NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F097808

Metagenome / Metatranscriptome Family F097808

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F097808
Family Type Metagenome / Metatranscriptome
Number of Sequences 104
Average Sequence Length 41 residues
Representative Sequence VVARTEGRKPPAPGQEVTFRVQPDDVFAFHPVTGARLAG
Number of Associated Samples 86
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 87.50 %
Associated GOLD sequencing projects 82
AlphaFold2 3D model prediction Yes
3D model pTM-score0.36

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (88.462 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa
(23.077 % of family members)
Environment Ontology (ENVO) Unclassified
(28.846 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(50.962 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 4.48%    β-sheet: 2.99%    Coil/Unstructured: 92.54%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.36
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF08240ADH_N 30.77
PF01232Mannitol_dh 22.12
PF08125Mannitol_dh_C 19.23
PF00294PfkB 18.27
PF00069Pkinase 1.92
PF03601Cons_hypoth698 0.96
PF00575S1 0.96
PF00392GntR 0.96
PF01909NTP_transf_2 0.96
PF01740STAS 0.96
PF00378ECH_1 0.96
PF13185GAF_2 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG0246Mannitol-1-phosphate/altronate dehydrogenasesCarbohydrate transport and metabolism [G] 41.35
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 7.69
COG2855Uncharacterized membrane protein YadS, UPF0324 familyFunction unknown [S] 0.96


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms88.46 %
UnclassifiedrootN/A11.54 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2166559005|cont_contig08123All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1696Open in IMG/M
3300002245|JGIcombinedJ26739_100469610All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1135Open in IMG/M
3300002245|JGIcombinedJ26739_100503460All Organisms → cellular organisms → Bacteria1088Open in IMG/M
3300005341|Ga0070691_10829292All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia565Open in IMG/M
3300005467|Ga0070706_100365270All Organisms → cellular organisms → Bacteria1345Open in IMG/M
3300005518|Ga0070699_101397943Not Available642Open in IMG/M
3300005536|Ga0070697_100360291All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1257Open in IMG/M
3300005610|Ga0070763_10180120All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1118Open in IMG/M
3300005764|Ga0066903_102187307All Organisms → cellular organisms → Bacteria → Terrabacteria group1066Open in IMG/M
3300005764|Ga0066903_108804847All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia512Open in IMG/M
3300006059|Ga0075017_101327480All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia565Open in IMG/M
3300006175|Ga0070712_100539402Not Available982Open in IMG/M
3300006175|Ga0070712_100574413All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia952Open in IMG/M
3300006176|Ga0070765_101458030All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia644Open in IMG/M
3300006176|Ga0070765_101647444All Organisms → cellular organisms → Bacteria → Terrabacteria group603Open in IMG/M
3300006861|Ga0063777_1414712All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300006904|Ga0075424_101215855All Organisms → cellular organisms → Bacteria802Open in IMG/M
3300009520|Ga0116214_1408740All Organisms → cellular organisms → Bacteria → Terrabacteria group531Open in IMG/M
