NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F097812

Metagenome / Metatranscriptome Family F097812

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F097812
Family Type Metagenome / Metatranscriptome
Number of Sequences 104
Average Sequence Length 41 residues
Representative Sequence DDFKVPEREKAEVLAAFGAEKGEVTAGSQPGAVNWRRWR
Number of Associated Samples 91
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.92 %
% of genes near scaffold ends (potentially truncated) 96.15 %
% of genes from short scaffolds (< 2000 bps) 95.19 %
Associated GOLD sequencing projects 87
AlphaFold2 3D model prediction Yes
3D model pTM-score0.29

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (50.962 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(36.538 % of family members)
Environment Ontology (ENVO) Unclassified
(42.308 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.154 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 20.90%    β-sheet: 0.00%    Coil/Unstructured: 79.10%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.29
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF07784DUF1622 11.54
PF00196GerE 4.81
PF00923TAL_FSA 2.88
PF08281Sigma70_r4_2 2.88
PF12973Cupin_7 2.88
PF13191AAA_16 1.92
PF05201GlutR_N 1.92
PF00440TetR_N 1.92
PF07992Pyr_redox_2 1.92
PF06441EHN 0.96
PF00708Acylphosphatase 0.96
PF13474SnoaL_3 0.96
PF01242PTPS 0.96
PF13610DDE_Tnp_IS240 0.96
PF00903Glyoxalase 0.96
PF02540NAD_synthase 0.96
PF13358DDE_3 0.96
PF00999Na_H_Exchanger 0.96
PF12840HTH_20 0.96
PF07282OrfB_Zn_ribbon 0.96
PF04185Phosphoesterase 0.96
PF14759Reductase_C 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG4828Uncharacterized membrane proteinFunction unknown [S] 11.54
COG0176Transaldolase/fructose-6-phosphate aldolaseCarbohydrate transport and metabolism [G] 2.88
COG0373Glutamyl-tRNA reductaseCoenzyme transport and metabolism [H] 1.92
COG0025NhaP-type Na+/H+ or K+/H+ antiporterInorganic ion transport and metabolism [P] 0.96
COG0171NH3-dependent NAD+ synthetaseCoenzyme transport and metabolism [H] 0.96
COG0475Kef-type K+ transport system, membrane component KefBInorganic ion transport and metabolism [P] 0.96
COG05962-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase foldCoenzyme transport and metabolism [H] 0.96
COG07206-pyruvoyl-tetrahydropterin synthaseCoenzyme transport and metabolism [H] 0.96
COG3004Na+/H+ antiporter NhaAEnergy production and conversion [C] 0.96
COG3263NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domainsEnergy production and conversion [C] 0.96
COG3511Phospholipase CCell wall/membrane/envelope biogenesis [M] 0.96
COG4651Predicted Kef-type K+ transport protein, K+/H+ antiporter domainInorganic ion transport and metabolism [P] 0.96


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms50.96 %
UnclassifiedrootN/A49.04 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352024|deeps__Contig_74590All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi766Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101963541Not Available608Open in IMG/M
3300002028|A17_1213572All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium650Open in IMG/M
