Basic Information | |
---|---|
Family ID | F097812 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 104 |
Average Sequence Length | 41 residues |
Representative Sequence | DDFKVPEREKAEVLAAFGAEKGEVTAGSQPGAVNWRRWR |
Number of Associated Samples | 91 |
Number of Associated Scaffolds | 104 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.92 % |
% of genes near scaffold ends (potentially truncated) | 96.15 % |
% of genes from short scaffolds (< 2000 bps) | 95.19 % |
Associated GOLD sequencing projects | 87 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.29 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (50.962 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (36.538 % of family members) |
Environment Ontology (ENVO) | Unclassified (42.308 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.154 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.90% β-sheet: 0.00% Coil/Unstructured: 79.10% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 104 Family Scaffolds |
---|---|---|
PF07784 | DUF1622 | 11.54 |
PF00196 | GerE | 4.81 |
PF00923 | TAL_FSA | 2.88 |
PF08281 | Sigma70_r4_2 | 2.88 |
PF12973 | Cupin_7 | 2.88 |
PF13191 | AAA_16 | 1.92 |
PF05201 | GlutR_N | 1.92 |
PF00440 | TetR_N | 1.92 |
PF07992 | Pyr_redox_2 | 1.92 |
PF06441 | EHN | 0.96 |
PF00708 | Acylphosphatase | 0.96 |
PF13474 | SnoaL_3 | 0.96 |
PF01242 | PTPS | 0.96 |
PF13610 | DDE_Tnp_IS240 | 0.96 |
PF00903 | Glyoxalase | 0.96 |
PF02540 | NAD_synthase | 0.96 |
PF13358 | DDE_3 | 0.96 |
PF00999 | Na_H_Exchanger | 0.96 |
PF12840 | HTH_20 | 0.96 |
PF07282 | OrfB_Zn_ribbon | 0.96 |
PF04185 | Phosphoesterase | 0.96 |
PF14759 | Reductase_C | 0.96 |
COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
---|---|---|---|
COG4828 | Uncharacterized membrane protein | Function unknown [S] | 11.54 |
COG0176 | Transaldolase/fructose-6-phosphate aldolase | Carbohydrate transport and metabolism [G] | 2.88 |
COG0373 | Glutamyl-tRNA reductase | Coenzyme transport and metabolism [H] | 1.92 |
COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.96 |
COG0171 | NH3-dependent NAD+ synthetase | Coenzyme transport and metabolism [H] | 0.96 |
COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.96 |
COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 0.96 |
COG0720 | 6-pyruvoyl-tetrahydropterin synthase | Coenzyme transport and metabolism [H] | 0.96 |
COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.96 |
COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.96 |
COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.96 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 50.96 % |
Unclassified | root | N/A | 49.04 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2199352024|deeps__Contig_74590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 766 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101963541 | Not Available | 608 | Open in IMG/M |
3300002028|A17_1213572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 650 | Open in IMG/M |
3300002568|C688J35102_120295991 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
3300004629|Ga0008092_11282719 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300005332|Ga0066388_102014802 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
3300005363|Ga0008090_10044702 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300005363|Ga0008090_15165540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → Methylocystis rosea | 500 | Open in IMG/M |