3300010046|Ga0126384_11105290All Organisms → cellular organisms → Bacteria → Terrabacteria group727Open in IMG/M
3300010048|Ga0126373_11296854All Organisms → cellular organisms → Bacteria794Open in IMG/M
3300010048|Ga0126373_11298832All Organisms → cellular organisms → Bacteria794Open in IMG/M
3300010048|Ga0126373_12241703Not Available607Open in IMG/M
3300010358|Ga0126370_10795563All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii842Open in IMG/M
3300010361|Ga0126378_10883618All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1001Open in IMG/M
3300010376|Ga0126381_104109036All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii565Open in IMG/M
3300010859|Ga0126352_1295075All Organisms → cellular organisms → Bacteria → Terrabacteria group506Open in IMG/M
3300012199|Ga0137383_10239789All Organisms → cellular organisms → Bacteria1329Open in IMG/M
3300012206|Ga0137380_11213033All Organisms → cellular organisms → Bacteria → Terrabacteria group639Open in IMG/M
3300012208|Ga0137376_10426174All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1152Open in IMG/M
3300012942|Ga0164242_11168950All Organisms → cellular organisms → Bacteria → Terrabacteria group512Open in IMG/M
3300013100|Ga0157373_11242664All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → unclassified Sphingomonadaceae → Sphingomonadaceae bacterium562Open in IMG/M
3300017933|Ga0187801_10034514All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1789Open in IMG/M
3300017961|Ga0187778_10229119All Organisms → cellular organisms → Bacteria1189Open in IMG/M
3300017993|Ga0187823_10178077All Organisms → cellular organisms → Bacteria → Terrabacteria group686Open in IMG/M
3300018007|Ga0187805_10450926All Organisms → cellular organisms → Bacteria → Terrabacteria group600Open in IMG/M
3300018058|Ga0187766_10772762All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300021402|Ga0210385_11429790All Organisms → cellular organisms → Bacteria → Terrabacteria group529Open in IMG/M
3300021404|Ga0210389_11123309All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300021405|Ga0210387_10041113All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3688Open in IMG/M
3300021420|Ga0210394_11502576Not Available570Open in IMG/M
3300021474|Ga0210390_11040217All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300021477|Ga0210398_10479164All Organisms → cellular organisms → Bacteria1014Open in IMG/M
3300021477|Ga0210398_10895363All Organisms → cellular organisms → Bacteria → Terrabacteria group711Open in IMG/M
3300021479|Ga0210410_10441937All Organisms → cellular organisms → Bacteria → Terrabacteria group1164Open in IMG/M
3300021479|Ga0210410_10601422All Organisms → cellular organisms → Bacteria → Terrabacteria group976Open in IMG/M
3300021559|Ga0210409_11682506All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300021560|Ga0126371_10088283All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3060Open in IMG/M
3300022523|Ga0242663_1090748All Organisms → cellular organisms → Bacteria → Terrabacteria group597Open in IMG/M
3300022523|Ga0242663_1122675All Organisms → cellular organisms → Bacteria → Terrabacteria group537Open in IMG/M
3300022724|Ga0242665_10176828All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300025898|Ga0207692_10445243Not Available814Open in IMG/M
3300025910|Ga0207684_10597912All Organisms → cellular organisms → Bacteria942Open in IMG/M