3300002568|C688J35102_120295991All Organisms → cellular organisms → Bacteria974Open in IMG/M
3300004629|Ga0008092_11282719All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300005332|Ga0066388_102014802All Organisms → cellular organisms → Bacteria1035Open in IMG/M
3300005363|Ga0008090_10044702All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300005363|Ga0008090_15165540All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → Methylocystis rosea500Open in IMG/M
3300005468|Ga0070707_101309660All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300005535|Ga0070684_101565243All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300005764|Ga0066903_101492618All Organisms → cellular organisms → Bacteria1276Open in IMG/M
3300005764|Ga0066903_105102788All Organisms → cellular organisms → Bacteria696Open in IMG/M
3300005764|Ga0066903_108178911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces535Open in IMG/M
3300006032|Ga0066696_10621119Not Available700Open in IMG/M
3300006034|Ga0066656_10219272All Organisms → cellular organisms → Bacteria1216Open in IMG/M
3300006175|Ga0070712_100401851Not Available1132Open in IMG/M
3300006796|Ga0066665_10929305All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300006852|Ga0075433_11095542Not Available693Open in IMG/M
3300006954|Ga0079219_10127027All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1313Open in IMG/M
3300009137|Ga0066709_100497491All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1716Open in IMG/M
3300009147|Ga0114129_10734753All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium1265Open in IMG/M
3300009147|Ga0114129_11524768All Organisms → cellular organisms → Bacteria820Open in IMG/M
3300009792|Ga0126374_11168149Not Available614Open in IMG/M
3300010040|Ga0126308_10311357Not Available1037Open in IMG/M
3300010045|Ga0126311_10120532All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1830Open in IMG/M
3300010046|Ga0126384_10799004Not Available844Open in IMG/M
3300010154|Ga0127503_11100111All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia509Open in IMG/M
3300010358|Ga0126370_10839590Not Available823Open in IMG/M
3300010359|Ga0126376_10772051Not Available934Open in IMG/M
3300010360|Ga0126372_12786918Not Available541Open in IMG/M
3300010373|Ga0134128_11779162Not Available678Open in IMG/M
3300010376|Ga0126381_101603915Not Available940Open in IMG/M
3300010376|Ga0126381_104043351Not Available570Open in IMG/M
3300010398|Ga0126383_10727686Not Available1072Open in IMG/M
3300010398|Ga0126383_11304575Not Available816Open in IMG/M
3300010398|Ga0126383_13649981Not Available503Open in IMG/M
3300012198|Ga0137364_10575555Not Available848Open in IMG/M
3300012201|Ga0137365_10260155All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1289Open in IMG/M
3300012202|Ga0137363_10103766All Organisms → cellular organisms → Bacteria2165Open in IMG/M
3300012204|Ga0137374_10213715Not Available1649Open in IMG/M
3300012207|Ga0137381_10351459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1285Open in IMG/M
3300012941|Ga0162652_100071692Not Available591Open in IMG/M
3300012957|Ga0164303_10717529Not Available676Open in IMG/M