3300005468|Ga0070707_101309660 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
3300005535|Ga0070684_101565243 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
3300005764|Ga0066903_101492618 | All Organisms → cellular organisms → Bacteria | 1276 | Open in IMG/M |
3300005764|Ga0066903_105102788 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
3300005764|Ga0066903_108178911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 535 | Open in IMG/M |
3300006032|Ga0066696_10621119 | Not Available | 700 | Open in IMG/M |
3300006034|Ga0066656_10219272 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
3300006175|Ga0070712_100401851 | Not Available | 1132 | Open in IMG/M |
3300006796|Ga0066665_10929305 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
3300006852|Ga0075433_11095542 | Not Available | 693 | Open in IMG/M |
3300006954|Ga0079219_10127027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1313 | Open in IMG/M |
3300009137|Ga0066709_100497491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1716 | Open in IMG/M |
3300009147|Ga0114129_10734753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 1265 | Open in IMG/M |
3300009147|Ga0114129_11524768 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
3300009792|Ga0126374_11168149 | Not Available | 614 | Open in IMG/M |
3300010040|Ga0126308_10311357 | Not Available | 1037 | Open in IMG/M |
3300010045|Ga0126311_10120532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1830 | Open in IMG/M |
3300010046|Ga0126384_10799004 | Not Available | 844 | Open in IMG/M |
3300010154|Ga0127503_11100111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 509 | Open in IMG/M |
3300010358|Ga0126370_10839590 | Not Available | 823 | Open in IMG/M |
3300010359|Ga0126376_10772051 | Not Available | 934 | Open in IMG/M |
3300010360|Ga0126372_12786918 | Not Available | 541 | Open in IMG/M |
3300010373|Ga0134128_11779162 | Not Available | 678 | Open in IMG/M |
3300010376|Ga0126381_101603915 | Not Available | 940 | Open in IMG/M |
3300010376|Ga0126381_104043351 | Not Available | 570 | Open in IMG/M |
3300010398|Ga0126383_10727686 | Not Available | 1072 | Open in IMG/M |
3300010398|Ga0126383_11304575 | Not Available | 816 | Open in IMG/M |
3300010398|Ga0126383_13649981 | Not Available | 503 | Open in IMG/M |
3300012198|Ga0137364_10575555 | Not Available | 848 | Open in IMG/M |
3300012201|Ga0137365_10260155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1289 | Open in IMG/M |
3300012202|Ga0137363_10103766 | All Organisms → cellular organisms → Bacteria | 2165 | Open in IMG/M |
3300012204|Ga0137374_10213715 | Not Available | 1649 | Open in IMG/M |
3300012207|Ga0137381_10351459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1285 | Open in IMG/M |
3300012941|Ga0162652_100071692 | Not Available | 591 | Open in IMG/M |
3300012957|Ga0164303_10717529 | Not Available | 676 | Open in IMG/M |
3300012989|Ga0164305_11360845 | Not Available | 623 | Open in IMG/M |
3300013102|Ga0157371_10662981 | Not Available | 779 | Open in IMG/M |
3300015372|Ga0132256_100532637 | Not Available | 1286 | Open in IMG/M |
3300016294|Ga0182041_11258632 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300016422|Ga0182039_11211539 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300017972|Ga0187781_10254293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1243 | Open in IMG/M |
3300018062|Ga0187784_10213206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1575 | Open in IMG/M |