3300025928|Ga0207700_11378649All Organisms → cellular organisms → Bacteria → Terrabacteria group627Open in IMG/M
3300026481|Ga0257155_1050215All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300026508|Ga0257161_1054152All Organisms → cellular organisms → Bacteria813Open in IMG/M
3300026557|Ga0179587_10146399All Organisms → cellular organisms → Bacteria → Terrabacteria group1469Open in IMG/M
3300027029|Ga0208731_1029942All Organisms → cellular organisms → Bacteria → Terrabacteria group594Open in IMG/M
3300027505|Ga0209218_1017335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → environmental samples → uncultured Pseudonocardia sp.1318Open in IMG/M
3300027895|Ga0209624_10906709All Organisms → cellular organisms → Bacteria → Terrabacteria group575Open in IMG/M
3300028781|Ga0302223_10198675All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300028806|Ga0302221_10052800All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae1861Open in IMG/M
3300028877|Ga0302235_10105092All Organisms → cellular organisms → Bacteria → Terrabacteria group1283Open in IMG/M
3300028877|Ga0302235_10200514All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii879Open in IMG/M
3300028877|Ga0302235_10494605All Organisms → cellular organisms → Bacteria → Terrabacteria group519Open in IMG/M
3300028879|Ga0302229_10028509All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii2969Open in IMG/M
3300028879|Ga0302229_10290606All Organisms → cellular organisms → Bacteria735Open in IMG/M
3300028879|Ga0302229_10559880Not Available503Open in IMG/M
3300028906|Ga0308309_10201766Not Available1639Open in IMG/M
3300029943|Ga0311340_10009309All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria12717Open in IMG/M
3300029943|Ga0311340_10032570All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6380Open in IMG/M
3300029951|Ga0311371_10682062All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1296Open in IMG/M
3300029997|Ga0302302_1275285All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300030007|Ga0311338_10006710All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria17609Open in IMG/M
3300030013|Ga0302178_10107483All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1427Open in IMG/M
3300030013|Ga0302178_10411911Not Available601Open in IMG/M
3300030043|Ga0302306_10035536All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii2004Open in IMG/M
3300030054|Ga0302182_10184834All Organisms → cellular organisms → Bacteria895Open in IMG/M
3300030490|Ga0302184_10034452All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2585Open in IMG/M
3300030490|Ga0302184_10199668All Organisms → cellular organisms → Bacteria → Terrabacteria group841Open in IMG/M
3300030503|Ga0311370_10049812All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6177Open in IMG/M
3300030503|Ga0311370_11288323All Organisms → cellular organisms → Bacteria → Terrabacteria group783Open in IMG/M
3300030617|Ga0311356_10907328All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii829Open in IMG/M
3300030659|Ga0316363_10272612All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300030855|Ga0075374_11303234All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300031057|Ga0170834_102131323All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300031234|Ga0302325_10533395All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1758Open in IMG/M
3300031236|Ga0302324_100101356All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4880Open in IMG/M