3300012989|Ga0164305_11360845Not Available623Open in IMG/M
3300013102|Ga0157371_10662981Not Available779Open in IMG/M
3300015372|Ga0132256_100532637Not Available1286Open in IMG/M
3300016294|Ga0182041_11258632All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300016422|Ga0182039_11211539All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300017972|Ga0187781_10254293All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1243Open in IMG/M
3300018062|Ga0187784_10213206All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1575Open in IMG/M
3300020581|Ga0210399_11489765Not Available525Open in IMG/M
3300021560|Ga0126371_10944401All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha1005Open in IMG/M
3300021560|Ga0126371_11900641Not Available714Open in IMG/M
3300025922|Ga0207646_10697011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonosporobacteraceae → Ktedonosporobacter → Ktedonosporobacter rubrisoli908Open in IMG/M
3300026300|Ga0209027_1143030All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium820Open in IMG/M
3300026538|Ga0209056_10706980Not Available510Open in IMG/M
3300027905|Ga0209415_10034898All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria7057Open in IMG/M
3300028592|Ga0247822_11013180Not Available686Open in IMG/M
3300031446|Ga0170820_14154926Not Available780Open in IMG/M
3300031474|Ga0170818_111837720Not Available505Open in IMG/M
3300031543|Ga0318516_10472071Not Available721Open in IMG/M
3300031543|Ga0318516_10786159Not Available538Open in IMG/M
3300031545|Ga0318541_10173460All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1189Open in IMG/M
3300031546|Ga0318538_10210648All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Knoellia → Knoellia sinensis → Knoellia sinensis KCTC 199361039Open in IMG/M
3300031561|Ga0318528_10269064Not Available914Open in IMG/M
3300031564|Ga0318573_10574043Not Available607Open in IMG/M
3300031640|Ga0318555_10608046Not Available592Open in IMG/M
3300031713|Ga0318496_10199651All Organisms → cellular organisms → Bacteria1099Open in IMG/M
3300031723|Ga0318493_10495703Not Available675Open in IMG/M
3300031744|Ga0306918_10656930All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria821Open in IMG/M
3300031764|Ga0318535_10145492All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1055Open in IMG/M
3300031765|Ga0318554_10160106All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1279Open in IMG/M
3300031769|Ga0318526_10080724All Organisms → cellular organisms → Bacteria1281Open in IMG/M
3300031770|Ga0318521_10292202All Organisms → cellular organisms → Bacteria958Open in IMG/M
3300031777|Ga0318543_10159706All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Knoellia → Knoellia sinensis → Knoellia sinensis KCTC 19936993Open in IMG/M
3300031780|Ga0318508_1082624All Organisms → cellular organisms → Bacteria880Open in IMG/M
3300031796|Ga0318576_10302348Not Available756Open in IMG/M
3300031799|Ga0318565_10635995Not Available512Open in IMG/M
3300031805|Ga0318497_10308345Not Available882Open in IMG/M
3300031805|Ga0318497_10752008Not Available546Open in IMG/M
