NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F097768

Metagenome / Metatranscriptome Family F097768

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F097768
Family Type Metagenome / Metatranscriptome
Number of Sequences 104
Average Sequence Length 51 residues
Representative Sequence LRGRDAVVGLYQAWEPVAAELFDRYPFGKLMVPDPQHDWPSALRAIRAAVRP
Number of Associated Samples 92
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.88 %
% of genes near scaffold ends (potentially truncated) 96.15 %
% of genes from short scaffolds (< 2000 bps) 98.08 %
Associated GOLD sequencing projects 87
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (71.154 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(24.038 % of family members)
Environment Ontology (ENVO) Unclassified
(35.577 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(43.269 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 48.75%    β-sheet: 0.00%    Coil/Unstructured: 51.25%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF00440TetR_N 25.96
PF08327AHSA1 10.58
PF07690MFS_1 4.81
PF14534DUF4440 1.92
PF07883Cupin_2 0.96
PF13432TPR_16 0.96
PF00583Acetyltransf_1 0.96
PF13474SnoaL_3 0.96
PF00999Na_H_Exchanger 0.96
PF13398Peptidase_M50B 0.96
PF07885Ion_trans_2 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG0025NhaP-type Na+/H+ or K+/H+ antiporterInorganic ion transport and metabolism [P] 0.96
COG0475Kef-type K+ transport system, membrane component KefBInorganic ion transport and metabolism [P] 0.96
COG3004Na+/H+ antiporter NhaAEnergy production and conversion [C] 0.96
COG3263NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domainsEnergy production and conversion [C] 0.96
COG4651Predicted Kef-type K+ transport protein, K+/H+ antiporter domainInorganic ion transport and metabolism [P] 0.96


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms71.15 %
UnclassifiedrootN/A28.85 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2040502001|FACENC_GAMC6GA01AOVPHNot Available511Open in IMG/M
2189573001|GZR05M102J0SRQNot Available522Open in IMG/M
2199352024|deeps__Contig_196957All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae604Open in IMG/M
3300005330|Ga0070690_100377399All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jatrophihabitantales → Jatrophihabitantaceae → Jatrophihabitans → Jatrophihabitans telluris1036Open in IMG/M
3300005332|Ga0066388_100599418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1724Open in IMG/M
3300005341|Ga0070691_10885239Not Available550Open in IMG/M
3300005436|Ga0070713_101633943All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jatrophihabitantales → Jatrophihabitantaceae → Jatrophihabitans → Jatrophihabitans telluris625Open in IMG/M
3300005436|Ga0070713_102145189Not Available541Open in IMG/M
3300005437|Ga0070710_10824056All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300005471|Ga0070698_101493630Not Available627Open in IMG/M
3300005541|Ga0070733_10775971All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300005547|Ga0070693_101666897Not Available502Open in IMG/M
3300005614|Ga0068856_100991645All Organisms → cellular organisms → Bacteria858Open in IMG/M
3300005616|Ga0068852_100351987All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Cellulomonas1438Open in IMG/M
3300005719|Ga0068861_101532845All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300005764|Ga0066903_102266401All Organisms → cellular organisms → Bacteria1048Open in IMG/M
