NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F097630

Metagenome Family F097630

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F097630
Family Type Metagenome
Number of Sequences 104
Average Sequence Length 44 residues
Representative Sequence MSAIGPKRTSLVAPHVSAFGGKADMTVCWSPLSRSLLGVKRT
Number of Associated Samples 72
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 79.61 %
% of genes near scaffold ends (potentially truncated) 92.31 %
% of genes from short scaffolds (< 2000 bps) 84.62 %
Associated GOLD sequencing projects 66
AlphaFold2 3D model prediction Yes
3D model pTM-score0.18

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (77.885 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(23.077 % of family members)
Environment Ontology (ENVO) Unclassified
(26.923 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(47.115 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 10.00%    β-sheet: 0.00%    Coil/Unstructured: 90.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.18
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF04392ABC_sub_bind 48.08
PF02518HATPase_c 3.85
PF01322Cytochrom_C_2 2.88
PF07681DoxX 1.92
PF07719TPR_2 1.92
PF13505OMP_b-brl 1.92
PF00582Usp 0.96
PF05235CHAD 0.96
PF14539DUF4442 0.96
PF00211Guanylate_cyc 0.96
PF05990DUF900 0.96
PF14023DUF4239 0.96
PF04519Bactofilin 0.96
PF07690MFS_1 0.96
PF10009DUF2252 0.96
PF13557Phenol_MetA_deg 0.96
PF13492GAF_3 0.96
PF03466LysR_substrate 0.96
PF00536SAM_1 0.96
PF13185GAF_2 0.96
PF12806Acyl-CoA_dh_C 0.96
PF03734YkuD 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 48.08
COG3909Cytochrome c556Energy production and conversion [C] 2.88
COG2259Uncharacterized membrane protein YphA, DoxX/SURF4 familyFunction unknown [S] 1.92
COG4270Uncharacterized membrane proteinFunction unknown [S] 1.92
COG1376Lipoprotein-anchoring transpeptidase ErfK/SrfKCell wall/membrane/envelope biogenesis [M] 0.96
COG1664Cytoskeletal protein CcmA, bactofilin familyCytoskeleton [Z] 0.96
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 0.96
COG3025Inorganic triphosphatase YgiF, contains CYTH and CHAD domainsInorganic ion transport and metabolism [P] 0.96
COG3034Murein L,D-transpeptidase YafKCell wall/membrane/envelope biogenesis [M] 0.96
COG4782Esterase/lipase superfamily enzymeGeneral function prediction only [R] 0.96
COG5607CHAD domain, binds inorganic polyphosphatesFunction unknown [S] 0.96


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms77.88 %
UnclassifiedrootN/A22.12 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2228664021|ICCgaii200_c0727149All Organisms → cellular organisms → Bacteria735Open in IMG/M
3300000041|ARcpr5oldR_c001168All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2704Open in IMG/M
3300000041|ARcpr5oldR_c001819All Organisms → cellular organisms → Bacteria2059Open in IMG/M
3300000363|ICChiseqgaiiFebDRAFT_14294989All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300000559|F14TC_101705723All Organisms → cellular organisms → Bacteria1284Open in IMG/M
3300000655|AF_2010_repII_A100DRAFT_1012602All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1612Open in IMG/M
3300000955|JGI1027J12803_100605281Not Available1441Open in IMG/M
3300000955|JGI1027J12803_103836488All Organisms → cellular organisms → Bacteria1029Open in IMG/M