3300031549|Ga0318571_10026251Not Available1577Open in IMG/M
3300031573|Ga0310915_10596004All Organisms → cellular organisms → Bacteria783Open in IMG/M
3300031718|Ga0307474_10264919All Organisms → cellular organisms → Bacteria1318Open in IMG/M
3300031764|Ga0318535_10367665All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria643Open in IMG/M
3300031782|Ga0318552_10377809All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300031799|Ga0318565_10445316All Organisms → cellular organisms → Bacteria → Terrabacteria group627Open in IMG/M
3300031823|Ga0307478_11479452All Organisms → cellular organisms → Bacteria → Terrabacteria group562Open in IMG/M
3300031860|Ga0318495_10089763Not Available1379Open in IMG/M
3300031954|Ga0306926_10367013Not Available1779Open in IMG/M
3300031962|Ga0307479_10227814All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1838Open in IMG/M
3300032042|Ga0318545_10277722All Organisms → cellular organisms → Bacteria → Terrabacteria group602Open in IMG/M
3300032076|Ga0306924_10071748All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3866Open in IMG/M
3300032515|Ga0348332_10546866Not Available1520Open in IMG/M
3300032770|Ga0335085_11740687All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300034163|Ga0370515_0014896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3628Open in IMG/M
3300034163|Ga0370515_0023851All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii2794Open in IMG/M
3300034820|Ga0373959_0037149All Organisms → cellular organisms → Bacteria1008Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa23.08%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil22.12%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere8.65%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil7.69%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.81%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.85%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.85%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.88%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.88%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.92%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.92%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.92%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.92%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.96%
CompostEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Compost0.96%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.96%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.96%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.96%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.96%
SimulatedEngineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated0.96%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2166559005Simulated microbial communities from Lyon, FranceEngineeredOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006861Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010859Boreal forest soil eukaryotic communities from Alaska, USA - C5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012942Miracle-Growth compost microbial communities from Emeryville, California, USA - Original compost - Miracle growth compost (MG)EnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017993Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022523Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022724Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026481Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-AEnvironmentalOpen in IMG/M