3300005764|Ga0066903_103068412All Organisms → cellular organisms → Bacteria904Open in IMG/M
3300005841|Ga0068863_101175861Not Available772Open in IMG/M
3300005842|Ga0068858_102440798Not Available517Open in IMG/M
3300006028|Ga0070717_10816451All Organisms → cellular organisms → Bacteria848Open in IMG/M
3300006028|Ga0070717_11937755All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300006046|Ga0066652_101462673All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300006175|Ga0070712_101533463All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300006575|Ga0074053_12010545All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Cellulomonas1108Open in IMG/M
3300006954|Ga0079219_10227716All Organisms → cellular organisms → Bacteria1085Open in IMG/M
3300007076|Ga0075435_100997993All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300009012|Ga0066710_103230386Not Available625Open in IMG/M
3300009098|Ga0105245_12713374All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Planosporangium → Planosporangium flavigriseum548Open in IMG/M
3300009545|Ga0105237_11077024All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium811Open in IMG/M
3300010159|Ga0099796_10305357Not Available675Open in IMG/M
3300010322|Ga0134084_10463699Not Available507Open in IMG/M
3300010325|Ga0134064_10481174Not Available512Open in IMG/M
3300010361|Ga0126378_10572944All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1243Open in IMG/M
3300010371|Ga0134125_11177051All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium838Open in IMG/M
3300010371|Ga0134125_11749820Not Available676Open in IMG/M
3300012199|Ga0137383_10906139Not Available644Open in IMG/M
3300012210|Ga0137378_10457519All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1181Open in IMG/M
3300012349|Ga0137387_10625068Not Available780Open in IMG/M
3300012356|Ga0137371_11414118All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae509Open in IMG/M
3300012944|Ga0137410_11012252All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharothrix → Saccharothrix syringae708Open in IMG/M
3300012971|Ga0126369_12338617All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia621Open in IMG/M
3300012985|Ga0164308_11351130All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → environmental samples → uncultured Nocardioidaceae bacterium649Open in IMG/M
3300013105|Ga0157369_10803123All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia967Open in IMG/M
3300013105|Ga0157369_12379992Not Available536Open in IMG/M
3300013307|Ga0157372_11294290All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium841Open in IMG/M
3300014968|Ga0157379_10415500All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1238Open in IMG/M
3300015242|Ga0137412_10485391All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Candidatus Melainabacteria → unclassified Candidatus Melainabacteria → Candidatus Melainabacteria bacterium947Open in IMG/M
3300015372|Ga0132256_101775860All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium725Open in IMG/M
3300020082|Ga0206353_10543974All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Cellulomonas815Open in IMG/M
3300021168|Ga0210406_10933300All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae651Open in IMG/M
3300021432|Ga0210384_10617095All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia973Open in IMG/M
3300021479|Ga0210410_10198985All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1794Open in IMG/M