3300001431|F14TB_100634837All Organisms → cellular organisms → Bacteria1234Open in IMG/M
3300004058|Ga0055498_10156568All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300004156|Ga0062589_100337181Not Available1188Open in IMG/M
3300004157|Ga0062590_100297831Not Available1253Open in IMG/M
3300004157|Ga0062590_102999004Not Available506Open in IMG/M
3300005332|Ga0066388_102278290Not Available979Open in IMG/M
3300005332|Ga0066388_102357872All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium964Open in IMG/M
3300005332|Ga0066388_102823615Not Available887Open in IMG/M
3300005332|Ga0066388_103798719All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium771Open in IMG/M
3300005332|Ga0066388_106262797All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales600Open in IMG/M
3300005332|Ga0066388_106519366All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria588Open in IMG/M
3300005338|Ga0068868_100070983All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae2777Open in IMG/M
3300005437|Ga0070710_10768578All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300005546|Ga0070696_101237693Not Available632Open in IMG/M
3300005713|Ga0066905_100286754All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1285Open in IMG/M
3300005713|Ga0066905_100718204All Organisms → cellular organisms → Bacteria859Open in IMG/M
3300005713|Ga0066905_101573494All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300005713|Ga0066905_101700972All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca → Stigmatella aurantiaca DW4/3-1580Open in IMG/M
3300005713|Ga0066905_101857440Not Available557Open in IMG/M
3300005713|Ga0066905_101879620All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium554Open in IMG/M
3300005713|Ga0066905_102262225Not Available508Open in IMG/M
3300005764|Ga0066903_100492150All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2073Open in IMG/M
3300005764|Ga0066903_101243542All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1386Open in IMG/M
3300005764|Ga0066903_102540105All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria992Open in IMG/M
3300005764|Ga0066903_103536844All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria842Open in IMG/M
3300006049|Ga0075417_10093062Not Available1359Open in IMG/M
3300006196|Ga0075422_10308264All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria680Open in IMG/M
3300006237|Ga0097621_100595902All Organisms → cellular organisms → Bacteria → Proteobacteria1010Open in IMG/M
3300006844|Ga0075428_100239991All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1955Open in IMG/M
3300006844|Ga0075428_100575361All Organisms → cellular organisms → Bacteria → Proteobacteria1204Open in IMG/M
3300006844|Ga0075428_102528322All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales525Open in IMG/M
3300006845|Ga0075421_100138778All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae3042Open in IMG/M
3300006847|Ga0075431_102060429All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria525Open in IMG/M
3300006852|Ga0075433_10371687All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1262Open in IMG/M
3300006852|Ga0075433_10564985All Organisms → cellular organisms → Bacteria999Open in IMG/M