3300020581|Ga0210399_11489765 | Not Available | 525 | Open in IMG/M |
3300021560|Ga0126371_10944401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha | 1005 | Open in IMG/M |
3300021560|Ga0126371_11900641 | Not Available | 714 | Open in IMG/M |
3300025922|Ga0207646_10697011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonosporobacteraceae → Ktedonosporobacter → Ktedonosporobacter rubrisoli | 908 | Open in IMG/M |
3300026300|Ga0209027_1143030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 820 | Open in IMG/M |
3300026538|Ga0209056_10706980 | Not Available | 510 | Open in IMG/M |
3300027905|Ga0209415_10034898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7057 | Open in IMG/M |
3300028592|Ga0247822_11013180 | Not Available | 686 | Open in IMG/M |
3300031446|Ga0170820_14154926 | Not Available | 780 | Open in IMG/M |
3300031474|Ga0170818_111837720 | Not Available | 505 | Open in IMG/M |
3300031543|Ga0318516_10472071 | Not Available | 721 | Open in IMG/M |
3300031543|Ga0318516_10786159 | Not Available | 538 | Open in IMG/M |
3300031545|Ga0318541_10173460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1189 | Open in IMG/M |
3300031546|Ga0318538_10210648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Knoellia → Knoellia sinensis → Knoellia sinensis KCTC 19936 | 1039 | Open in IMG/M |
3300031561|Ga0318528_10269064 | Not Available | 914 | Open in IMG/M |
3300031564|Ga0318573_10574043 | Not Available | 607 | Open in IMG/M |
3300031640|Ga0318555_10608046 | Not Available | 592 | Open in IMG/M |
3300031713|Ga0318496_10199651 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
3300031723|Ga0318493_10495703 | Not Available | 675 | Open in IMG/M |
3300031744|Ga0306918_10656930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 821 | Open in IMG/M |
3300031764|Ga0318535_10145492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1055 | Open in IMG/M |
3300031765|Ga0318554_10160106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1279 | Open in IMG/M |
3300031769|Ga0318526_10080724 | All Organisms → cellular organisms → Bacteria | 1281 | Open in IMG/M |
3300031770|Ga0318521_10292202 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
3300031777|Ga0318543_10159706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Knoellia → Knoellia sinensis → Knoellia sinensis KCTC 19936 | 993 | Open in IMG/M |
3300031780|Ga0318508_1082624 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
3300031796|Ga0318576_10302348 | Not Available | 756 | Open in IMG/M |
3300031799|Ga0318565_10635995 | Not Available | 512 | Open in IMG/M |
3300031805|Ga0318497_10308345 | Not Available | 882 | Open in IMG/M |
3300031805|Ga0318497_10752008 | Not Available | 546 | Open in IMG/M |
3300031859|Ga0318527_10320050 | Not Available | 661 | Open in IMG/M |
3300031860|Ga0318495_10038116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2113 | Open in IMG/M |
3300031893|Ga0318536_10040685 | Not Available | 2215 | Open in IMG/M |
3300031894|Ga0318522_10369448 | Not Available | 543 | Open in IMG/M |
3300031896|Ga0318551_10511635 | Not Available | 689 | Open in IMG/M |
3300031896|Ga0318551_10705640 | Not Available | 585 | Open in IMG/M |
3300031903|Ga0307407_10155062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1492 | Open in IMG/M |
3300031912|Ga0306921_11164736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 860 | Open in IMG/M |
3300031912|Ga0306921_11550556 | Not Available | 722 | Open in IMG/M |