3300031859|Ga0318527_10320050Not Available661Open in IMG/M
3300031860|Ga0318495_10038116All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2113Open in IMG/M
3300031893|Ga0318536_10040685Not Available2215Open in IMG/M
3300031894|Ga0318522_10369448Not Available543Open in IMG/M
3300031896|Ga0318551_10511635Not Available689Open in IMG/M
3300031896|Ga0318551_10705640Not Available585Open in IMG/M
3300031903|Ga0307407_10155062All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1492Open in IMG/M
3300031912|Ga0306921_11164736All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia860Open in IMG/M
3300031912|Ga0306921_11550556Not Available722Open in IMG/M
3300031912|Ga0306921_12602654Not Available522Open in IMG/M
3300031941|Ga0310912_10065062All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2607Open in IMG/M
3300031946|Ga0310910_10499163All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. RIT328966Open in IMG/M
3300031954|Ga0306926_10815303All Organisms → cellular organisms → Bacteria1124Open in IMG/M
3300032002|Ga0307416_102856297Not Available578Open in IMG/M
3300032025|Ga0318507_10212225Not Available836Open in IMG/M
3300032039|Ga0318559_10166730All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1005Open in IMG/M
3300032043|Ga0318556_10619403Not Available564Open in IMG/M
3300032044|Ga0318558_10625284Not Available538Open in IMG/M
3300032066|Ga0318514_10405546All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria724Open in IMG/M
3300032067|Ga0318524_10742649All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria518Open in IMG/M
3300032089|Ga0318525_10269783All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi874Open in IMG/M
3300032090|Ga0318518_10524286Not Available606Open in IMG/M
3300032091|Ga0318577_10502560All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059578Open in IMG/M
3300033289|Ga0310914_10384315All Organisms → cellular organisms → Bacteria1270Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil36.54%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil11.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.73%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.81%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.85%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.88%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.88%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil2.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.92%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.92%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.92%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.92%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.92%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.92%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.96%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.96%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.96%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.96%