3300006853|Ga0075420_101739991All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria534Open in IMG/M
3300006903|Ga0075426_10934452All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300007076|Ga0075435_100091187All Organisms → cellular organisms → Bacteria → Proteobacteria2515Open in IMG/M
3300009094|Ga0111539_10673141All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1205Open in IMG/M
3300009094|Ga0111539_12310664Not Available624Open in IMG/M
3300009100|Ga0075418_10197577All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2142Open in IMG/M
3300009147|Ga0114129_10565618All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1477Open in IMG/M
3300009147|Ga0114129_10636594All Organisms → cellular organisms → Bacteria1378Open in IMG/M
3300009156|Ga0111538_10755017All Organisms → cellular organisms → Bacteria1232Open in IMG/M
3300010043|Ga0126380_10391603Not Available1028Open in IMG/M
3300010047|Ga0126382_11646029All Organisms → cellular organisms → Bacteria → Proteobacteria597Open in IMG/M
3300010361|Ga0126378_10301669All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1705Open in IMG/M
3300010362|Ga0126377_10291565All Organisms → cellular organisms → Bacteria1605Open in IMG/M
3300010362|Ga0126377_11454121All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria759Open in IMG/M
3300010362|Ga0126377_13002971All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria544Open in IMG/M
3300010366|Ga0126379_13329977All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi538Open in IMG/M
3300010371|Ga0134125_10496428All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1352Open in IMG/M
3300010375|Ga0105239_11435204All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria797Open in IMG/M
3300011119|Ga0105246_10383697All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1162Open in IMG/M
3300012958|Ga0164299_10652079Not Available728Open in IMG/M
3300012960|Ga0164301_10055788All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2063Open in IMG/M
3300012960|Ga0164301_10805663All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae719Open in IMG/M
3300012961|Ga0164302_10177391All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1286Open in IMG/M
3300012971|Ga0126369_10073609All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium3006Open in IMG/M
3300012971|Ga0126369_10856868Not Available993Open in IMG/M
3300012984|Ga0164309_10742362All Organisms → cellular organisms → Bacteria784Open in IMG/M
3300012985|Ga0164308_10357008All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1181Open in IMG/M
3300014326|Ga0157380_13324699All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria514Open in IMG/M
3300015371|Ga0132258_10915952Not Available2213Open in IMG/M
3300015371|Ga0132258_12386615All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1325Open in IMG/M
3300015372|Ga0132256_100805579All Organisms → cellular organisms → Bacteria1056Open in IMG/M
3300015374|Ga0132255_100937749All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 1741296Open in IMG/M
3300015374|Ga0132255_101391039All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1060Open in IMG/M
3300016422|Ga0182039_12109442All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300017947|Ga0187785_10274995All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium764Open in IMG/M