3300021559|Ga0210409_10321558All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1392Open in IMG/M
3300021560|Ga0126371_12929298All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300024222|Ga0247691_1043005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Cellulomonas685Open in IMG/M
3300025321|Ga0207656_10304577All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jatrophihabitantales → Jatrophihabitantaceae → Jatrophihabitans → Jatrophihabitans telluris789Open in IMG/M
3300025914|Ga0207671_10887358Not Available705Open in IMG/M
3300025916|Ga0207663_10219245All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Cellulomonas1383Open in IMG/M
3300025916|Ga0207663_10905077Not Available706Open in IMG/M
3300025926|Ga0207659_10458516All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Cellulomonas1074Open in IMG/M
3300025927|Ga0207687_10472535All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Planosporangium → Planosporangium flavigriseum1043Open in IMG/M
3300025927|Ga0207687_11702479Not Available540Open in IMG/M
3300025928|Ga0207700_10107303All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2240Open in IMG/M
3300025929|Ga0207664_10220010All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1646Open in IMG/M
3300026023|Ga0207677_10581030All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Cellulomonas981Open in IMG/M
3300026088|Ga0207641_10942841All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium858Open in IMG/M
3300026118|Ga0207675_101145227All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Planosporangium → Planosporangium flavigriseum798Open in IMG/M
3300026121|Ga0207683_10978856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium785Open in IMG/M
3300026121|Ga0207683_11272728All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Planosporangium → Planosporangium flavigriseum681Open in IMG/M
3300026316|Ga0209155_1209925All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium610Open in IMG/M
3300027523|Ga0208890_1004130All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Sagittula → Sagittula stellata → Sagittula stellata E-371680Open in IMG/M
3300027765|Ga0209073_10064549All Organisms → cellular organisms → Bacteria1232Open in IMG/M
3300028799|Ga0307284_10149330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Cellulomonas901Open in IMG/M
3300029636|Ga0222749_10665343All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium570Open in IMG/M
3300031543|Ga0318516_10813257All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia528Open in IMG/M
3300031572|Ga0318515_10600757All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia585Open in IMG/M
3300031713|Ga0318496_10575269Not Available623Open in IMG/M
3300031736|Ga0318501_10303119All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia853Open in IMG/M
3300031736|Ga0318501_10555655Not Available628Open in IMG/M
3300031744|Ga0306918_10271432All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1300Open in IMG/M
3300031777|Ga0318543_10414603All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria604Open in IMG/M
3300031779|Ga0318566_10212742All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia960Open in IMG/M
3300031793|Ga0318548_10557987Not Available558Open in IMG/M
3300031846|Ga0318512_10626096All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia549Open in IMG/M
3300031846|Ga0318512_10702376Not Available518Open in IMG/M
