKADMTVCGKSLSRSLLG |
Ga0070696_1012376932 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MSAIGPKQTSPFALHMSAIGVEADMTVFGNPLSRSLLGAKRT |
Ga0066905_1002867542 | 3300005713 | Tropical Forest Soil | MSAIGPKQTLPCALHESAFGGKADMTVWGSPLSRSLLGVKQTS |
Ga0066905_1007182041 | 3300005713 | Tropical Forest Soil | MSGGMSAIGPKRTWTTALHMPAFRGKADMTVCGCLLSRSLSGVKRT |
Ga0066905_1015734942 | 3300005713 | Tropical Forest Soil | MNAPMSAIGPKQTWASAVHMSAFGCKADMPVCGCPLLRSLLGVKRTCVAAPHES |
Ga0066905_1017009722 | 3300005713 | Tropical Forest Soil | MSAIGPKRTLASALHMSAFGGKADMAFCGISLSWSLLGVKQT |
Ga0066905_1018574401 | 3300005713 | Tropical Forest Soil | MRIISRMSAFGPKQTCTSALHMSAFGCKADMTVCGCLLSRSLLG |
Ga0066905_1018796202 | 3300005713 | Tropical Forest Soil | MFAIGPKRTRAIAPQMSAFGGKPDITFAGSPLSRSLLGVNRTWAGAVQM |
Ga0066905_1022622252 | 3300005713 | Tropical Forest Soil | MSAIGPKRTSALAPHMSAFGGKADMTFCGNPRSRSLLGVKRTCLLALHMSAY |
Ga0066903_1004921501 | 3300005764 | Tropical Forest Soil | MSAIGPKRTLASALHMSAFGGKADMAFCGISLSWSLLGVKQTCSLAAHMFAF |
Ga0066903_1012435422 | 3300005764 | Tropical Forest Soil | MSAFGPKRTFGFALHMSAFEGKAEMTVCGSPLLRSLLGVK |
Ga0066903_1025401051 | 3300005764 | Tropical Forest Soil | MMSGTSAIGPKRTSLVAPHMSALGGKADMTVCASPLSGRYRG* |
Ga0066903_1035368442 | 3300005764 | Tropical Forest Soil | MSAFGPKQTWPLALHMSAFSGKADMTFRGCLLLRSLLG* |
Ga0075417_100930623 | 3300006049 | Populus Rhizosphere | MSAFGPKQTSLVAPHMSAFGGKADMTSCGDPLLRSLLGL |
Ga0075422_103082641 | 3300006196 | Populus Rhizosphere | MSGMSAIGPKRTLTSAPHMSAFGGEADMTVCGCLLSRSLLGVKRTWPF |
Ga0097621_1005959021 | 3300006237 | Miscanthus Rhizosphere | MSAFGPKQTWAVAPHMSAVGSKADMTFCENPLSRSLLGRE |
Ga0075428_1002399911 | 3300006844 | Populus Rhizosphere | MSAFGPKQTWACAPHMSAFGGKADMGYCGSPLSRSLLGVKRTW |
Ga0075428_1005753613 | 3300006844 | Populus Rhizosphere | MVMSAFGPKQTSGSAPHMSAFGGKADMTVCGNPLSRS |
Ga0075428_1025283222 | 3300006844 | Populus Rhizosphere | MSAFGPKQTSASALHMSAIGCKADMAFCGITLSRSLSGVKRTWLVAA |
Ga0075421_1001387782 | 3300006845 | Populus Rhizosphere | MLFAALHESAIGPKRTSLVAPHMSAFGGKADMAFCENPLSRSLLGVKRT* |
Ga0075431_1020604291 | 3300006847 | Populus Rhizosphere | MNGRMSAFGPKRTSLVAPHMSAFGGKADMTVCGNPL |
Ga0075433_103716874 | 3300006852 | Populus Rhizosphere | MSAIGPKRTSLVAPHRSAFGGKADIACCENPLSWSLLGVTRTTLTR |
Ga0075433_105649852 | 3300006852 | Populus Rhizosphere | MSAFGPKQTSLVAPHMSAFGGKADMTVCGNPLSRSL |
Ga0075420_1017399912 | 3300006853 | Populus Rhizosphere | MNGRMSAFGPKRTSLVAPHMSAFGGKADMTVCGNPLLRSLLGAKRTCLI |
Ga0075426_109344521 | 3300006903 | Populus Rhizosphere | LNFEMSAIGPKQTLLIAPQMSAFVAKADMAFWGISLSRSLLGVKRTWLVAA |
Ga0075435_1000911876 | 3300007076 | Populus Rhizosphere | MSAIGPKQTSPFALHMSAFGVEADMTVFGNPLSRSRV* |
Ga0111539_106731412 | 3300009094 | Populus Rhizosphere | MNGGMSAIGPKQTWAAAPHMSAFGGKADMAFCENPLSRSLLGVKR |