3300018060|Ga0187765_11333852All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300025916|Ga0207663_10142540All Organisms → cellular organisms → Bacteria → Proteobacteria1671Open in IMG/M
3300025936|Ga0207670_10779513All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales796Open in IMG/M
3300025972|Ga0207668_10557222All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria994Open in IMG/M
3300026035|Ga0207703_10984714All Organisms → cellular organisms → Bacteria809Open in IMG/M
3300026121|Ga0207683_11705891Not Available579Open in IMG/M
3300027873|Ga0209814_10248052All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria772Open in IMG/M
3300027880|Ga0209481_10036592All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2241Open in IMG/M
3300027880|Ga0209481_10188937Not Available1027Open in IMG/M
3300027909|Ga0209382_10093310All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3534Open in IMG/M
3300027909|Ga0209382_10628498All Organisms → cellular organisms → Bacteria1165Open in IMG/M
3300027909|Ga0209382_11133881All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga805Open in IMG/M
3300031545|Ga0318541_10769738All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria537Open in IMG/M
3300031668|Ga0318542_10758146Not Available508Open in IMG/M
3300031854|Ga0310904_10018148All Organisms → cellular organisms → Bacteria3034Open in IMG/M
3300031910|Ga0306923_10533368All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1324Open in IMG/M
3300031944|Ga0310884_10138001All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1244Open in IMG/M
3300031946|Ga0310910_11518692Not Available513Open in IMG/M
3300031947|Ga0310909_10445074Not Available1087Open in IMG/M
3300031981|Ga0318531_10199491Not Available902Open in IMG/M
3300032003|Ga0310897_10004464All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3816Open in IMG/M
3300032052|Ga0318506_10432186Not Available584Open in IMG/M
3300032076|Ga0306924_10966875All Organisms → cellular organisms → Bacteria → Proteobacteria937Open in IMG/M
3300032180|Ga0307471_102756477All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300032782|Ga0335082_10074508All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3427Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere23.08%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil16.35%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil8.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.77%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere5.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.88%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.88%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.92%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.92%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.96%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.96%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.96%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.96%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.96%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.96%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2228664021Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000041Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphereHost-AssociatedOpen in IMG/M