3300026508Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-AEnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027029Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF045 (SPAdes)EnvironmentalOpen in IMG/M
3300027505Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300028781Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_3EnvironmentalOpen in IMG/M
3300028806Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1EnvironmentalOpen in IMG/M
3300028877Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3EnvironmentalOpen in IMG/M
3300028879Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300029997Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_3EnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030013Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3EnvironmentalOpen in IMG/M
3300030043Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030054Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1EnvironmentalOpen in IMG/M
3300030490Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3EnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030659Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)EnvironmentalOpen in IMG/M
3300030855Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032042Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M
3300034820Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
cont_0123.000008902166559005SimulatedEDHTLVVARTEGRKPPAPGQQVTFNVQPDDVFAFQPKTGARLAG
JGIcombinedJ26739_10046961013300002245Forest SoilEGRKPPAPGQRVAFAVQSADVLAFNPATGARLAG*
JGIcombinedJ26739_10050346023300002245Forest SoilARAEGRRPPALGQHVTFNVQPDDMFGFHPVTGARLAG*
Ga0070691_1082929213300005341Corn, Switchgrass And Miscanthus RhizosphereGRTVVARTEGRKSPAPGQRVAFRAQPDNIFAFHPATGARLAG*
Ga0070706_10036527023300005467Corn, Switchgrass And Miscanthus RhizospherePVVARAEGRKPPAPGQEVTFRVQPEDVFAFHPKTGARLAG*
Ga0070699_10139794323300005518Corn, Switchgrass And Miscanthus RhizosphereVVARAEGRKPPTPGMHVTFHVEPDDVFAFHPENGARLAG*
Ga0070697_10036029133300005536Corn, Switchgrass And Miscanthus RhizosphereQVVARAEGRKPPTPGQAVTLRIQPDDVFAFHPVTGARLAG*
Ga0070763_1018012023300005610SoilLAGGGDPVVARTEGRKPPAQGQPVTFHVQADDVFAFYPETGERLIG*
Ga0066903_10218730713300005764Tropical Forest SoilAEGRQPPAPGQQVSFYIRPEDVFAFHPVTGARLAG*
Ga0066903_10880484723300005764Tropical Forest SoilDHNLVVARTEGRKPPAPGQEVTFRVQPDDIFAFHPKTGARLAG*
Ga0075017_10132748013300006059WatershedsVVARTEGRKPPAPGQEVTFRVQPDDVFAFHPVTGARLAG*
Ga0070712_10053940213300006175Corn, Switchgrass And Miscanthus RhizosphereEGRKPPAPGQDVTFRVQPDDVFAFHPVTGARLAG*
Ga0070712_10057441323300006175Corn, Switchgrass And Miscanthus RhizosphereGDAGPAVGNTVVARTEGRKSPAPGQRVAFRAQPDNIFAFHPATGARLAG*
Ga0070765_10145803013300006176SoilVARAEGRRPPALGQHVTFNVQPDDMFGFHPATGARLAG*
Ga0070765_10164744413300006176SoilAEGRKPPAPGQRVAFRVQSADVLAFNPATGARLAG*
Ga0063777_141471213300006861Peatlands SoilHVRLSESGNSVVARTEGRVSLTPGQRVTFRVQPDDIFAFHPVTGARLAG*
Ga0075424_10121585513300006904Populus RhizosphereAEGRKPPAQGQGVTFHVQTDDIFAFHPVTGARLAG*
Ga0116214_140874013300009520Peatlands SoilGNSVVARTEGRVSLTPGQRVTFRVQPDDIFAFHPVTGARLAG*
Ga0126384_1110529023300010046Tropical Forest SoilPEGGNPIVARAEGRQPPAPGREVSLHIRPEDVFAFHPQTGARLTG*
Ga0126373_1129685423300010048Tropical Forest SoilGDQVVARAEGRKPPAPGRQVTFRVQPDDVFAFHPVTGARLAG*
Ga0126373_1129883223300010048Tropical Forest SoilVVARAEGRKPPAPGQEVTFRVQPDDVFAFHPVTGARIAG*
