Basic Information | |
---|---|
Family ID | F097761 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 104 |
Average Sequence Length | 42 residues |
Representative Sequence | MIPLASEAWPAVFGGLIPIVGLVAIGYLIVRAVRDNDEDDD |
Number of Associated Samples | 89 |
Number of Associated Scaffolds | 104 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 47.57 % |
% of genes near scaffold ends (potentially truncated) | 3.85 % |
% of genes from short scaffolds (< 2000 bps) | 64.42 % |
Associated GOLD sequencing projects | 72 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.52 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (98.077 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (17.308 % of family members) |
Environment Ontology (ENVO) | Unclassified (37.500 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (45.192 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.72% β-sheet: 0.00% Coil/Unstructured: 49.28% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 104 Family Scaffolds |
---|---|---|
PF00067 | p450 | 29.81 |
PF12437 | GSIII_N | 4.81 |
PF00120 | Gln-synt_C | 3.85 |
PF00149 | Metallophos | 2.88 |
PF12680 | SnoaL_2 | 1.92 |
PF00440 | TetR_N | 1.92 |
PF07690 | MFS_1 | 1.92 |
PF01391 | Collagen | 1.92 |
PF00795 | CN_hydrolase | 0.96 |
PF07728 | AAA_5 | 0.96 |
PF01292 | Ni_hydr_CYTB | 0.96 |
PF04055 | Radical_SAM | 0.96 |
PF00909 | Ammonium_transp | 0.96 |
PF05762 | VWA_CoxE | 0.96 |
PF04087 | DUF389 | 0.96 |
PF02405 | MlaE | 0.96 |
PF01336 | tRNA_anti-codon | 0.96 |
PF13406 | SLT_2 | 0.96 |
PF01171 | ATP_bind_3 | 0.96 |
PF00679 | EFG_C | 0.96 |
PF00753 | Lactamase_B | 0.96 |
PF12867 | DinB_2 | 0.96 |
PF06772 | LtrA | 0.96 |
PF07366 | SnoaL | 0.96 |
COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
---|---|---|---|
COG2124 | Cytochrome P450 | Defense mechanisms [V] | 29.81 |
COG0004 | Ammonia channel protein AmtB | Inorganic ion transport and metabolism [P] | 0.96 |
COG0037 | tRNA(Ile)-lysidine synthase TilS/MesJ | Translation, ribosomal structure and biogenesis [J] | 0.96 |
COG0301 | Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.96 |
COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 0.96 |
COG0519 | GMP synthase, PP-ATPase domain/subunit | Nucleotide transport and metabolism [F] | 0.96 |
COG0603 | 7-cyano-7-deazaguanine synthase (queuosine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.96 |
COG0767 | Permease subunit MlaE of the ABC-type intermembrane phospholipid transporter Mla | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
COG1606 | ATP-utilizing enzyme, PP-loop superfamily | General function prediction only [R] | 0.96 |
COG1808 | Uncharacterized membrane protein AF0785, contains DUF389 domain | Function unknown [S] | 0.96 |
COG1969 | Ni,Fe-hydrogenase I cytochrome b subunit | Energy production and conversion [C] | 0.96 |
COG2864 | Cytochrome b subunit of formate dehydrogenase | Energy production and conversion [C] | 0.96 |
COG3038 | Cytochrome b561 | Energy production and conversion [C] | 0.96 |
COG3658 | Cytochrome b subunit of Ni2+-dependent hydrogenase | Energy production and conversion [C] | 0.96 |
COG4117 | Thiosulfate reductase cytochrome b subunit | Inorganic ion transport and metabolism [P] | 0.96 |
COG4292 | Low temperature requirement protein LtrA (function unknown) | Function unknown [S] | 0.96 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.08 % |
Unclassified | root | N/A | 1.92 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908044|A5_c1_ConsensusfromContig49714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 663 | Open in IMG/M |