3300000363Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000655Forest soil microbial communities from Amazon forest - 2010 replicate II A100EnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300004058Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ICCgaii200_072714922228664021SoilVNGAMSAFGPKQTLPLAPHMSAFGSKADITVCGNP
ARcpr5oldR_00116813300000041Arabidopsis RhizosphereMSGMSAIGPKRTLTSAPHMSAFGGEADMTVCGCLLSRSLLGVK
ARcpr5oldR_00181913300000041Arabidopsis RhizosphereMSAYGPLRTWPLALQMSAFRGRADITFRGGPLSWSLSGVKR
ICChiseqgaiiFebDRAFT_1429498913300000363SoilVNGAMSAFGPKQTLPLAPHMSAFGSKADITVCGNPLSRSL
F14TC_10170572323300000559SoilVNGAMSAFGPKQTLPLAPHMSAFGSKADITVCGNPL
AF_2010_repII_A100DRAFT_101260223300000655Forest SoilMNYGMSAFGPKQTSATALHMSAFGGKADMAFCGISLSRSLLGVKRT*
JGI1027J12803_10060528113300000955SoilMVDAVHESAIGPKRTCTAAPRMSAFGGKADIAFRGISLSRSLLGVKRTCLIAA
JGI1027J12803_10275871543300000955SoilMSAIGPKRTFLFAPHMSALGSKADITFFESPLSRSLL
JGI1027J12803_10383648833300000955SoilVNGAMSAFGPKQTLPLAPHMSAFGSKADITVCGNPLSRSLL
F14TB_10063483723300001431SoilVIGMMSAIGPKRTYACALHMSAFGGKADMSVCGGPLSRSLL
Ga0055498_1015656823300004058Natural And Restored WetlandsMSAIGPKQTSLVAPHMSAFGGRADMTLCECPLFRSLLGVKRTGLVA
Ga0062589_10033718143300004156SoilMSAIGPSPTFRFALHLSAFGGKADMTFRECLLSRSLLGVK
Ga0062590_10029783113300004157SoilMSGMSAIGPKRTLTSAPHMSAFGGEADMTVCGCLLSRSLLGVKRT
Ga0062590_10299900413300004157SoilMSAIGPKQTWASALHTSAFGVKADMTVRRSPLSRALLGVERTW
Ga0066388_10227829033300005332Tropical Forest SoilVNYAMSAIGPKQTWTVALHMSALGGKADMTVCGCLLSRSLLGVKRTW
Ga0066388_10235787233300005332Tropical Forest SoilVMSAFGPKQTWRIALHMSAIGGKADMAFCGISLSRSLLGVKQT
Ga0066388_10282361523300005332Tropical Forest SoilMSAFGPKRTFMVASHMSAFGGKADMTLGRCLLLRSLFGVKRTC
Ga0066388_10379871943300005332Tropical Forest SoilVTIQIAAVRESAIGSKRTYACAPHMSAFGGKADMTLCGNSLLRSLLGVKR
Ga0066388_10626279713300005332Tropical Forest SoilMADKLSVPRMSAIGPKQTWAGALHMSAFRGKADMTVCGCLLSRSLLGAKRTS
Ga0066388_10651936623300005332Tropical Forest SoilVNGEMSAIGPKRTSLAALHMSAFGGKADMTFCGNPLSRSLLGVK
Ga0068868_10007098313300005338Miscanthus RhizosphereMQMSAFGPKQTSLVALHMSAFGGKADMTVYRSPLSRSLLGVKRTSL
Ga0070710_1076857823300005437Corn, Switchgrass And Miscanthus RhizosphereMLFAAVHESAFGPKRTSLVALHMSAFGGKADMTVCGKSLSRSLLG
Ga0070696_10123769323300005546Corn, Switchgrass And Miscanthus RhizosphereMSAIGPKQTSPFALHMSAIGVEADMTVFGNPLSRSLLGAKRT
Ga0066905_10028675423300005713Tropical Forest SoilMSAIGPKQTLPCALHESAFGGKADMTVWGSPLSRSLLGVKQTS
Ga0066905_10071820413300005713Tropical Forest SoilMSGGMSAIGPKRTWTTALHMPAFRGKADMTVCGCLLSRSLSGVKRT
Ga0066905_10157349423300005713Tropical Forest SoilMNAPMSAIGPKQTWASAVHMSAFGCKADMPVCGCPLLRSLLGVKRTCVAAPHES
Ga0066905_10170097223300005713Tropical Forest SoilMSAIGPKRTLASALHMSAFGGKADMAFCGISLSWSLLGVKQT
Ga0066905_10185744013300005713Tropical Forest SoilMRIISRMSAFGPKQTCTSALHMSAFGCKADMTVCGCLLSRSLLG
Ga0066905_10187962023300005713Tropical Forest SoilMFAIGPKRTRAIAPQMSAFGGKPDITFAGSPLSRSLLGVNRTWAGAVQM
Ga0066905_10226222523300005713Tropical Forest SoilMSAIGPKRTSALAPHMSAFGGKADMTFCGNPRSRSLLGVKRTCLLALHMSAY
Ga0066903_10049215013300005764Tropical Forest SoilMSAIGPKRTLASALHMSAFGGKADMAFCGISLSWSLLGVKQTCSLAAHMFAF
Ga0066903_10124354223300005764Tropical Forest SoilMSAFGPKRTFGFALHMSAFEGKAEMTVCGSPLLRSLLGVK