Permafrost And Active Layer SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost And Active Layer Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.96%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.96%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.96%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352024Bare-fallow DEEP SOILEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300002028Permafrost and active layer soil microbial communities from McGill Arctic Research Station (MARS), Canada, for enrichment studies - Sample_A17EnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004629Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A01 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012941Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026300Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031903Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1Host-AssociatedOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
deeps_012109902199352024SoilVHRDGRLDDFNVPEREKQEVLAAFAGEKGEVSAGSPSGAVNWRRWS
INPhiseqgaiiFebDRAFT_10196354113300000364SoilGRCNRDGRLDDFNVPEREKQEVLAAFAGEKGEVSAGSPSGAVNWRRWS*
A17_121357213300002028Permafrost And Active Layer SoilRTLDHFNVPEREKGEALAAFNGWKGEVTAGSDPDAVNWRRWN*
C688J35102_12029599133300002568SoilLDDFNVPEREKQEVLAAFAAEKGEVTAGSQPGAVNWRSWP*
Ga0008092_1128271913300004629Tropical Rainforest SoilNALDDFNVPEREKQEVLAAFDGEKGEVSAGSQPGAVNWRRWR*
Ga0066388_10201480243300005332Tropical Forest SoilMDDFKVPEREKAEVLAAFGAEKGEVTAGSQPGAVNWRRWR*
Ga0008090_1004470213300005363Tropical Rainforest SoilMDDFKVPEREKAEVLAAFGAEKGEVTAGSQPGEVNWRRWR*
Ga0008090_1516554013300005363Tropical Rainforest SoilALDDFNVPEREKNEVLGAFGGEKGEVTAGSQPGAVNWATWD*
Ga0070707_10130966023300005468Corn, Switchgrass And Miscanthus RhizosphereTLDHFKVPEREKGEVLSAFARWKGEVTAGSEPGSVNWRRWR*
Ga0070684_10156524313300005535Corn RhizosphereVSAELANALDDFNVPEREKQEVLAAFNREKSEVSAGSQPGAVNWRRWH*
Ga0066903_10149261813300005764Tropical Forest SoilQELINAMDDFKVPEREKAEVLAAFGAEKGEVTAGSEPGAVNWRRWR*
Ga0066903_10510278813300005764Tropical Forest SoilVPEREKAEVLAGFAGEKGEVTAGSQPGAVNWRRWR*
Ga0066903_10817891113300005764Tropical Forest SoilNAMDDFKVPEREKAEVLAAFGAEKGEVTAGSQPGAVNWRRWR*
Ga0066696_1062111913300006032SoilDDFNVPEREKQEVLAAFAAEKGEVTAGSQPGAVNWRSWH*
Ga0066656_1021927233300006034SoilLTLDHFKVPEREKGEVLGTFARWKGEVTAGSESGSVNWRRWR*
Ga0070712_10040185113300006175Corn, Switchgrass And Miscanthus RhizosphereELANALDEFQVPEREKQEVLAGFAGEKSEVTAGSQPGAVNWRRWR*
Ga0066665_1092930523300006796SoilHFKVPEREKGEVLAAFAGWKGEVTAGSEPGSVNWRRWR*
Ga0075433_1109554213300006852Populus RhizosphereLDEFKVPEREKQEVLAAFAAEKGEVTAGSQPGAVNWRRWR*
Ga0079219_1012702733300006954Agricultural SoilGRRLRPRPVHGDGRLDDFNLPEREKQEVLAAFAGEKGEVSAGSPSGAVNWRRWS*
Ga0066709_10049749133300009137Grasslands SoilGRRLRPRPVHRDGRLDDFNVPEREKQEVLAAFAGEKGEVSAGFPSGAVNWRRWS*
Ga0114129_1073475313300009147Populus RhizospherePEREKGEVLAAFGGWKDEVTAGSKPGAVNWRRWR*
Ga0114129_1152476833300009147Populus RhizosphereGATLDHFGVPEREKGEVLDAFASRKGEVTAGSERGAVNWRRWRSGA*
Ga0126374_1116814923300009792Tropical Forest SoilLDDFNVPEREKGEVLAAFAGEKSEVSAGSQPGAVNWRRWRS*
Ga0126308_1031135713300010040Serpentine SoilHFSVPGGEKEEVLAAFNGWKEEVTAGSQPDAINWRRWR*
Ga0126311_1012053213300010045Serpentine SoilTLDHFNVPEREQEEVLAAFNGWKEEVTAGSQPGAINWRRWR*
Ga0126384_1079900423300010046Tropical Forest SoilVPEREKQEVLAAFAAEKGEVSAGSQPGAVNWRSWR*