2140918007|ConsensusfromContig182650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9 | 855 | Open in IMG/M |
2170459014|G1P06HT02FPTRR | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300001161|JGI12135J13285_100311 | All Organisms → cellular organisms → Bacteria | 3199 | Open in IMG/M |
3300001537|A2065W1_10139902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 1562 | Open in IMG/M |
3300002568|C688J35102_119610931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 731 | Open in IMG/M |
3300002906|JGI25614J43888_10001677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 6685 | Open in IMG/M |
3300002906|JGI25614J43888_10027066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1819 | Open in IMG/M |
3300003987|Ga0055471_10211123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 608 | Open in IMG/M |
3300003992|Ga0055470_10131005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 645 | Open in IMG/M |
3300003992|Ga0055470_10242057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 502 | Open in IMG/M |
3300004071|Ga0055486_10075056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9 | 727 | Open in IMG/M |
3300004081|Ga0063454_100533580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9 | 836 | Open in IMG/M |
3300004081|Ga0063454_101482893 | Not Available | 579 | Open in IMG/M |
3300005329|Ga0070683_100687402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 980 | Open in IMG/M |
3300005337|Ga0070682_100000032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 155141 | Open in IMG/M |
3300005337|Ga0070682_100108240 | All Organisms → cellular organisms → Bacteria | 1847 | Open in IMG/M |
3300005337|Ga0070682_101291561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9 | 620 | Open in IMG/M |
3300005339|Ga0070660_101001737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 706 | Open in IMG/M |
3300005340|Ga0070689_100384677 | All Organisms → cellular organisms → Bacteria | 1183 | Open in IMG/M |
3300005345|Ga0070692_10077292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1786 | Open in IMG/M |
3300005406|Ga0070703_10218652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 757 | Open in IMG/M |
3300005435|Ga0070714_100292701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 1516 | Open in IMG/M |
3300005436|Ga0070713_100088732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 2655 | Open in IMG/M |
3300005439|Ga0070711_100152950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 1742 | Open in IMG/M |
3300005459|Ga0068867_100000454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 27165 | Open in IMG/M |
3300005764|Ga0066903_102906938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 929 | Open in IMG/M |
3300005841|Ga0068863_100017941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 6773 | Open in IMG/M |
3300005842|Ga0068858_100000017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 186913 | Open in IMG/M |
3300005898|Ga0075276_10114439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 602 | Open in IMG/M |
3300006046|Ga0066652_100022949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4329 | Open in IMG/M |
3300006175|Ga0070712_101627343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 565 | Open in IMG/M |
3300006804|Ga0079221_11063588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 615 | Open in IMG/M |
3300009093|Ga0105240_10176758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium | 2523 | Open in IMG/M |
3300009098|Ga0105245_10004472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 12358 | Open in IMG/M |
3300009176|Ga0105242_10003474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 12252 | Open in IMG/M |