Ga0111539_123106641 | 3300009094 | Populus Rhizosphere | MSAIGPKRTFLVAPHMSAFGGKADMGYCGSPLSRSLLGVKRTWVGALHMS |
Ga0075418_101975772 | 3300009100 | Populus Rhizosphere | MSAIGPKRTFLVAPHMSAFGGKADMAYCGMSLSRSLL |
Ga0114129_105656181 | 3300009147 | Populus Rhizosphere | MSAIAPKQTLVSALHMSAFGGKADMACCGNPLSRSLL |
Ga0114129_106365941 | 3300009147 | Populus Rhizosphere | MSAFGPKQTWACAPHMSAFGGKADMGYCGSPLSRSLLGVKRTWV |
Ga0111538_107550171 | 3300009156 | Populus Rhizosphere | MDFAAMHESAIGPKRTSVAASHMSALGGKADMACCGNSLSRSLLGVKRTCPF |
Ga0126380_103916031 | 3300010043 | Tropical Forest Soil | MSAIGPMQTCSFAPHMSAFGGKADMTICACLLLRLLLGVKRTWR |
Ga0126382_116460291 | 3300010047 | Tropical Forest Soil | MSAFGPKRTFLFALHMSAFGGKADMTVCGNPLSQSPLGVK |
Ga0126378_103016692 | 3300010361 | Tropical Forest Soil | MSAFGPKQTCACAVQESAFGGKADMTFHGKSLSWSLLGVKRTWAGAAQ |
Ga0126377_102915654 | 3300010362 | Tropical Forest Soil | MIFFCAAHKSAFGPKQTSLVAPHMSAFGCKADMTLCGSPLSRSLLGVKRT |
Ga0126377_114541211 | 3300010362 | Tropical Forest Soil | MSAIGPKRTSLVAPHVSAFGGKADMTVCWSPLSRSLLGVKRT |
Ga0126377_130029712 | 3300010362 | Tropical Forest Soil | MLVMSAYSPKQTSAGAPHMSAFGGKADMAFCGISLSRSLLGVKR |
Ga0126379_133299771 | 3300010366 | Tropical Forest Soil | MSAIGPKQTWPIALHMSAFGGEADMTFCGISLSRLLLGVKQ |
Ga0134125_104964281 | 3300010371 | Terrestrial Soil | MSAIGPKPTSLVAAHASAFGGEADMAFCGSPLLRSLS |
Ga0105239_114352041 | 3300010375 | Corn Rhizosphere | MSPMSAIGPKRTYRFALHMSAFGGKADMTFCGSLLSWSLLGAKRT |
Ga0105246_103836972 | 3300011119 | Miscanthus Rhizosphere | MSAFGPKQTSPIALHMSAFGGKADMAFRGSPLLRS |
Ga0164299_106520791 | 3300012958 | Soil | MSAIGPSQTSLVAVHMSAFGGKADMTIGTCPLLQSQLGVKRTWLV |
Ga0164301_100557882 | 3300012960 | Soil | MSAIGPKQTWALALHMSAFGDKADITFFENPLSWSLLGVERT |
Ga0164301_108056632 | 3300012960 | Soil | MSASAPKQTSLVAAHMSAFGGKADMAYRGNTLSRSLLGLKRTW |
Ga0164302_101773911 | 3300012961 | Soil | VIAGMSAFGPKRTSLVAPHMSAFGGKADMIFCEGPLSRSLLGAKRTSL |
Ga0126369_100736094 | 3300012971 | Tropical Forest Soil | VIALHMSAFGPKQTWLGALQMSAFGTKADMAFCGISLSR |
Ga0126369_108568682 | 3300012971 | Tropical Forest Soil | MSAIGPKQTCTDALHMSAFGGKADMTGCRSPLLRSLLGVKRTWPFAA |
Ga0164309_107423622 | 3300012984 | Soil | MLDFSTDLSAIGPKRTFLVALHMSAFGGKADMAVCENPLSR |
Ga0164308_103570081 | 3300012985 | Soil | MSAIGPKQTWAVAPHMSAFRGNADVTFCGNKLSRSLLG |
Ga0157380_133246992 | 3300014326 | Switchgrass Rhizosphere | MSGMSAIGPKRTLTSAPHMSAFGGEADMTVCGCLLSRSLLGVKRTSHFAAQ |
Ga0132258_109159521 | 3300015371 | Arabidopsis Rhizosphere | VRMSAIGPERTSLVAPHMSAFGGKADMTLRGNPLSRSLSGVK |
Ga0132258_123866151 | 3300015371 | Arabidopsis Rhizosphere | MSALGPKRTLSFATHMSAFEGKADMTFCGNPLSRSLLG |
Ga0132256_1008055791 | 3300015372 | Arabidopsis Rhizosphere | MSAIGPKPTLAFAAHMSASRGKADMTISASPLSRSLFGLKRTWLFAL |
Ga0132255_1009377491 | 3300015374 | Arabidopsis Rhizosphere | MSAIGTKRTSPVAPHMSAFGGKADMAFCGNPLSRSLLRVKRTS |