3300031896|Ga0318551_10759001All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300031912|Ga0306921_11025889All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria929Open in IMG/M
3300031938|Ga0308175_100411691All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae1415Open in IMG/M
3300031946|Ga0310910_10853019Not Available716Open in IMG/M
3300032039|Ga0318559_10359949All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria677Open in IMG/M
3300032044|Ga0318558_10500574Not Available606Open in IMG/M
3300032067|Ga0318524_10494746Not Available641Open in IMG/M
3300032090|Ga0318518_10378253All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia727Open in IMG/M
3300032174|Ga0307470_11014337All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Planosporangium → Planosporangium flavigriseum661Open in IMG/M
3300032261|Ga0306920_103110283All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia623Open in IMG/M
3300032770|Ga0335085_10019723All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia9656Open in IMG/M
3300032805|Ga0335078_12096065All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia601Open in IMG/M
3300032829|Ga0335070_12054110Not Available513Open in IMG/M
3300033004|Ga0335084_10916276All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia886Open in IMG/M
3300033134|Ga0335073_11543974All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Planosporangium → Planosporangium flavigriseum637Open in IMG/M
3300033290|Ga0318519_10702207All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia618Open in IMG/M
3300033290|Ga0318519_10714757Not Available613Open in IMG/M
3300033290|Ga0318519_10912106Not Available543Open in IMG/M
3300033803|Ga0314862_0138584Not Available584Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil24.04%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere11.54%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.73%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere4.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.85%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.88%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.88%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.88%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.88%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.92%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.92%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.92%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.92%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.92%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.96%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.96%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.96%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.96%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.96%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.96%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.96%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.96%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.96%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2040502001Soil microbial communities from sample at FACE Site 2 North Carolina CO2+EnvironmentalOpen in IMG/M
2189573001Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml)EnvironmentalOpen in IMG/M
2199352024Bare-fallow DEEP SOILEnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006575Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300024222Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK32EnvironmentalOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026316Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)EnvironmentalOpen in IMG/M