3300009176|Ga0105242_10008217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 8019 | Open in IMG/M |
3300009840|Ga0126313_10462220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9 | 1013 | Open in IMG/M |
3300010371|Ga0134125_10576436 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9 | 1244 | Open in IMG/M |
3300010400|Ga0134122_11046764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9 | 804 | Open in IMG/M |
3300012957|Ga0164303_10863984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9 | 629 | Open in IMG/M |
3300012960|Ga0164301_10310096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1067 | Open in IMG/M |
3300012985|Ga0164308_10057259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2554 | Open in IMG/M |
3300012985|Ga0164308_12162105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9 | 518 | Open in IMG/M |
3300012987|Ga0164307_10290609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 1161 | Open in IMG/M |
3300012987|Ga0164307_10463554 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
3300012987|Ga0164307_10477790 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
3300012988|Ga0164306_10015225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4092 | Open in IMG/M |
3300012989|Ga0164305_10968052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 721 | Open in IMG/M |
3300013104|Ga0157370_10015334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7794 | Open in IMG/M |
3300013306|Ga0163162_10176296 | All Organisms → cellular organisms → Bacteria | 2263 | Open in IMG/M |
3300013307|Ga0157372_10000407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 47331 | Open in IMG/M |
3300013308|Ga0157375_10000194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 56860 | Open in IMG/M |
3300013308|Ga0157375_10001744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 18673 | Open in IMG/M |
3300013503|Ga0120127_10000041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 38635 | Open in IMG/M |
3300014256|Ga0075318_1003455 | All Organisms → cellular organisms → Bacteria | 1855 | Open in IMG/M |
3300014256|Ga0075318_1105839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 559 | Open in IMG/M |
3300014323|Ga0075356_1002085 | All Organisms → cellular organisms → Bacteria | 3033 | Open in IMG/M |
3300014968|Ga0157379_12476853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9 | 519 | Open in IMG/M |
3300017792|Ga0163161_10649800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9 | 874 | Open in IMG/M |
3300017792|Ga0163161_11105358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9 | 681 | Open in IMG/M |
3300019361|Ga0173482_10259365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9 | 745 | Open in IMG/M |
3300019868|Ga0193720_1004847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium | 1838 | Open in IMG/M |
3300019881|Ga0193707_1029056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9 | 1810 | Open in IMG/M |
3300020001|Ga0193731_1119128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9 | 671 | Open in IMG/M |
3300020034|Ga0193753_10113571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9 | 1334 | Open in IMG/M |
3300020070|Ga0206356_11791050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium | 850 | Open in IMG/M |
3300021363|Ga0193699_10070638 | All Organisms → cellular organisms → Bacteria | 1378 | Open in IMG/M |
3300024347|Ga0179591_1209223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 2364 | Open in IMG/M |
3300025625|Ga0208219_1070601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium | 828 | Open in IMG/M |