Ga0127503_1110011123300010154SoilFKVPEREKGEVLGAFAGWKGEVTAGSEPGVVNWRRWH*
Ga0126370_1083959013300010358Tropical Forest SoilDFKVPEREKAEVLAAFGAEKGEVTAGSQPGAVNWRRWR*
Ga0126376_1077205123300010359Tropical Forest SoilGMIRLRTVLDEFKVPEREKQEVLAAFAAEKGEVTAGSQPGEVNWRRWR*
Ga0126372_1278691823300010360Tropical Forest SoilINAMDDFKVPEREKAEVLAAFGAEKGEVTAGSQPGEVNWRRWR*
Ga0134128_1177916223300010373Terrestrial SoilDFNVPEREKQEVLAAFNGEKGEVSAGSQPGAVNWRRWR*
Ga0126381_10160391533300010376Tropical Forest SoilDFKVPEREKAEVLAAFGAEKGEVTAGSQPGAVNWRRWP*
Ga0126381_10404335113300010376Tropical Forest SoilVPEREKAEVLAAFGAEKGEVTAGSQPGAVNWRRWR*
Ga0126383_1072768613300010398Tropical Forest SoilSVPEREKQEVLAAFAAEKGEVTAGSQPGAVNWRSWH*
Ga0126383_1130457523300010398Tropical Forest SoilINAMDDFKVPEREKAEVLAAFGAEKGEVTAGSQSGEVNWRRWR*
Ga0126383_1364998113300010398Tropical Forest SoilDAFNVPEREKQEVLAAFAAEKGEVTAGSQPGAVNWRSWH*
Ga0137364_1057555513300012198Vadose Zone SoilTLDEFNVPEREKGEVLAGFAGEKSEVTAGSQPGAVNWRRWR*
Ga0137365_1026015533300012201Vadose Zone SoilVHRDGRLDDFNVPEREKQEVLAAFAGEKGEVSAGFPSGAVNWRRWS*
Ga0137363_1010376633300012202Vadose Zone SoilMDEFQVPDREKQEVLAAFANEKGAVTAGSQPEAVNWRRWR*
Ga0137374_1021371543300012204Vadose Zone SoilFKVPEREKGEALAAFNGWKDEVTAGSKPGAVNWRRWH*
Ga0137381_1035145913300012207Vadose Zone SoilHRDGRLDDFNVPEREKQEVLAAFAGEKGEVSAGSPSGAVNWRRWS*
Ga0162652_10007169223300012941SoilLDDFNVPEREKQEVLAAFAAEKGEVTAGSQPGAVNWRSWH*
Ga0164303_1071752923300012957SoilTLDHFNVPEREKGEVLTAFGGWKGEVTAGSKEGAVNWRRWH*
Ga0164305_1136084523300012989SoilDFHVPEREKGEVLAGFAGEKGEVTAGSQPEAVNWRRWR*
Ga0157371_1066298113300013102Corn RhizosphereLDDFNVPEREKGEVLAGFAGGKGAVTAGSQPGAVNWRRWR*
Ga0132256_10053263733300015372Arabidopsis RhizosphereDDFNVPEREKQEVLAAFNGEKGEVSAGSQPGEVNWRRWR*
Ga0182041_1125863213300016294SoilNAMDDFKVPEREKAEVLAAFGAEKGEVTAGSQPGEVNWRRWR
Ga0182039_1121153913300016422SoilLINAMDDFKVPEREKAEVLAAFGAEKGEVTAGSQPGEVNWRRWR
Ga0187781_1025429313300017972Tropical PeatlandFKVPGREKAEVLEAFAGWKGEVTAGSAPESVNWRRWR
Ga0187784_1021320633300018062Tropical PeatlandMSPEPTDFKVPGREKAEVLEAFAGWKGEVTAGSAPESVNWRRWR
Ga0210399_1148976513300020581SoilQELINALNEFKVPEREKQEVLAAFANEKGEVTAGSQPGAVNWRRWR
Ga0126371_1094440133300021560Tropical Forest SoilVPEREKAEVLAAFGAEKGEVTAGSQPGAVNWRRWR
Ga0126371_1190064113300021560Tropical Forest SoilAMDDFKVPEREKAEVLAAFGAEKGEVTAGSQPGAVNWRRWP
Ga0207646_1069701123300025922Corn, Switchgrass And Miscanthus RhizosphereTLDHFKVPEREKGEVLSAFARWKGEVTAGSEPGSVNWRRWR
Ga0209027_114303013300026300Grasslands SoilLTLDHFKVPEREKGEVLGAFARWKGEVTAGSEPGSVNWRRWR
Ga0209056_1070698023300026538SoilFNVPEREKQEVLAAFAGEKGEVSAGFPSGAVNWRRWS
Ga0209415_1003489813300027905Peatlands SoilHFKVPEREKDQVLDAFAGWKGEVTAGSKPEAVNWRRWR
Ga0247822_1101318023300028592SoilLTLEHFRVPERERGEVLGAFAGWKGEVTAGSEPGATNWRRWRSRP
Ga0170820_1415492613300031446Forest SoilLDDFNVPEREKGEVLAGFAGEKSEVSAGSQPGAVNWRRWR
Ga0170818_11183772013300031474Forest SoilSAELANALDDFNVPEREKQEVLAAFNGEKGEVSAGSQPGEVNWRRWR
Ga0318516_1047207123300031543SoilDFKVPEREKGEVLAAFAAEKGEVSAGSQPGAVNWRRWR
Ga0318516_1078615913300031543SoilDFKVPEREKAEVLAAFGAEKGEVTAGSQSGEVNWRRWR