3300027523Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033803Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FACENCE_10303602040502001SoilRRRNLRGRDAVVRLYQAWDPVVSELFDRYPFPKLMVPDPHHDWPASLRAICAAVRP
FD2_013095302189573001Grass SoilVRLYQAWEPVVGELYDRYPFPKLMVPDPQHDWPAAMRSIRAAIRP
deeps_037643802199352024SoilVGPPPRLRGRDAVVGLYQAWEPVAAELFDRYPFGKLMVPDPQHDWPAAL
Ga0070690_10037739943300005330Switchgrass RhizosphereAWEPVAAELFDRYPFGKLMVPDPQHDWPSALRAIRAAVRP*
Ga0066388_10059941813300005332Tropical Forest SoilYQAWEPVVSQLYDRYPFGKLMVPDPRHDWPAALQTIYAAVRP*
Ga0070691_1088523933300005341Corn, Switchgrass And Miscanthus RhizosphereDSPWARRRGLRGRDAVVGLYQAWEPVAVELFDRYPFGKLMLPDPQHDWPSALRAVRAAVRP*
Ga0070713_10163394333300005436Corn, Switchgrass And Miscanthus RhizosphereLYRAWEPVAAELFDRYPFGKLMVPDPQHDWPSALRAIRAAVRP*
Ga0070713_10214518913300005436Corn, Switchgrass And Miscanthus RhizosphereWARRRGLRGRDAVVGLYQAWEPVAVELFDRYPFGKLMLPDPQHDWPSALRAVRAAVRP*
Ga0070710_1082405633300005437Corn, Switchgrass And Miscanthus RhizosphereRRGLRGRDAVVGLYQAWEPVAAELFDRYPFGKLMVPDPQHDWPSALRAIRAAVRP*
Ga0070698_10149363013300005471Corn, Switchgrass And Miscanthus RhizosphereYQAWDPVVRELFDRYPFPKLMVPNPHHDWPGSLHAICTALRP*
Ga0070733_1077597113300005541Surface SoilHDAVVRLYQAWEPVVTRLYRRYPFPKITVTDPQRDWPEALARICAAVRPSAANPS*
Ga0070693_10166689713300005547Corn, Switchgrass And Miscanthus RhizosphereNLRGRDAVVRLYQAWDPVVSELFDRYPFPKLMVPDPHHDWPASLRAICAAVRP*
Ga0068856_10099164523300005614Corn RhizosphereRRRGLRGRDAVVGLYQAWEPVAAELFDRYPFGKLMVPDPHYDWPSALRAIRAAVRP*
Ga0068852_10035198713300005616Corn RhizosphereYRAWEPVAAELFDRYPFGKLMVPDPQHDWPSALRAIRAAVRP*
Ga0068861_10153284513300005719Switchgrass RhizosphereLRGRDAVVGLYQAWEPVAAELFDRYPFGKLMVPDPQHDWPSALRAIRAAVRP*
Ga0066903_10226640133300005764Tropical Forest SoilHRNLRGRDAVVRLYQAWEPVVSQLYGRYPFGKLMVPDPQHDWQAALRAICAAVRP*
Ga0066903_10306841223300005764Tropical Forest SoilAFVENSPWARRRNLRGRDAVVRLYQAWEPMVSQLYDRYPFGKLMVFDPRHDWPAALQTIYAAVRP*
Ga0068863_10117586123300005841Switchgrass RhizosphereAFVQDSPWARRRDLRGRDAVVGLYRAWEPVAAELFDRYPFGKLMVPDPHYDWPSALRAIRAAVRP*
Ga0068858_10244079823300005842Switchgrass RhizosphereAWEPVAAELFDRYPFGKLMVPDPQHDWSSALRAIRAAVRP*
Ga0070717_1081645113300006028Corn, Switchgrass And Miscanthus RhizosphereLRGRDAVVGLYRAWEPVAAELFDRYPFGKLMVPDPHYDWPSALRAIRAAVRP*
Ga0070717_1193775533300006028Corn, Switchgrass And Miscanthus RhizosphereLYQAWEPVAAELFDRYPFGKLMVPDPQHDWPSALRAIRAAVRP*
Ga0066652_10146267313300006046SoilPWARRRDLRGRDAVVGLYQAWEPVAAGLFDRYPFGKLMLPDPQHDWPAALRALRAAVRP*
Ga0070712_10153346333300006175Corn, Switchgrass And Miscanthus RhizosphereAFVQDSPWARRRDLRGRDAVVGLYQAWEPVAAELFDRYPFGKLMVPDPQHDWPSALRAIRTAVRP*
Ga0074053_1201054533300006575SoilVGLYQAWEPVAARLFDQYPFGKLMVPDPQHDWPATLRVIRAAVRP*
Ga0079219_1022771623300006954Agricultural SoilVQDSPWARCRGLRGRDAVVGLYRAWEPVAAELFDRYPFGKLMVPDPHYDWPSALRAIRAAVRP*
Ga0075435_10099799313300007076Populus RhizosphereDAVVGLYQAWEPLAAELFDRYPFGKLMLSDPQHDWPAALRAVRAAVRP*
Ga0066710_10323038623300009012Grasslands SoilAVVQLYQAWEPVVSRLYDRYPFPKLMVPDPQHDWPAALRNICAAVRP
Ga0105245_1271337433300009098Miscanthus RhizosphereVGLYRAWEPVAVELFDRYPFGKLMLPDPQHDWPSALRAVRAAVRP*
Ga0105237_1107702423300009545Corn RhizosphereAWEPVAAELFDRYPFGKLMVPDPHYDWPSALRAIRAAVRP*
Ga0099796_1030535713300010159Vadose Zone SoilDCLWARRRNLRGRDAVVQLYQAWEPVATRLYDRYPFPKLMVPDPQHDWPAALRAIRTAVRP*