Ga0126373_1224170313300010048Tropical Forest SoilTRAEGRRPPSLGQDVALQINSADLLAFHPVTGARLAG*
Ga0126370_1079556323300010358Tropical Forest SoilSVVARTEGRKPPSQGQPVTFHVQPDDVFAFHPQTGSRLVG*
Ga0126378_1088361823300010361Tropical Forest SoilVARTEGRKPPAQGQPVTFHVQPDDVFAFHPQTGSRLVG*
Ga0126381_10410903613300010376Tropical Forest SoilVVARTEGRKPPAAGTGVTFRVQTDDIFAFHPVTGARLAG*
Ga0126352_129507513300010859Boreal Forest SoilVRLADGGGAVVARTEGRKTPAPGQQVAFRVQPSDVFAFHPVTGARLAG*
Ga0137383_1023978913300012199Vadose Zone SoilGDPVVARAEGRKPPAQGQGVTFHVQTDDIFAFHPVTGARLAG*
Ga0137380_1121303323300012206Vadose Zone SoilDDPVVARTEGRKPLAPGQGVTFHVQPDDVFAFDPATGARLAG*
Ga0137376_1042617423300012208Vadose Zone SoilARAEGRRPPAQGQPVTFNVQQDDVFAFHPETGERLIG*
Ga0164242_1116895023300012942CompostGTVVARTEGRTAPAPGSKVSFRVQPGNVFAFNPRTGARL*
Ga0157373_1124266423300013100Corn RhizosphereAEGRKPPAQGQPVTFNVQTEDVFAFHPETGARLAG*
Ga0187801_1003451433300017933Freshwater SedimentRTEGRRPPAPGQDVTFRVEPDDIFAFDPVTGARIAG
Ga0187778_1022911913300017961Tropical PeatlandVVARTEGREPAAPGQEVTSGVQPGDIFAFHPQTGARLAC
Ga0187823_1017807713300017993Freshwater SedimentALLHVRLTGDAGPVVGNTVVARTEGRKSPAPGQRVSFRAQPDNIFAFHPATGARLAG
Ga0187805_1045092613300018007Freshwater SedimentRTEGRKSPAPGQRIALRVQPDDVFAFHPATGARLAG
Ga0187766_1077276213300018058Tropical PeatlandLAGDRTAVVARTEGREPAAPGQEVTSGVQPDDIFAFHPQTGARLAC
Ga0210385_1142979023300021402SoilGGGAVVARAEGRKPPAPGQRVAFRVQSADVLAFNPATGARLAG
Ga0210389_1112330913300021404SoilTEGRRPPAQGQPVTFHVQPDDVFAFHPETGNRLIG
Ga0210387_1004111353300021405SoilTDQVVARTEGRKPPAPGQEVTFRVQPDDVFAFHPVTGARLAG
Ga0210394_1150257613300021420SoilHVRLVGGGDPVVARAEGRKPPAQGQPVTFHVQPDDVFAFYPATGERLIG
Ga0210390_1104021723300021474SoilTEGRKPPAPGQEVTFRVQPDDVFAFHPVTGARLAG
Ga0210398_1047916413300021477SoilRTEGRKPPPPGQQVRFHVQPDDVFAFNPVTGGRLAG
Ga0210398_1089536323300021477SoilAVVARAEGRKPPAPGQRVAFRVQSADVLAFNPATGARLAG
Ga0210410_1044193723300021479SoilGGTVVARTEGRKSPAPGQRVALRVQPDDIFAFHPVTGARLAG
Ga0210410_1060142213300021479SoilRLDDDGGAVVARTEGRKSPAPGQRVSFRVQPDDVFAFHPATGARLAG
Ga0210409_1168250613300021559SoilNQVVARTEGRKPPAPGQEVTFRVQPDDVFAFHPVTGARLAG
Ga0126371_1008828313300021560Tropical Forest SoilGADALLHVRLAGTGNPVVARTEGHKPPAAGTGVTFRVQTDDIFAFHPVTGARLAG
Ga0242663_109074813300022523SoilDEGGTVVARTEGRKSPAPGQRVALRVQPDDIFAFHPVTGARLAG
Ga0242663_112267523300022523SoilDAGGTVVARTEGRRSPAPGSQATFRVRPADVFAFHPASGARLAG
Ga0242665_1017682813300022724SoilLAESGDPVVARTEGRVSMSPGQKVTFHVRPEDVFAFHPVTGARLAG
Ga0207692_1044524313300025898Corn, Switchgrass And Miscanthus RhizosphereAEDSGSVVARTEGRKSPAPGQRVAFRVQPDDVFAFHPATGARL
Ga0207684_1059791223300025910Corn, Switchgrass And Miscanthus RhizosphereARTEGRKPPAPGRQVTFWVRPDDAFAFNPGTGARLAG
Ga0207700_1137864923300025928Corn, Switchgrass And Miscanthus RhizosphereRTEGRKFPAPGQPVALRVQPDDIFAFHPGTGARLAG
Ga0257155_105021523300026481SoilHVRLAEAGDPVVARAEGRKPPVPGQHVTFHVQPEDIFAFHPGTGARLAG
Ga0257161_105415223300026508SoilQVVARAEGRKTPAPGQKVTFRVLPEDVFAFHPVTGARLAG
Ga0179587_1014639913300026557Vadose Zone SoilRTEGRKSPAPGQRVTLRVQPDDIFAFHPVTGARLAG
Ga0208731_102994213300027029Forest SoilLLHVRLADDGGAVVARTEGRKSPAPGHRVSFRVQPDDVFAFHPVTGARLAG
Ga0209218_101733523300027505Forest SoilAGGGSPVVARAEGRRPPALGQHVTFNVQPDDMFGFHPATGARLAG
Ga0209624_1090670913300027895Forest SoilTVVARTEGRKSPAPGQRVALRIEPDNVLAFHPVTGARLAG
Ga0302223_1019867513300028781PalsaHVRLAVDGNAVVARTEGRKPPAPGQQVRFNVQPDDVFAFHPVTGARLAA
Ga0302221_1005280033300028806PalsaTEGRKPPAPGQQVRFHVEPDDVFAFHPATGARLAS
Ga0302235_1010509213300028877PalsaEGGNPVVARSEGRKPPAPGRTVTFNVQRDDILAFHPATGARLAG