3300025780|Ga0210100_1000024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 33835 | Open in IMG/M |
3300025898|Ga0207692_10727606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 645 | Open in IMG/M |
3300025913|Ga0207695_10272416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1588 | Open in IMG/M |
3300025915|Ga0207693_10332591 | All Organisms → cellular organisms → Bacteria | 1189 | Open in IMG/M |
3300025916|Ga0207663_10112216 | All Organisms → cellular organisms → Bacteria | 1851 | Open in IMG/M |
3300025919|Ga0207657_10195067 | All Organisms → cellular organisms → Bacteria | 1632 | Open in IMG/M |
3300025927|Ga0207687_10001665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 15338 | Open in IMG/M |
3300025928|Ga0207700_10146170 | All Organisms → cellular organisms → Bacteria | 1949 | Open in IMG/M |
3300025932|Ga0207690_10008467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 6105 | Open in IMG/M |
3300025934|Ga0207686_10000035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 130483 | Open in IMG/M |
3300025934|Ga0207686_10011397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4868 | Open in IMG/M |
3300025936|Ga0207670_10334539 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
3300025938|Ga0207704_11061939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9 | 687 | Open in IMG/M |
3300025939|Ga0207665_11372769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 563 | Open in IMG/M |
3300025944|Ga0207661_10568598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1039 | Open in IMG/M |
3300025947|Ga0210067_1001668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 2562 | Open in IMG/M |
3300026035|Ga0207703_10000030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 199014 | Open in IMG/M |
3300026088|Ga0207641_10002521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 16875 | Open in IMG/M |
3300026089|Ga0207648_10009090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 9553 | Open in IMG/M |
3300026304|Ga0209240_1050631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 1565 | Open in IMG/M |
3300026319|Ga0209647_1000207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 54684 | Open in IMG/M |
3300027383|Ga0209213_1008566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1830 | Open in IMG/M |
3300027524|Ga0208998_1000003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 198932 | Open in IMG/M |
3300028556|Ga0265337_1002592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8185 | Open in IMG/M |
3300028790|Ga0307283_10039710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9 | 1086 | Open in IMG/M |
3300031184|Ga0307499_10001535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6594 | Open in IMG/M |
3300031198|Ga0307500_10031340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1206 | Open in IMG/M |
3300031235|Ga0265330_10298327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 679 | Open in IMG/M |
3300031242|Ga0265329_10089681 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
3300031938|Ga0308175_100822979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9 | 1017 | Open in IMG/M |
3300031938|Ga0308175_101910866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 665 | Open in IMG/M |
3300032133|Ga0316583_10074888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9 | 1184 | Open in IMG/M |