Ga0134084_1046369913300010322Grasslands SoilLHQAWEPVASQLYDRYPFGKLVVPDPHHDWPAALRTIRAAVRS*
Ga0134064_1048117413300010325Grasslands SoilLRGRDAVVQLHQAWEPVASQLYDRYPFGKLVVPDPHHDWPAALRTIRAAVRS*
Ga0126378_1057294423300010361Tropical Forest SoilVQLYQAWEPVVSQLYDGYPFPKLTVPDPHHDWPATLRVICAAVRP*
Ga0134125_1117705113300010371Terrestrial SoilVGLYRAWEPVAAELFDRYPFGKLMVPDPHYDWPSALRAIRAAVRP*
Ga0134125_1174982013300010371Terrestrial SoilRRHGLRGRDAVVGLYQAWEPAAARLYDRYPFGKLMVPDPQHDWPAALRAIRTAVRP*
Ga0137383_1090613923300012199Vadose Zone SoilAVVRLYQAWEPVVSELYIQYPFPKLMVRDPHHDWPASLHHICAAVRP*
Ga0137378_1045751913300012210Vadose Zone SoilSRNVAFVENSRWARCRNLRGQDAVAQLYQAWEAVVSQLYGRYSFPKLLVTDPQDDWPAAMTRICAAVRP*
Ga0137387_1062506823300012349Vadose Zone SoilLRGRDAVVRLYQAWEPMVSRLYDRYPFPKLMVPDPQHDWPAALRAICAAVRP*
Ga0137371_1141411813300012356Vadose Zone SoilLRGRDAVVQLYQAWEPVVSRLYDRYPFPKLMVPDPQHDWPAALRNICAAVRP*
Ga0137410_1101225223300012944Vadose Zone SoilVSELFDRYPFPKLMVPDPHHDWPASLRAICAAVRP*
Ga0126369_1233861713300012971Tropical Forest SoilVVRLYQAWEPVVSQLYDRYPFGKLVVPDPQLNWPAALHTICAAARP*
Ga0164308_1135113013300012985SoilAVIALYQAWEDVVNLLYDQYPFGKLMLTDPQHDWPAALTRIGAAVRP*
Ga0157369_1080312323300013105Corn RhizosphereRGRDAVVGLYRAWEPVAAELFDRYPFGKLMVPDPHYDWPSALRAIRAAVRP*
Ga0157369_1237999213300013105Corn RhizosphereRDAVVRLYQAWNPVVSELFDRYPFPKLMVPDPHHDWPASLRAICAALRP*
Ga0157372_1129429023300013307Corn RhizosphereLYRAWEPVAAELFDRYPFGKLMVPDPHYDWPSALRAIRAAVRP*
Ga0157379_1041550043300014968Switchgrass RhizosphereWEPVAAELFDRYPFGKLMVPDPQHDWPSALRAIRAAVRP*
Ga0137412_1048539123300015242Vadose Zone SoilVQDSPWARRRDLRGRDAVVGLYQAWEPVAAELFDRYPFGKLMVPDPQHDWPSALRAIRAAVRP*
Ga0132256_10177586013300015372Arabidopsis RhizosphereVVSQLYDRYPFGKLMVPDPQHDWTAALLAIYAAVRP*
Ga0206353_1054397413300020082Corn, Switchgrass And Miscanthus RhizosphereRDLRGRDAVVGLYRAWEPVAAELFDRYPFGKLMVPDPQHDWPSALRAIRAAVRP
Ga0210406_1093330013300021168SoilLRGLDAVVRLYQAWEPVVGELYDRYPFPRLMVPDPHHDWPAALRAIRAAVRP
Ga0210384_1061709513300021432SoilRNLRGRDAVIRLYQAWEPVASQLYDRYPFPKLMVPDPHHDWPAALHRICTAVRP
Ga0210410_1019898533300021479SoilRRRNLRGRDAVVRLYQAWDPVVSELFDRYPFGKLMVPDPHHDWPASLRAICAAVRP
Ga0210409_1032155813300021559SoilRGRDAVVRLYQAWDPVASELFDRYPFGKLMVPDPHHDWPASLRAICTAVRP
Ga0126371_1292929813300021560Tropical Forest SoilQDAVVGLYRQWEAVVSQLYGRYPFPKLMLTDPQDDWPAALTRICAAVRP
Ga0247691_104300533300024222SoilAWEPVAAELFDRYPFGKLMVPDPQHDWPSALRAIRAAVRP
Ga0207656_1030457733300025321Corn RhizosphereWEPVAAELFDRYPFGKLMVPDPQHDWPSALRAIRAAVRP
Ga0207671_1088735813300025914Corn RhizosphereRGLRGRDAVVGLYRAWEPVAAELFDRYPFGKLMVPDPHYDWPSALRAIRAAVRP
Ga0207663_1021924513300025916Corn, Switchgrass And Miscanthus RhizosphereYQAWEPVAAELFDRYPFGKLMVPDPQHDWPSALRAIRAAVRP
Ga0207663_1090507723300025916Corn, Switchgrass And Miscanthus RhizosphereRLYQAWDPVVSELFDRYPFPKLMVPDPHHDWPASLRAICAAVRP
Ga0207659_1045851633300025926Miscanthus RhizosphereAVVGLYQAWEPVAAELFDRYPFGKLMVPDPQHDWPSALRAIRTAVRP
Ga0207687_1047253513300025927Miscanthus RhizosphereRGRDAVVGLYQAWEPVAAELFDRYPFGKLMVPDPQHDWPSALRAIRTAVRP
Ga0207687_1170247933300025927Miscanthus RhizosphereAFVQDSPWARRRDLRGRAAVVGLYQAWEPVAAELFDRYPFGKLMVPDPQHDWPSALRAIRAAVRP
Ga0207700_1010730333300025928Corn, Switchgrass And Miscanthus RhizosphereAVVRLYQAWYPVASELFDRYPFGKLMVPDPHHDWPASLRAICAAVRP
Ga0207664_1022001013300025929Agricultural SoilGLRGRDAVVGLYQAWEPVAAELFDRYPFGKLMVPDPQHDWPSALRAIRAAVRP
Ga0207677_1058103043300026023Miscanthus RhizosphereRRGLRGRDAVVGLYQAWEPVAVELFDRYPFGKLMLPDPQHDWPSALRAIRAAVRP