Ga0302235_1020051423300028877PalsaAVVARTEGRKPPAPGQQVRFNVQPDDVFAFHPVTGARLAA
Ga0302235_1049460513300028877PalsaTPVVARAEGRKPPAPGQQVTFRVLTTDVFAFDPVTGARLAG
Ga0302229_1002850953300028879PalsaLHVRLAVDGNAVVARTEGRKPPAPGQQVRFNVQPDDVFAFHPVTGARLAA
Ga0302229_1029060613300028879PalsaLHVRLAVDGNAVVARTEGRKPPAPGQQVRFNVQPDDVFAFHPATGARLAG
Ga0302229_1055988013300028879PalsaNQVVARTEGRKPPAPGQEVRFNVQPDDVFAFHPVTGARLAG
Ga0308309_1020176623300028906SoilRTEGRKPPAPGQEVTFRVQPDDVFAFHPVTGARLAG
Ga0311340_1000930913300029943PalsaDGNAVVARTEGRKPPAPGQQVRFNVQPDDVFAFHPATGARLAG
Ga0311340_1003257013300029943PalsaDGNAVVARTEGRKPPAPGQQVRFNVQPDDVFAFHPATGARLAA
Ga0311371_1068206233300029951PalsaGGSVVARAEGRKPPAPGQRVAFRVESADVLGFNPANGARLAG
Ga0302302_127528513300029997PalsaVRLAESGNPVIARTEGRKPPAPGQQVRFHVEPDDVFAFHPATGARLAS
Ga0311338_10006710243300030007PalsaARTEGRKPPAPGQQVRFNVQPDDVFAFHPATGARLAG
Ga0302178_1010748333300030013PalsaHVRLADGGGAVVARAEGRKPPAPGQRVAFRVQSADVLAFNPATGARLAG
Ga0302178_1041191123300030013PalsaQVVARTEGRKPPAPGQEVRFNVQPDDVFAFHPVTGARLAG
Ga0302306_1003553643300030043PalsaGNAVVARTEGRKPPAPGQEVRFHVQPDDVFAFHPVTGARLA
Ga0302182_1018483423300030054PalsaLHVRLAESGNAVVARAEGRKPPIPGQKVTFHVQLEDIFAFHPGTGARLAG
Ga0302184_1003445243300030490PalsaDDGGAVVARAEGRKPPAPGQRVAFAVQSADVLAFNPANGARLAG
Ga0302184_1019966823300030490PalsaARAEGRKPPPPGQRVAFRIQSADVLAFNPATGARLAG
Ga0311370_1004981283300030503PalsaVVARTEGRKPPAPGQQVRFNVQPDDVFAFHPVTGARLAA
Ga0311370_1128832313300030503PalsaVATPVVARAEGRKPPAPGQQVTFRVLTTDVFAFDPVTGARLAG
Ga0311356_1090732823300030617PalsaTEGRKPPAPGQEVRFNVQPDDVFAFHPVTGARLAG
Ga0316363_1027261213300030659Peatlands SoilRTEGRVSMAPGQKVTFHVRPEDVFAFHPVTGARLAG
Ga0075374_1130323413300030855SoilRAEGRKPPTPGMHVTFHVEPDDVFAFHPGTGARLAG
Ga0170834_10213132313300031057Forest SoilSGNQVVARAEGRKPPAPGQEVTFRVQPDDVFAFNPATGARLAG
Ga0302325_1053339513300031234PalsaVVARAEGRKPPAPGQRVAFAVQSADVLAFNPANGARLAG
Ga0302324_10010135613300031236PalsaADALLHVRLPDVATPVVARAEGRKPPAPGQQVTFRVLTTDVFAFDPVTGARLAG
Ga0318571_1002625123300031549SoilVACTEGRKPPAPGQEVTFRVQPDDVFAFHPVTGARIGG
Ga0310915_1059600413300031573SoilGNPMVARTEGRKPPAPGQEVTFRVQPDDIFAFHPVTGARIAG
Ga0307474_1026491923300031718Hardwood Forest SoilLHVRLAESGNQVVARTEGRKPPAPGQEVTFRVLPDDVFAFHPVTGARLAG
Ga0318535_1036766533300031764SoilARAEGRKPPAPGQEVTFRVQPDDVFAFHPVTGARIAG
Ga0318552_1037780913300031782SoilARAEGRRPPAPGQDVTFHVQPDDVFAFDPATGARIAG
Ga0318565_1044531623300031799SoilVRLADGGGSVVTRTEGRKAPAPGQQVRFRVQPADVFAFHPVTGARLAA
Ga0307478_1147945223300031823Hardwood Forest SoilHVRLARDGGPVVARTEGRKSPAPGQSVAFRVQPDDVLAFHPVTGARLAG
Ga0318495_1008976313300031860SoilTEGRKPPAPGQEVTFRVQPDDVFAFHPVTGARIAG
Ga0306926_1036701333300031954SoilPAGGGNPMVARTEGRKPPAPGQEVTFRVQPDDVFAFHPVTGARIGG
Ga0307479_1022781413300031962Hardwood Forest SoilVVARTEGRNPKAPGQRVAFRVQPEDIFAFHPTTGVRLAS
Ga0318545_1027772223300032042SoilTRTEGRKAPVPGQQVRFRVQPADVFAFHPVTGARLAG
Ga0306924_1007174813300032076SoilTEGRKAPVPGQQVRFRVQPADVFAFHPVTGARLAG
Ga0348332_1054686613300032515Plant LitterVRLTGRTDQVVARAEGRRPPALGQHVTFNVQPDDMFGFHPVTGARLAG
Ga0335085_1174068713300032770SoilGQVVARAEGRKPPAPGQQVKFHVEPEDVFAFHPGTGARLAG
Ga0370515_0014896_3_1373300034163Untreated Peat SoilEDGNPVVARTEGRKPPAPGQEIRFHVQPDDVFAFHPVTGARLAG
Ga0370515_0023851_2661_27923300034163Untreated Peat SoilEDGNPVVARTEGRKPPAPGQEIRFHVQPDDVFAFHPVTGARLA
Ga0373959_0037149_1_1413300034820Rhizosphere SoilLAGGGDPVVARAEGRKPPAQGQGVTFHVQTDDIFAFHPVTGARLAG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.