Ga0066903_10254010513300005764Tropical Forest SoilMMSGTSAIGPKRTSLVAPHMSALGGKADMTVCASPLSGRYRG*
Ga0066903_10353684423300005764Tropical Forest SoilMSAFGPKQTWPLALHMSAFSGKADMTFRGCLLLRSLLG*
Ga0075417_1009306233300006049Populus RhizosphereMSAFGPKQTSLVAPHMSAFGGKADMTSCGDPLLRSLLGL
Ga0075422_1030826413300006196Populus RhizosphereMSGMSAIGPKRTLTSAPHMSAFGGEADMTVCGCLLSRSLLGVKRTWPF
Ga0097621_10059590213300006237Miscanthus RhizosphereMSAFGPKQTWAVAPHMSAVGSKADMTFCENPLSRSLLGRE
Ga0075428_10023999113300006844Populus RhizosphereMSAFGPKQTWACAPHMSAFGGKADMGYCGSPLSRSLLGVKRTW
Ga0075428_10057536133300006844Populus RhizosphereMVMSAFGPKQTSGSAPHMSAFGGKADMTVCGNPLSRS
Ga0075428_10252832223300006844Populus RhizosphereMSAFGPKQTSASALHMSAIGCKADMAFCGITLSRSLSGVKRTWLVAA
Ga0075421_10013877823300006845Populus RhizosphereMLFAALHESAIGPKRTSLVAPHMSAFGGKADMAFCENPLSRSLLGVKRT*
Ga0075431_10206042913300006847Populus RhizosphereMNGRMSAFGPKRTSLVAPHMSAFGGKADMTVCGNPL
Ga0075433_1037168743300006852Populus RhizosphereMSAIGPKRTSLVAPHRSAFGGKADIACCENPLSWSLLGVTRTTLTR
Ga0075433_1056498523300006852Populus RhizosphereMSAFGPKQTSLVAPHMSAFGGKADMTVCGNPLSRSL
Ga0075420_10173999123300006853Populus RhizosphereMNGRMSAFGPKRTSLVAPHMSAFGGKADMTVCGNPLLRSLLGAKRTCLI
Ga0075426_1093445213300006903Populus RhizosphereLNFEMSAIGPKQTLLIAPQMSAFVAKADMAFWGISLSRSLLGVKRTWLVAA
Ga0075435_10009118763300007076Populus RhizosphereMSAIGPKQTSPFALHMSAFGVEADMTVFGNPLSRSRV*
Ga0111539_1067314123300009094Populus RhizosphereMNGGMSAIGPKQTWAAAPHMSAFGGKADMAFCENPLSRSLLGVKR
Ga0111539_1231066413300009094Populus RhizosphereMSAIGPKRTFLVAPHMSAFGGKADMGYCGSPLSRSLLGVKRTWVGALHMS
Ga0075418_1019757723300009100Populus RhizosphereMSAIGPKRTFLVAPHMSAFGGKADMAYCGMSLSRSLL
Ga0114129_1056561813300009147Populus RhizosphereMSAIAPKQTLVSALHMSAFGGKADMACCGNPLSRSLL
Ga0114129_1063659413300009147Populus RhizosphereMSAFGPKQTWACAPHMSAFGGKADMGYCGSPLSRSLLGVKRTWV
Ga0111538_1075501713300009156Populus RhizosphereMDFAAMHESAIGPKRTSVAASHMSALGGKADMACCGNSLSRSLLGVKRTCPF
Ga0126380_1039160313300010043Tropical Forest SoilMSAIGPMQTCSFAPHMSAFGGKADMTICACLLLRLLLGVKRTWR
Ga0126382_1164602913300010047Tropical Forest SoilMSAFGPKRTFLFALHMSAFGGKADMTVCGNPLSQSPLGVK
Ga0126378_1030166923300010361Tropical Forest SoilMSAFGPKQTCACAVQESAFGGKADMTFHGKSLSWSLLGVKRTWAGAAQ
Ga0126377_1029156543300010362Tropical Forest SoilMIFFCAAHKSAFGPKQTSLVAPHMSAFGCKADMTLCGSPLSRSLLGVKRT
Ga0126377_1145412113300010362Tropical Forest SoilMSAIGPKRTSLVAPHVSAFGGKADMTVCWSPLSRSLLGVKRT
Ga0126377_1300297123300010362Tropical Forest SoilMLVMSAYSPKQTSAGAPHMSAFGGKADMAFCGISLSRSLLGVKR
Ga0126379_1332997713300010366Tropical Forest SoilMSAIGPKQTWPIALHMSAFGGEADMTFCGISLSRLLLGVKQ
Ga0134125_1049642813300010371Terrestrial SoilMSAIGPKPTSLVAAHASAFGGEADMAFCGSPLLRSLS
Ga0105239_1143520413300010375Corn RhizosphereMSPMSAIGPKRTYRFALHMSAFGGKADMTFCGSLLSWSLLGAKRT
Ga0105246_1038369723300011119Miscanthus RhizosphereMSAFGPKQTSPIALHMSAFGGKADMAFRGSPLLRS
Ga0164299_1065207913300012958SoilMSAIGPSQTSLVAVHMSAFGGKADMTIGTCPLLQSQLGVKRTWLV
Ga0164301_1005578823300012960SoilMSAIGPKQTWALALHMSAFGDKADITFFENPLSWSLLGVERT
Ga0164301_1080566323300012960SoilMSASAPKQTSLVAAHMSAFGGKADMAYRGNTLSRSLLGLKRTW
Ga0164302_1017739113300012961SoilVIAGMSAFGPKRTSLVAPHMSAFGGKADMIFCEGPLSRSLLGAKRTSL
Ga0126369_1007360943300012971Tropical Forest SoilVIALHMSAFGPKQTWLGALQMSAFGTKADMAFCGISLSR