Ga0207641_1094284113300026088Switchgrass RhizosphereLRGRDAVVGLYRAWEPVAAELFDRYPFGKLMVPDPHYDWPSALRAIRAAVRP
Ga0207675_10114522743300026118Switchgrass RhizosphereDSPWARRRGLRGRDAVVGLYQAWEPVAVELFDRYPFGKLMLPDPQHDWPSALRAIRAAVR
Ga0207683_1097885613300026121Miscanthus RhizosphereRDAVVGLYRAWEPVAAELFDRYPFGKLMVPDPHYDWPSALRAIRAAVRP
Ga0207683_1127272833300026121Miscanthus RhizosphereRDAVVGLYRAWEPVAAELFDRYPFGKLMVPDPQHDWPSALRAIRAAVRP
Ga0209155_120992523300026316SoilLRGRDAVVRLYQAWDPVASELFDRYPFGKLMVPDPHHDWLASLRAICTAVRP
Ga0208890_100413023300027523SoilLYQAWEPVAARLFDQYPFGKLMVPDPQRDWPAALRAIRAAVRP
Ga0209073_1006454913300027765Agricultural SoilLAFVQDSPWARRHGLRGRDAVVGLYQAWEPVAARLFDQYPFGKLMLPDPQHDWPAALQAIRTAIRP
Ga0307284_1014933013300028799SoilVQDSPWARRRDLRGRDAVVGLYQAWEPVAVELFDRYPFGKLMVPDPQHDWPAALRAIRAAVRP
Ga0222749_1066534313300029636SoilRNLRRRDAVIRLYQAWEPVATQLYDRYPFPKLMVPDPQHDWPAALPCPSAARRTIRSPVR
Ga0318516_1081325713300031543SoilDAVVGLYQAWEPVAARLYDRYPFGKLMVPDPQQDWPAAVRRICAAVRP
Ga0318515_1060075713300031572SoilPVAARLYDRYPFGKLMVPDPQQDWPAAVRRICAAVRP
Ga0318496_1057526923300031713SoilAWEPVVSQLYLRYPFGKLMVPDPQLDWPAALQRICAAVRP
Ga0318501_1030311923300031736SoilPWARHRNLRGRDAVVGLYQAWEPVAARLYDRYPFGKLMVPDPQQDWPAAVRRICAAVRP
Ga0318501_1055565513300031736SoilRHRNLRGLDAVVQLYQAWEPVVSQLYDGYPFPKLTVPDPHHDWPATVRVICAAVRP
Ga0306918_1027143213300031744SoilYQAWEPVAARLYDRYPFGKLMVPDPQQDWPAAVRRICAAVRP
Ga0318543_1041460333300031777SoilVVQLYQAWEPVVSQLYDGYPFPKLTVPDPHHDWPATVRVICAAVRP
Ga0318566_1021274223300031779SoilWARRRNLHGRTAVVRLYQAWEPVVSQLYLRYPFGKLMVPDPQLDWPAALQRICAAVRP
Ga0318548_1055798733300031793SoilLYQAWEPVVSQLYDGYPFPKLTVPDPHHDWPATVRVICAAVRP
Ga0318512_1062609613300031846SoilAWEPVAARLYDRYPFGKLMVPDPQQDWPAAVRRICAAVRP
Ga0318512_1070237613300031846SoilYQAWEPVVSQLYDGYPFPKLTVPDPHHDWPATVRVICAAVRP
Ga0318551_1075900113300031896SoilVGLYRQWEAVVSQLYGRYPFSKLMLTDPQDDWPAALTRICAAVRP
Ga0306921_1102588933300031912SoilPWARHRNLRGLDAVVQLYQAWEPVVSQLYDGYPFPKLTVPDPHHDWPATVRVICAAVRP
Ga0308175_10041169113300031938SoilEPVAAGLFDRYPFGKVMVPDPQHDWPAALRVIRAAVRP
Ga0310910_1085301913300031946SoilAWEPVAARLYDRYRFGKLMVPDPQHDWPAALRRICATVRP
Ga0318559_1035994933300032039SoilSPRNLAFVEDSPWARHRNLRGLDAVVQLYQAWEPVVSQLYDGYPFPKLTVPDPHHDWPATVRVICAAVRP
Ga0318558_1050057433300032044SoilRTLRGLDAVVQLYQAWEPVVSQLYDGYPFPKLTVPDPHHDWPATVRVICAAVRP
Ga0318524_1049474613300032067SoilSPWARHRNLRGLDAVVQLYQAWEPVVSQLYDGYPFPKLTVPDPHHDWPATVRVICAAVRP
Ga0318518_1037825323300032090SoilQAWEPVVSQLYLRYPFGKLMVPDPQLDWPAALQRICAAVRP
Ga0307470_1101433713300032174Hardwood Forest SoilDSPWARRRGLRGRDAVVGLYRAWEPVAAELFDRYPFGKLMVPDPQHDWPSALRAIRAAVR
Ga0306920_10311028323300032261SoilWARHRNLRGRDAVVGLYQAWEPVAARLYDRYPFGKLMVPDPQQDWPAAVRRICAAVRP
Ga0335085_10019723123300032770SoilRDAVIRLYQAWEPVVSQLYDRYPFGKLIVPDPQRDWPAALQTIYAAVRP
Ga0335078_1209606523300032805SoilQLYQAWEPVAVRLYRQYPFPKLMVPDPQRDWPTALRNICAAVRP
Ga0335070_1205411023300032829SoilLRGRDAVVRLYQAWEPVVSQLYRRYPFGKLMVPDPQRDWPSALRTICAAVRP
Ga0335084_1091627623300033004SoilRGRDAVIRLYQAWEPVVSQLYDRYPFGKLIVPDPQRDWPAALQTIYAAVRP
Ga0335073_1154397423300033134SoilDSPWARRHGLRGRDAVVGLYQAWEPVAAGLFDRYPFGKLMVPDPQHDWPSALRAVRAAVR
Ga0318519_1070220723300033290SoilGRDAVVGLYQAWEPVAARLYDRYPFGKLMVPDPQQDWPAAVRRICAAVRP
Ga0318519_1071475723300033290SoilAVVRLYQAWEPVVSQLYERYPFGKLMVPDPRHDWPAALQTIYAAVRP
Ga0318519_1091210613300033290SoilRNLRGREAVVRLYQAWEPVAGELYDRYLFPKLMVPDPQLDWPSALQAICAAVRP
Ga0314862_0138584_19_2103300033803PeatlandVENSPWARRRNLRGREAVIRLYQAWEPVASELYDRYPFAKLMVPDPRHDWPAALRAICAAVRP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.