3300033433|Ga0326726_10045291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3847 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 17.31% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.62% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 5.77% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 5.77% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 4.81% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.85% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 3.85% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.85% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.88% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.88% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.88% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.88% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.88% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.88% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.92% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 1.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.92% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.92% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.92% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.92% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.92% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.96% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.96% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.96% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.96% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.96% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.96% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.96% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.96% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.96% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.96% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.96% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908044 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5 | Environmental | Open in IMG/M |
2140918007 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_all | Environmental | Open in IMG/M |
2170459014 | Litter degradation PV2 | Engineered | Open in IMG/M |
3300001161 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M2 | Environmental | Open in IMG/M |
3300001537 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-65 cm-11A)- 1 week illumina | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
3300003992 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1 | Environmental | Open in IMG/M |
3300004071 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D2 | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005898 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_405 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300013503 | Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M | Environmental | Open in IMG/M |
3300014256 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleB_D2 | Environmental | Open in IMG/M |
3300014323 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D1 | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300019868 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s1 | Environmental | Open in IMG/M |
3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
3300020034 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2 | Environmental | Open in IMG/M |
3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025625 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025780 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1 (SPAdes) | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025947 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
3300027383 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027524 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Host-Associated | Open in IMG/M |
3300028790 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122 | Environmental | Open in IMG/M |
3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Host-Associated | Open in IMG/M |
3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Host-Associated | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Host-Associated | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
A5_c1_01283910 | 2124908044 | Soil | MIVLAAEAWPAVFGGFIPILGLAAIGYIIYRAVRDDGDDE |
A_all_C_02168390 | 2140918007 | Soil | VIAFATEAWPAVFGGLIPILGLAGIGYIIYRAVRSDDEDEE |
2PV_03399810 | 2170459014 | Switchgrass, Maize And Mischanthus Litter | TFAAEAWTAVFAGLIPIVGLVAVGYLIYRAVRDEDDGDSSE |
JGI12135J13285_1003113 | 3300001161 | Forest Soil | LIPAGTEAWPAVFGGLIPILGLALIAYIIWKAVKDDGSDEKDE* |
A2065W1_101399023 | 3300001537 | Permafrost | MAVIPLATEAWPAVFGGLIPILGLAAIGYVIVRAVRDRDDED* |
C688J35102_1196109312 | 3300002568 | Soil | MLFAAAETWWAVLGGLIPILGLAASGYLIYRALRDPSSKNEEE* |
JGI25614J43888_100016773 | 3300002906 | Grasslands Soil | MVLASEAWPAVFGGLIPIVGLVAIGYLIVRAVRDNDQDDD* |
JGI25614J43888_100270662 | 3300002906 | Grasslands Soil | VIPCASEAWPVVFGGLIPILGLAGGGYLIYRAVRDDDSNDDDK* |
Ga0055471_102111232 | 3300003987 | Natural And Restored Wetlands | LIPAATEAWPAVFGGLIPIIGLAAIGYLIWRAVRDGDEDDG* |
Ga0055470_101310052 | 3300003992 | Natural And Restored Wetlands | VIPLATEAWPAVFGGLIPIVGLAAAGYLIYRAVRNEDDEDQSR* |
Ga0055470_102420571 | 3300003992 | Natural And Restored Wetlands | MIPLAAEAWPAVLGGLIPILGLAAAGYLLYRAVKNNDEP* |
Ga0055486_100750562 | 3300004071 | Natural And Restored Wetlands | VTPLAAEAWPAVFGGLIPIIGLAAVGYLIIRAVRDRDDDE* |
Ga0063454_1005335802 | 3300004081 | Soil | VTPFAAEAWPAVFGGLIPILGLAAIGYVIYRAVRDSDEDDE* |
Ga0063454_1014828932 | 3300004081 | Soil | VTPLAAEAWPAVFGGLIPILGLALIAYIIYRAVKDDGNDGNDEM* |
Ga0070683_1006874022 | 3300005329 | Corn Rhizosphere | VTPIAAEAWQAVLFAGLIPIVGLAGAGYLLYRAARGDDADDG* |
Ga0070682_1000000322 | 3300005337 | Corn Rhizosphere | VLPSATEAWPAIFGGLIPLVGLLAIGYLIWRAIRDGNDEEN* |
Ga0070682_1001082402 | 3300005337 | Corn Rhizosphere | VIPTAAEAWPAVFGGLIPILGLAAIGYLIYRAVRNGDDDE* |
Ga0070682_1012915612 | 3300005337 | Corn Rhizosphere | VTPLAAEAWPAVFGGLIPILGLAAIGYIIYRAVHDNDEEDE* |
Ga0070660_1010017372 | 3300005339 | Corn Rhizosphere | VIPAATEAWPAVFGGLIPIVGLGAIGYIIWRAVREPDEDDGEQ* |
Ga0070689_1003846772 | 3300005340 | Switchgrass Rhizosphere | MTPTAAEAWPAIFGGLIPIIGLAAIGYLIYRAVKDGSDDEDESP* |
Ga0070692_100772922 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | VLPTAASETWLAVLGGLIPILGLAAVSYIIYRAVRDDAGNDEEE* |
Ga0070703_102186522 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | VIALAAEAWPAVFSGLIPILGLVGVGYLLVRAARDQDGDDE* |
Ga0070714_1002927012 | 3300005435 | Agricultural Soil | VPLFATEAWPAVFGGLIPIIGLGAIGYLIYRAVKDDGANGNDEP* |
Ga0070713_1000887323 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPIATEAWPAIFGGLIPIIGLVAVGYIIYRAVKDGDDDEGKSGRG* |
Ga0070711_1001529502 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VIPAATEAWPAIFGGLIPIIGLIAAGYLIYRAVRDDDSNDEEQ* |
Ga0068867_1000004543 | 3300005459 | Miscanthus Rhizosphere | VILFAAEAWSAVFGGLIPILGLAGIGYVLVRAARDRDEDGE* |
Ga0066903_1029069382 | 3300005764 | Tropical Forest Soil | VIPAAAEAWPAVFGGLIPIVGLAGIGYIIYRATRDPNDGDGEGK* |
Ga0068863_1000179412 | 3300005841 | Switchgrass Rhizosphere | VIPAATEAWPAVFGGLIPILGLALIAYIIWRAVKDDGNDEDE* |
Ga0068858_10000001735 | 3300005842 | Switchgrass Rhizosphere | MIPLASEAWPAVFGGLIPIVGLVAIGWLIVRAVRDNDEDDE* |
Ga0075276_101144391 | 3300005898 | Rice Paddy Soil | MAPLATEAWPAVFGGLIPILGLAAIGWIVVRAARDHDGD* |
Ga0066652_1000229493 | 3300006046 | Soil | MIVVAAEAWPAVFGGLIPILGLAGIGYVVVRAARDRDEE* |
Ga0070712_1016273432 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VTPFAAEAWAAVFGGLIPIVGLVAIGWLIVRAVRDTGDDDDVPGGP* |