Ga0126369_1085686823300012971Tropical Forest SoilMSAIGPKQTCTDALHMSAFGGKADMTGCRSPLLRSLLGVKRTWPFAA
Ga0164309_1074236223300012984SoilMLDFSTDLSAIGPKRTFLVALHMSAFGGKADMAVCENPLSR
Ga0164308_1035700813300012985SoilMSAIGPKQTWAVAPHMSAFRGNADVTFCGNKLSRSLLG
Ga0157380_1332469923300014326Switchgrass RhizosphereMSGMSAIGPKRTLTSAPHMSAFGGEADMTVCGCLLSRSLLGVKRTSHFAAQ
Ga0132258_1091595213300015371Arabidopsis RhizosphereVRMSAIGPERTSLVAPHMSAFGGKADMTLRGNPLSRSLSGVK
Ga0132258_1238661513300015371Arabidopsis RhizosphereMSALGPKRTLSFATHMSAFEGKADMTFCGNPLSRSLLG
Ga0132256_10080557913300015372Arabidopsis RhizosphereMSAIGPKPTLAFAAHMSASRGKADMTISASPLSRSLFGLKRTWLFAL
Ga0132255_10093774913300015374Arabidopsis RhizosphereMSAIGTKRTSPVAPHMSAFGGKADMAFCGNPLSRSLLRVKRTS
Ga0132255_10139103933300015374Arabidopsis RhizosphereMMSAIGPKRTCVAALHESAIGGKADMTIGTCPLSWSLLGVKR
Ga0182039_1210944213300016422SoilMSAIGPKRTSLIAPHMSAFGGKAEMAFFGMSLSRSLLGVKRTWLF
Ga0187785_1027499523300017947Tropical PeatlandMIGTMSAFGPKQTLRCALHESAFGGKADMTVCRSPLSQSLLGVK
Ga0187765_1133385213300018060Tropical PeatlandMSATQPTRPVAMHMSTFGGKADMAGCGSPLLRSLSGAKRTWLFA
Ga0207663_1014254013300025916Corn, Switchgrass And Miscanthus RhizosphereVIAGMSAFGPKRTSLVAPHMSAFGGKADMIFCEGPLSRSLLGA
Ga0207670_1077951323300025936Switchgrass RhizosphereMSAIGPKRTSLAAPNMSAFGGKADMTVCGVSLLRSLLVESGHGLLRRT
Ga0207668_1055722223300025972Switchgrass RhizosphereMSAFGPKQTSPIALHMSAFGGKADMAFRGSPLLRSLLGAKRTWRF
Ga0207703_1098471413300026035Switchgrass RhizosphereMSAFGPKQTWAVAPHMSAVGSKADMTFCENPLSRSLLGREAR
Ga0207683_1170589123300026121Miscanthus RhizosphereMSAFGPKQTWAVAPHMSAVGSKADMTFCENPLSRSL
Ga0209814_1024805213300027873Populus RhizosphereMSAIGPKQTWAFALHMSAFGGKADMTVCGNPLSRSLLGAKRTSH
Ga0209481_1003659233300027880Populus RhizosphereMSAIGPKRTSLVALHMSALGGKADMTISACLLLWSLLGVKRTSIIAAH
Ga0209481_1018893723300027880Populus RhizosphereMSAFGPKQTSLVAPHMSAFGGKADMTSCGDPLLRSLLGLKRTSLFAVRM
Ga0209382_1009331043300027909Populus RhizosphereMLFAALHESAIGPKRTSLVAPHMSAFGGKADMAFCENPLSRSLLGVKRT
Ga0209382_1062849813300027909Populus RhizosphereMDFAAMHESAIGPKRTSVAASHMSALGGKADMACCGNSLSRSLLGVKRTCP
Ga0209382_1113388123300027909Populus RhizosphereMSAIGPKRTSLVALHMSAFGGKADMTLCGNPLLRSLLGASGRA
Ga0318541_1076973823300031545SoilMSAIGPKRTSTSAPHMSAFGMKADMTVCGSPLLRSLLGAKRTSASALHM
Ga0318542_1075814613300031668SoilMSAFGPKRTLAIALHMSALRGKADMTVCGSPLSRSLLGVKRTCLCALRMSAY
Ga0310904_1001814843300031854SoilMSGMSAIGPKRTLTSAPHMSAFGGEADMTVCGCLLSRSLLGVKRTSHFAAQMSA
Ga0306923_1053336823300031910SoilMSAIGPKQTSLVAPHMSAFGGKADMAVCGSPLSRSLLGVKRTWLVAAH
Ga0310884_1013800113300031944SoilMSVAMSAIGPKQTSLVAPHMSAFRGRADMTFCGGPLSRSLLGVKRTSLFVAH
Ga0310910_1151869223300031946SoilMSAIGPNQTSASAAHMSAFRGKADMIVCGRPLSRSLLGVKRI
Ga0310909_1044507423300031947SoilAVMSAYGPKQTFLFALHMSAFGGKADMTLCGNSLLRSLLGVKRT
Ga0318531_1019949113300031981SoilKDPGAVMSAYGPKQTFLFALHMSAFGGKADMTLCGNSLLRSLLGVKRT
Ga0310897_1000446483300032003SoilMSVAMSAIGPKQTSLVAPHMSAFRGRADMTFCGGPLSRSLLGVKRT
Ga0318506_1043218613300032052SoilMSAFGPKRTLAIALHMSALRGKADMTVCGSPLSRSLLGVK
Ga0306924_1096687523300032076SoilMSAFGPKRTSPVAPHMSAFGGKADMAFCGISLSMSLLGLKRT
Ga0307471_10275647723300032180Hardwood Forest SoilMSAFGPKQTCSFAPHMSAFGGKADMAYCGMSLSRSLLGVKQ
Ga0335082_1007450853300032782SoilMSAIGPKQKWVGAPHRSASGSKADMTFSGGPLSRSLFGAK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.