3300031912|Ga0306921_12602654 | Not Available | 522 | Open in IMG/M |
3300031941|Ga0310912_10065062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2607 | Open in IMG/M |
3300031946|Ga0310910_10499163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. RIT328 | 966 | Open in IMG/M |
3300031954|Ga0306926_10815303 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
3300032002|Ga0307416_102856297 | Not Available | 578 | Open in IMG/M |
3300032025|Ga0318507_10212225 | Not Available | 836 | Open in IMG/M |
3300032039|Ga0318559_10166730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1005 | Open in IMG/M |
3300032043|Ga0318556_10619403 | Not Available | 564 | Open in IMG/M |
3300032044|Ga0318558_10625284 | Not Available | 538 | Open in IMG/M |
3300032066|Ga0318514_10405546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 724 | Open in IMG/M |
3300032067|Ga0318524_10742649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 518 | Open in IMG/M |
3300032089|Ga0318525_10269783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 874 | Open in IMG/M |
3300032090|Ga0318518_10524286 | Not Available | 606 | Open in IMG/M |
3300032091|Ga0318577_10502560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 578 | Open in IMG/M |
3300033289|Ga0310914_10384315 | All Organisms → cellular organisms → Bacteria | 1270 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 36.54% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.54% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.73% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.81% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.85% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.88% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.88% |
Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 2.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.92% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.92% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.92% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.92% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.92% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.92% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.96% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.96% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.96% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.96% |
Permafrost And Active Layer Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost And Active Layer Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.96% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.96% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.96% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.96% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.96% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300002028 | Permafrost and active layer soil microbial communities from McGill Arctic Research Station (MARS), Canada, for enrichment studies - Sample_A17 | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300004629 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A01 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012941 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015 | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
deeps_01210990 | 2199352024 | Soil | VHRDGRLDDFNVPEREKQEVLAAFAGEKGEVSAGSPSGAVNWRRWS |
INPhiseqgaiiFebDRAFT_1019635411 | 3300000364 | Soil | GRCNRDGRLDDFNVPEREKQEVLAAFAGEKGEVSAGSPSGAVNWRRWS* |