Ga0079221_110635882 | 3300006804 | Agricultural Soil | VLPTAAAETWLAVLGGLIPILGLALVGYIIYRAVRDDASNNEDK* |
Ga0105240_101767583 | 3300009093 | Corn Rhizosphere | MPVATEAWPAVFGGLIPILGLALIAYIIWRAVRDNDESDE* |
Ga0105245_1000447212 | 3300009098 | Miscanthus Rhizosphere | MPAATEAWPAIFGGLIPIIGLALIGYVIYLAVKKSDDDEDGSQ* |
Ga0105242_100034743 | 3300009176 | Miscanthus Rhizosphere | MPVATEAWPAVFGGLIPILGLALIAYIIYRAVKDDGNDDDE* |
Ga0105242_100082178 | 3300009176 | Miscanthus Rhizosphere | MIPLASEAWPAVFGGLIPIVGLVAIGWLIIRAVRDNDEDDE* |
Ga0126313_104622201 | 3300009840 | Serpentine Soil | MIPAAAEAWPAVFGGLIPILGLTLIAYIIYRAVKDDGNDEK* |
Ga0134125_105764362 | 3300010371 | Terrestrial Soil | LIPSAAEAWPAVFGGLIPILGLAAIGYVIYRAVRDDDESDDE* |
Ga0134122_110467642 | 3300010400 | Terrestrial Soil | LIVLATEAWAAVFGGLIPILGLGAVGYLLIRAVRDNDE* |
Ga0164303_108639842 | 3300012957 | Soil | LIVFATEAWAAVFGGLIPIAGLGAIGYLLVRAVRDNDEEEE* |
Ga0164301_103100961 | 3300012960 | Soil | VIPLAAEAWAAVFGGLIPIVGLVAIGWLIVRAVRDTDEEDGGPGGP* |
Ga0164308_100572592 | 3300012985 | Soil | VIPAATEAWPAVFGGLIPIIGLVAVGYLIFRAVKDSSDDEDESQ* |
Ga0164308_121621052 | 3300012985 | Soil | VSHFLLAAAETWLAVFGGLIPILGIAAVGYIVIRASRNDEEDPDGP* |
Ga0164307_102906093 | 3300012987 | Soil | MPLAVESWIAVLFAGLIPILGALAVLYLIVRAVRDNDEGPDPE* |
Ga0164307_104635542 | 3300012987 | Soil | VIPTATEAWPAIFGGLIPIIGLAAVGYVIWRAVKDSDDDEDEPR* |
Ga0164307_104777901 | 3300012987 | Soil | MTFAAEAWTAVFAGLIPIVGLVAVGYLIYRAVRDEDDGDSSE* |
Ga0164306_100152252 | 3300012988 | Soil | LIVFATEAWAAVFGGLIPILGLGAIGYLLIRAIRDNDEEDE* |
Ga0164305_109680521 | 3300012989 | Soil | MVLATEAWTAVLGGLIPIVGLAAVGYLIVRAVRDNDEDGGD* |
Ga0157370_100153343 | 3300013104 | Corn Rhizosphere | VILLASEAWPAVFGGLIPIVGLVAIGWLIVRAVRDSDEDDD* |
Ga0163162_101762962 | 3300013306 | Switchgrass Rhizosphere | VIASATEAWPAVFGGLIPILGLAAIGYLIYRAVRSSDDDA* |
Ga0157372_1000040722 | 3300013307 | Corn Rhizosphere | VLPVATEAWPAIFGGLIPIIGLAAIGYVIYRAVKNTGDDEDGEK* |
Ga0157375_1000019420 | 3300013308 | Miscanthus Rhizosphere | LIPLASEAWPAVFGGLIPIVGLVAIGWLIVRAVRDNDED* |
Ga0157375_1000174410 | 3300013308 | Miscanthus Rhizosphere | VTLATEAWPAVFGGLIPIVGLVAIGYLIYRAVKDDPNDDGPDE* |
Ga0120127_1000004123 | 3300013503 | Permafrost | MIPLASEAWPAVFGGLIPIVGLVAIGYLIVRAVRDNDENDE* |
Ga0075318_10034552 | 3300014256 | Natural And Restored Wetlands | MTPLATEAWPAVFGGLIPVIGFGAAGYLIYRAVKAPPDETDHDDEP* |
Ga0075318_10475601 | 3300014256 | Natural And Restored Wetlands | AEEAWEPVLFGGMIPILGALAVGYIIWRAVRDNDESDEE* |
Ga0075318_11058391 | 3300014256 | Natural And Restored Wetlands | VICQATEAWPAVFGGLIPIIGLAAIGYLIYRAVRDGDEDDG* |
Ga0075356_10020853 | 3300014323 | Natural And Restored Wetlands | MFLVLAEEAWQPVLLGGLIPILGLTGLGYLLYRAVRNNDEK* |
Ga0157379_124768532 | 3300014968 | Switchgrass Rhizosphere | VIPAAAEAWPAVFGGLIPILGLAGISYIIWRAVKDDGNDDE* |
Ga0163161_106498002 | 3300017792 | Switchgrass Rhizosphere | MIPLASEAWPAVFGGLIPILGLLAIGYLIVRAVRDNDEGDE |
Ga0163161_111053582 | 3300017792 | Switchgrass Rhizosphere | MIPFAAEAWLAVFGGLIPILGLVGIGYLIIRAVRDHD |
Ga0173482_102593651 | 3300019361 | Soil | VIANATEAWPAVFGGLIPILGLAAIGYLIYRAVRNSDDE |
Ga0193720_10048472 | 3300019868 | Soil | VTVLAPEAWPAVFGGLIPIVGLVALGYLIVRAVRDSDENDN |
Ga0193707_10290562 | 3300019881 | Soil | VIVLAAEAWPAVFGGLIPILGLAAIGYIIWRAVRDPDDDNKDE |
Ga0193731_11191282 | 3300020001 | Soil | MIPLASEAWPAVFGGLIPIVGLVAIGYLIVRAVRDNDEDDD |
Ga0193753_101135712 | 3300020034 | Soil | MIPAATEAWPAVFGGLIPILGLAAIAYVIYRAVRDSNGSDDE |
Ga0206356_117910501 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | VTPSATEAWPAVFGGLIPILGLAALGYLIYRAVKDNPDDDQ |