Ga0318541_1017346023300031545SoilFKVPEREKGEVLAAFAAEKGEVSAGSQPEAVNWRRWR
Ga0318538_1021064813300031546SoilAMDEFKVPEREKQEVLAAFAAEKGEVTAGSQPGAVNWRSWH
Ga0318528_1026906433300031561SoilAMDDFKVPEREKAEVLAAFGAEKGEVTAGSQPGAVNWRRWR
Ga0318573_1057404313300031564SoilLDDFKVPEREKGEVLAAFAAEKGEVSAGSQPGAVNWRRWR
Ga0318555_1060804613300031640SoilNAMDDFKVPEREKAEVLAAFGAEKGEVTAGSQPGAVNWRRWP
Ga0318496_1019965123300031713SoilQELINAMDDFKVPDREKAEVLAAFGAEKGEVTAGSQPGEVNWRRWR
Ga0318493_1049570313300031723SoilFNVPEREKAEVLAGFAGEKGEVTAGSQRGAVNWRRWR
Ga0306918_1065693033300031744SoilAELSYTLDHFQVPEPEKGEVLGAFAGWRGEVTAGAEPGAVNWRRWR
Ga0318535_1014549213300031764SoilLDDFKVPEPEKGEVLGAFAGWRGEVTAGAQPEAVNWRRWR
Ga0318554_1016010643300031765SoilFKVPEREKAEVLAAFGAEKGEVTAGSQPGQVNWRRWR
Ga0318526_1008072413300031769SoilDFKVPEREKGEVLAAFAAEKGEVSAGSQPEAVNWRRWR
Ga0318521_1029220223300031770SoilDDFHVPEREKAEVLAGFAGEKGEVTAGSQPGAVNWRRWR
Ga0318543_1015970623300031777SoilTQELINAMDDFKVPDREKAEVLAAFGAEKGEVTAGSQPGEVNWRRWR
Ga0318508_108262433300031780SoilRHTLDHFGVPEREKGEVLGAFGAERREVTAGSQPGAVNWRRWR
Ga0318576_1030234823300031796SoilVPEREKAEVLAGFAGEKGEVTAGSQPGAVNWRRWR
Ga0318565_1063599513300031799SoilDDFKVPEREKAEVLAAFGAEKGEVTAGSQPGAVNWRRWR
Ga0318497_1030834533300031805SoilMDDFKVPDREKAEVLAAFGAEKGEVTAGSQSGEVNWRRWR
Ga0318497_1075200823300031805SoilELINAMDDFKVPDREKAEVLAAFGAEKGEVTAGSQPGEVNWRRWR
Ga0318527_1032005023300031859SoilFKVPEREKAEVLAAFGGEKGEVSAGSQPGAVNWRRWR
Ga0318495_1003811643300031860SoilFKVPEREKAEVLAAFGAEKGEVTASSQPGEVNWRRWR
Ga0318536_1004068533300031893SoilINAMDDFKVPEREKAEVLAAFGAEKGEVTAGSQPGAVNWRRWR
Ga0318522_1036944823300031894SoilKVPEREKAEVLAAFGAEKGEVTAGSQPGAVNWRRWR
Ga0318551_1051163523300031896SoilDDFKVPEREKAEVLAAFGAEKGEVTAGSQSGEVNWRRWR
Ga0318551_1070564013300031896SoilLDDFNVPEREKGEVLAGFAGEKGEVTAGSQPGAVNWRRWR
Ga0307407_1015506213300031903RhizosphereVPEREKGEVLAAFGGWKDEVTAGSKQGAVNWRRWR
Ga0306921_1116473623300031912SoilNAMDDFKVPEREKAEVLAAFGAEKGEVTAGSQPGAVNWRRWR
Ga0306921_1155055613300031912SoilLINAMDDFKVPEREKAEVLAAFGAEKGEVTAGSQPGAVNWRRWR
Ga0306921_1260265423300031912SoilMDDFKVPEREKAEVLAAFGAEKGEVTAGSQPGAVNWRRWR
Ga0310912_1006506213300031941SoilFKVPEREKAEVLAAFGAEKGEVTAGSQPGAVNWRRWR
Ga0310910_1049916323300031946SoilDDFNVPEREKGEVLAGFAGEKGEVTAGSQPGAVNWRRWR
Ga0306926_1081530323300031954SoilFEVPEREKAEVLAAFGAEKGEVTAGSEPGAVNWRRWR
Ga0307416_10285629713300032002RhizosphereRTLDHFSVPEREKEEVLAAFNGWKEEVTAGSKPGAINWRRWR
Ga0318507_1021222523300032025SoilVPEREKGEVLAAFAAEKGEVSAGSQPGAVNWRRWR
Ga0318559_1016673033300032039SoilVPDREKAEVLAAFGAEKGEVTAGSQSGEVNWRRWR
Ga0318556_1061940313300032043SoilELINAMDDFKVPEREKAEVLAAFGAEKGEVTAGSEPGQVNWRRWR
Ga0318558_1062528423300032044SoilSTLDDFKVPEREKAEVLAAFGGEKGEVSAGSQPGAVNWRRWR
Ga0318514_1040554613300032066SoilFKVPEREKAEVLAAFGAEKGEVTASSQPGEANWRRWR
Ga0318524_1074264933300032067SoilTLDHFQVPEPEKGEVLGAFAGWRGEVTAGAEPGAVNWRRWR
Ga0318525_1026978313300032089SoilDDFNVPEREKQEVLAAFADEEGEVSAGSPSGAVNWRRWS
Ga0318518_1052428613300032090SoilDDFKVPEREKGEVLAAFAAEKGEVSAGSQPEAVNWRRWR
Ga0318577_1050256033300032091SoilVPEPEKGEVLGAFAGWRGEVTAGAQPEAVNWRRWR
Ga0310914_1038431513300033289SoilKVPEREKAEVLAAFGAEKGEVTAGSEPGAVNWRRWR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.