Ga0132255_1013910393 | 3300015374 | Arabidopsis Rhizosphere | MMSAIGPKRTCVAALHESAIGGKADMTIGTCPLSWSLLGVKR |
Ga0182039_121094421 | 3300016422 | Soil | MSAIGPKRTSLIAPHMSAFGGKAEMAFFGMSLSRSLLGVKRTWLF |
Ga0187785_102749952 | 3300017947 | Tropical Peatland | MIGTMSAFGPKQTLRCALHESAFGGKADMTVCRSPLSQSLLGVK |
Ga0187765_113338521 | 3300018060 | Tropical Peatland | MSATQPTRPVAMHMSTFGGKADMAGCGSPLLRSLSGAKRTWLFA |
Ga0207663_101425401 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VIAGMSAFGPKRTSLVAPHMSAFGGKADMIFCEGPLSRSLLGA |
Ga0207670_107795132 | 3300025936 | Switchgrass Rhizosphere | MSAIGPKRTSLAAPNMSAFGGKADMTVCGVSLLRSLLVESGHGLLRRT |
Ga0207668_105572222 | 3300025972 | Switchgrass Rhizosphere | MSAFGPKQTSPIALHMSAFGGKADMAFRGSPLLRSLLGAKRTWRF |
Ga0207703_109847141 | 3300026035 | Switchgrass Rhizosphere | MSAFGPKQTWAVAPHMSAVGSKADMTFCENPLSRSLLGREAR |
Ga0207683_117058912 | 3300026121 | Miscanthus Rhizosphere | MSAFGPKQTWAVAPHMSAVGSKADMTFCENPLSRSL |
Ga0209814_102480521 | 3300027873 | Populus Rhizosphere | MSAIGPKQTWAFALHMSAFGGKADMTVCGNPLSRSLLGAKRTSH |
Ga0209481_100365923 | 3300027880 | Populus Rhizosphere | MSAIGPKRTSLVALHMSALGGKADMTISACLLLWSLLGVKRTSIIAAH |
Ga0209481_101889372 | 3300027880 | Populus Rhizosphere | MSAFGPKQTSLVAPHMSAFGGKADMTSCGDPLLRSLLGLKRTSLFAVRM |
Ga0209382_100933104 | 3300027909 | Populus Rhizosphere | MLFAALHESAIGPKRTSLVAPHMSAFGGKADMAFCENPLSRSLLGVKRT |
Ga0209382_106284981 | 3300027909 | Populus Rhizosphere | MDFAAMHESAIGPKRTSVAASHMSALGGKADMACCGNSLSRSLLGVKRTCP |
Ga0209382_111338812 | 3300027909 | Populus Rhizosphere | MSAIGPKRTSLVALHMSAFGGKADMTLCGNPLLRSLLGASGRA |
Ga0318541_107697382 | 3300031545 | Soil | MSAIGPKRTSTSAPHMSAFGMKADMTVCGSPLLRSLLGAKRTSASALHM |
Ga0318542_107581461 | 3300031668 | Soil | MSAFGPKRTLAIALHMSALRGKADMTVCGSPLSRSLLGVKRTCLCALRMSAY |
Ga0310904_100181484 | 3300031854 | Soil | MSGMSAIGPKRTLTSAPHMSAFGGEADMTVCGCLLSRSLLGVKRTSHFAAQMSA |
Ga0306923_105333682 | 3300031910 | Soil | MSAIGPKQTSLVAPHMSAFGGKADMAVCGSPLSRSLLGVKRTWLVAAH |
Ga0310884_101380011 | 3300031944 | Soil | MSVAMSAIGPKQTSLVAPHMSAFRGRADMTFCGGPLSRSLLGVKRTSLFVAH |
Ga0310910_115186922 | 3300031946 | Soil | MSAIGPNQTSASAAHMSAFRGKADMIVCGRPLSRSLLGVKRI |
Ga0310909_104450742 | 3300031947 | Soil | AVMSAYGPKQTFLFALHMSAFGGKADMTLCGNSLLRSLLGVKRT |
Ga0318531_101994911 | 3300031981 | Soil | KDPGAVMSAYGPKQTFLFALHMSAFGGKADMTLCGNSLLRSLLGVKRT |
Ga0310897_100044648 | 3300032003 | Soil | MSVAMSAIGPKQTSLVAPHMSAFRGRADMTFCGGPLSRSLLGVKRT |
Ga0318506_104321861 | 3300032052 | Soil | MSAFGPKRTLAIALHMSALRGKADMTVCGSPLSRSLLGVK |
Ga0306924_109668752 | 3300032076 | Soil | MSAFGPKRTSPVAPHMSAFGGKADMAFCGISLSMSLLGLKRT |
Ga0307471_1027564772 | 3300032180 | Hardwood Forest Soil | MSAFGPKQTCSFAPHMSAFGGKADMAYCGMSLSRSLLGVKQ |
Ga0335082_100745085 | 3300032782 | Soil | MSAIGPKQKWVGAPHRSASGSKADMTFSGGPLSRSLFGAK |
⦗Top⦘ |