Ga0193699_100706382 | 3300021363 | Soil | LIPSATEAWPAVFGGLIPILGLAAIGYIIHRAVKNDGNDHSDDDPPFA |
Ga0179591_12092232 | 3300024347 | Vadose Zone Soil | VIPAAAEAWPAVFGGLIPILGLVAIGYLIYRAVRGGDEDD |
Ga0208219_10706012 | 3300025625 | Arctic Peat Soil | MSPLAAEAWPAVFGGFIPILGLAGIGYIIYRAVRSPDDEDDD |
Ga0210100_10000248 | 3300025780 | Natural And Restored Wetlands | MIPLAAEAWPAVLGGLIPILGLAAAGYLLYRAVKNNDEP |
Ga0207692_107276061 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MLAATPLAAEAWPAVFGGLIPILGLGAIGYIIYRAVKNDNES |
Ga0207695_102724161 | 3300025913 | Corn Rhizosphere | MPVATEAWPAVFGGLIPILGLALIAYIIWRAVRDNDESDE |
Ga0207693_103325912 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VTPFAAEAWAAVFGGLIPIVGLVAIGWLIVRAVRDTGDDDDVPGGP |
Ga0207663_101122162 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VIPAATEAWPAIFGGLIPIIGLIAAGYLIYRAVRDDDSNDEEQ |
Ga0207657_101950671 | 3300025919 | Corn Rhizosphere | DPGVIPAATEAWPAVFGGLIPIVGLGAIGYIIWRAVREPDEDDGEQ |
Ga0207687_100016656 | 3300025927 | Miscanthus Rhizosphere | MPAATEAWPAIFGGLIPIIGLALIGYVIYLAVKKSDDDEDGSQ |
Ga0207700_101461703 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPIATEAWPAIFGGLIPIIGLVAVGYIIYRAVKDGDDDEGKSGRG |
Ga0207690_100084676 | 3300025932 | Corn Rhizosphere | VIPAATEAWPAVFGGLIPIVGLGAIGYIIWRAVREPDEDDGEQ |
Ga0207686_1000003539 | 3300025934 | Miscanthus Rhizosphere | MPVATEAWPAVFGGLIPILGLALIAYIIYRAVKDDGNDDDE |
Ga0207686_100113974 | 3300025934 | Miscanthus Rhizosphere | MIPLASEAWPAVFGGLIPIVGLVAIGWLIIRAVRDNDEDDE |
Ga0207670_103345392 | 3300025936 | Switchgrass Rhizosphere | MTPTAAEAWPAIFGGLIPIIGLAAIGYLIYRAVKDGSDDEDESP |
Ga0207704_110619392 | 3300025938 | Miscanthus Rhizosphere | VSLATEAWPAVFGGLIPIVGLVAIAYLIIRAVRDHDDADDE |
Ga0207665_113727692 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VIPLAAEAWAAVFGGLIPIVGLVAIGWLIVRAVRDTDEDDQPPPG |
Ga0207661_105685982 | 3300025944 | Corn Rhizosphere | VTPIAAEAWQAVLFAGLIPIVGLAGAGYLLYRAARGDDADDG |
Ga0210067_10016682 | 3300025947 | Natural And Restored Wetlands | VTPLAAEAWPAVFGGLIPIIGLAAVGYLIIRAVRDRDDDE |
Ga0207703_1000003035 | 3300026035 | Switchgrass Rhizosphere | MIPLASEAWPAVFGGLIPIVGLVAIGWLIVRAVRDNDEDDE |
Ga0207641_100025212 | 3300026088 | Switchgrass Rhizosphere | VIPAATEAWPAVFGGLIPILGLALIAYIIWRAVKDDGNDEDE |
Ga0207648_100090903 | 3300026089 | Miscanthus Rhizosphere | VILFAAEAWSAVFGGLIPILGLAGIGYVLVRAARDRDEDGE |
Ga0209240_10506312 | 3300026304 | Grasslands Soil | VIPCASEAWPVVFGGLIPILGLAGGGYLIYRAVRDDDSNDDDK |
Ga0209647_100020719 | 3300026319 | Grasslands Soil | MVLASEAWPAVFGGLIPIVGLVAIGYLIVRAVRDNDQDDD |
Ga0209213_10085662 | 3300027383 | Forest Soil | VIVVAAEAWPAVFAGLIPIIGLVGVGYLIARAVRDRDDDQ |
Ga0208998_100000344 | 3300027524 | Forest Soil | LIPAGTEAWPAVFGGLIPILGLALIAYIIWKAVKDDGSDEKDE |
Ga0265337_10025922 | 3300028556 | Rhizosphere | LPLAAEAWPAVFGGFIPIIGLVAIGWLIYKAVRPPDDEGDG |
Ga0307283_100397102 | 3300028790 | Soil | LIPGATEAWPAVFGGLIPIIGLAAIGYIIYRAVRDSDEDDE |
Ga0307499_100015352 | 3300031184 | Soil | VIPLSAVSEGWTAVLAGLIPIVGLAAIAWLIVRAVRDNDEDDE |
Ga0307500_100313402 | 3300031198 | Soil | VIPLAAEAWPAVFGGLIPIIGLAAIGYLIIRAVRNNDEEDE |
Ga0265330_102983272 | 3300031235 | Rhizosphere | LRCESRSVGLPLAAEAWPAVFGGFIPIIGLVAIGWLIYKAVRPPDDEGDG |
Ga0265329_100896812 | 3300031242 | Rhizosphere | EAWPAVFGGFIPIIGLVAIGWLIYKAVRPPDDEGDG |
Ga0308175_1008229792 | 3300031938 | Soil | MIPVATEAWPAVFGGLIPIVGLVAIGWLIIRAVRDSDEDDE |
Ga0308175_1019108661 | 3300031938 | Soil | VLLLAAAETWLAVFGGLIPIIGLAAVGYLLYRAVRDTDNNDEEK |
Ga0316583_100748882 | 3300032133 | Rhizosphere | MIPLATEAWPAVFGGLIPIIGLVAVGWLIVRAVRDSDDDEGGPPGPT |
Ga0326726_100452912 | 3300033433 | Peat Soil | VIDLAVLTFATEAWPAVFGGLIPVIGLAGVGYLVLRAVRDDGEDEE |
⦗Top⦘ |