A17_12135721 | 3300002028 | Permafrost And Active Layer Soil | RTLDHFNVPEREKGEALAAFNGWKGEVTAGSDPDAVNWRRWN* |
C688J35102_1202959913 | 3300002568 | Soil | LDDFNVPEREKQEVLAAFAAEKGEVTAGSQPGAVNWRSWP* |
Ga0008092_112827191 | 3300004629 | Tropical Rainforest Soil | NALDDFNVPEREKQEVLAAFDGEKGEVSAGSQPGAVNWRRWR* |
Ga0066388_1020148024 | 3300005332 | Tropical Forest Soil | MDDFKVPEREKAEVLAAFGAEKGEVTAGSQPGAVNWRRWR* |
Ga0008090_100447021 | 3300005363 | Tropical Rainforest Soil | MDDFKVPEREKAEVLAAFGAEKGEVTAGSQPGEVNWRRWR* |
Ga0008090_151655401 | 3300005363 | Tropical Rainforest Soil | ALDDFNVPEREKNEVLGAFGGEKGEVTAGSQPGAVNWATWD* |
Ga0070707_1013096602 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | TLDHFKVPEREKGEVLSAFARWKGEVTAGSEPGSVNWRRWR* |
Ga0070684_1015652431 | 3300005535 | Corn Rhizosphere | VSAELANALDDFNVPEREKQEVLAAFNREKSEVSAGSQPGAVNWRRWH* |
Ga0066903_1014926181 | 3300005764 | Tropical Forest Soil | QELINAMDDFKVPEREKAEVLAAFGAEKGEVTAGSEPGAVNWRRWR* |
Ga0066903_1051027881 | 3300005764 | Tropical Forest Soil | VPEREKAEVLAGFAGEKGEVTAGSQPGAVNWRRWR* |
Ga0066903_1081789111 | 3300005764 | Tropical Forest Soil | NAMDDFKVPEREKAEVLAAFGAEKGEVTAGSQPGAVNWRRWR* |
Ga0066696_106211191 | 3300006032 | Soil | DDFNVPEREKQEVLAAFAAEKGEVTAGSQPGAVNWRSWH* |
Ga0066656_102192723 | 3300006034 | Soil | LTLDHFKVPEREKGEVLGTFARWKGEVTAGSESGSVNWRRWR* |
Ga0070712_1004018511 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | ELANALDEFQVPEREKQEVLAGFAGEKSEVTAGSQPGAVNWRRWR* |
Ga0066665_109293052 | 3300006796 | Soil | HFKVPEREKGEVLAAFAGWKGEVTAGSEPGSVNWRRWR* |
Ga0075433_110955421 | 3300006852 | Populus Rhizosphere | LDEFKVPEREKQEVLAAFAAEKGEVTAGSQPGAVNWRRWR* |
Ga0079219_101270273 | 3300006954 | Agricultural Soil | GRRLRPRPVHGDGRLDDFNLPEREKQEVLAAFAGEKGEVSAGSPSGAVNWRRWS* |
Ga0066709_1004974913 | 3300009137 | Grasslands Soil | GRRLRPRPVHRDGRLDDFNVPEREKQEVLAAFAGEKGEVSAGFPSGAVNWRRWS* |
Ga0114129_107347531 | 3300009147 | Populus Rhizosphere | PEREKGEVLAAFGGWKDEVTAGSKPGAVNWRRWR* |
Ga0114129_115247683 | 3300009147 | Populus Rhizosphere | GATLDHFGVPEREKGEVLDAFASRKGEVTAGSERGAVNWRRWRSGA* |
Ga0126374_111681492 | 3300009792 | Tropical Forest Soil | LDDFNVPEREKGEVLAAFAGEKSEVSAGSQPGAVNWRRWRS* |
Ga0126308_103113571 | 3300010040 | Serpentine Soil | HFSVPGGEKEEVLAAFNGWKEEVTAGSQPDAINWRRWR* |
Ga0126311_101205321 | 3300010045 | Serpentine Soil | TLDHFNVPEREQEEVLAAFNGWKEEVTAGSQPGAINWRRWR* |
Ga0126384_107990042 | 3300010046 | Tropical Forest Soil | VPEREKQEVLAAFAAEKGEVSAGSQPGAVNWRSWR* |
Ga0127503_111001112 | 3300010154 | Soil | FKVPEREKGEVLGAFAGWKGEVTAGSEPGVVNWRRWH* |
Ga0126370_108395901 | 3300010358 | Tropical Forest Soil | DFKVPEREKAEVLAAFGAEKGEVTAGSQPGAVNWRRWR* |
Ga0126376_107720512 | 3300010359 | Tropical Forest Soil | GMIRLRTVLDEFKVPEREKQEVLAAFAAEKGEVTAGSQPGEVNWRRWR* |
Ga0126372_127869182 | 3300010360 | Tropical Forest Soil | INAMDDFKVPEREKAEVLAAFGAEKGEVTAGSQPGEVNWRRWR* |
Ga0134128_117791622 | 3300010373 | Terrestrial Soil | DFNVPEREKQEVLAAFNGEKGEVSAGSQPGAVNWRRWR* |
Ga0126381_1016039153 | 3300010376 | Tropical Forest Soil | DFKVPEREKAEVLAAFGAEKGEVTAGSQPGAVNWRRWP* |
Ga0126381_1040433511 | 3300010376 | Tropical Forest Soil | VPEREKAEVLAAFGAEKGEVTAGSQPGAVNWRRWR* |
Ga0126383_107276861 | 3300010398 | Tropical Forest Soil | SVPEREKQEVLAAFAAEKGEVTAGSQPGAVNWRSWH* |
Ga0126383_113045752 | 3300010398 | Tropical Forest Soil | INAMDDFKVPEREKAEVLAAFGAEKGEVTAGSQSGEVNWRRWR* |
Ga0126383_136499811 | 3300010398 | Tropical Forest Soil | DAFNVPEREKQEVLAAFAAEKGEVTAGSQPGAVNWRSWH* |
Ga0137364_105755551 | 3300012198 | Vadose Zone Soil | TLDEFNVPEREKGEVLAGFAGEKSEVTAGSQPGAVNWRRWR* |
Ga0137365_102601553 | 3300012201 | Vadose Zone Soil | VHRDGRLDDFNVPEREKQEVLAAFAGEKGEVSAGFPSGAVNWRRWS* |
Ga0137363_101037663 | 3300012202 | Vadose Zone Soil | MDEFQVPDREKQEVLAAFANEKGAVTAGSQPEAVNWRRWR* |
Ga0137374_102137154 | 3300012204 | Vadose Zone Soil | FKVPEREKGEALAAFNGWKDEVTAGSKPGAVNWRRWH* |
Ga0137381_103514591 | 3300012207 | Vadose Zone Soil | HRDGRLDDFNVPEREKQEVLAAFAGEKGEVSAGSPSGAVNWRRWS* |
Ga0162652_1000716922 | 3300012941 | Soil | LDDFNVPEREKQEVLAAFAAEKGEVTAGSQPGAVNWRSWH* |
Ga0164303_107175292 | 3300012957 | Soil | TLDHFNVPEREKGEVLTAFGGWKGEVTAGSKEGAVNWRRWH* |
Ga0164305_113608452 | 3300012989 | Soil | DFHVPEREKGEVLAGFAGEKGEVTAGSQPEAVNWRRWR* |
Ga0157371_106629811 | 3300013102 | Corn Rhizosphere | LDDFNVPEREKGEVLAGFAGGKGAVTAGSQPGAVNWRRWR* |
Ga0132256_1005326373 | 3300015372 | Arabidopsis Rhizosphere | DDFNVPEREKQEVLAAFNGEKGEVSAGSQPGEVNWRRWR* |
Ga0182041_112586321 | 3300016294 | Soil | NAMDDFKVPEREKAEVLAAFGAEKGEVTAGSQPGEVNWRRWR |
Ga0182039_112115391 | 3300016422 | Soil | LINAMDDFKVPEREKAEVLAAFGAEKGEVTAGSQPGEVNWRRWR |
Ga0187781_102542931 | 3300017972 | Tropical Peatland | FKVPGREKAEVLEAFAGWKGEVTAGSAPESVNWRRWR |
Ga0187784_102132063 | 3300018062 | Tropical Peatland | MSPEPTDFKVPGREKAEVLEAFAGWKGEVTAGSAPESVNWRRWR |
Ga0210399_114897651 | 3300020581 | Soil | QELINALNEFKVPEREKQEVLAAFANEKGEVTAGSQPGAVNWRRWR |
Ga0126371_109444013 | 3300021560 | Tropical Forest Soil | VPEREKAEVLAAFGAEKGEVTAGSQPGAVNWRRWR |
Ga0126371_119006411 | 3300021560 | Tropical Forest Soil | AMDDFKVPEREKAEVLAAFGAEKGEVTAGSQPGAVNWRRWP |
Ga0207646_106970112 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | TLDHFKVPEREKGEVLSAFARWKGEVTAGSEPGSVNWRRWR |
Ga0209027_11430301 | 3300026300 | Grasslands Soil | LTLDHFKVPEREKGEVLGAFARWKGEVTAGSEPGSVNWRRWR |
Ga0209056_107069802 | 3300026538 | Soil | FNVPEREKQEVLAAFAGEKGEVSAGFPSGAVNWRRWS |
Ga0209415_100348981 | 3300027905 | Peatlands Soil | HFKVPEREKDQVLDAFAGWKGEVTAGSKPEAVNWRRWR |
Ga0247822_110131802 | 3300028592 | Soil | LTLEHFRVPERERGEVLGAFAGWKGEVTAGSEPGATNWRRWRSRP |
Ga0170820_141549261 | 3300031446 | Forest Soil | LDDFNVPEREKGEVLAGFAGEKSEVSAGSQPGAVNWRRWR |
Ga0170818_1118377201 | 3300031474 | Forest Soil | SAELANALDDFNVPEREKQEVLAAFNGEKGEVSAGSQPGEVNWRRWR |
Ga0318516_104720712 | 3300031543 | Soil | DFKVPEREKGEVLAAFAAEKGEVSAGSQPGAVNWRRWR |
Ga0318516_107861591 | 3300031543 | Soil | DFKVPEREKAEVLAAFGAEKGEVTAGSQSGEVNWRRWR |
Ga0318541_101734602 | 3300031545 | Soil | FKVPEREKGEVLAAFAAEKGEVSAGSQPEAVNWRRWR |
Ga0318538_102106481 | 3300031546 | Soil | AMDEFKVPEREKQEVLAAFAAEKGEVTAGSQPGAVNWRSWH |
Ga0318528_102690643 | 3300031561 | Soil | AMDDFKVPEREKAEVLAAFGAEKGEVTAGSQPGAVNWRRWR |
Ga0318573_105740431 | 3300031564 | Soil | LDDFKVPEREKGEVLAAFAAEKGEVSAGSQPGAVNWRRWR |
Ga0318555_106080461 | 3300031640 | Soil | NAMDDFKVPEREKAEVLAAFGAEKGEVTAGSQPGAVNWRRWP |
Ga0318496_101996512 | 3300031713 | Soil | QELINAMDDFKVPDREKAEVLAAFGAEKGEVTAGSQPGEVNWRRWR |
Ga0318493_104957031 | 3300031723 | Soil | FNVPEREKAEVLAGFAGEKGEVTAGSQRGAVNWRRWR |
Ga0306918_106569303 | 3300031744 | Soil | AELSYTLDHFQVPEPEKGEVLGAFAGWRGEVTAGAEPGAVNWRRWR |
Ga0318535_101454921 | 3300031764 | Soil | LDDFKVPEPEKGEVLGAFAGWRGEVTAGAQPEAVNWRRWR |
Ga0318554_101601064 | 3300031765 | Soil | FKVPEREKAEVLAAFGAEKGEVTAGSQPGQVNWRRWR |
Ga0318526_100807241 | 3300031769 | Soil | DFKVPEREKGEVLAAFAAEKGEVSAGSQPEAVNWRRWR |
Ga0318521_102922022 | 3300031770 | Soil | DDFHVPEREKAEVLAGFAGEKGEVTAGSQPGAVNWRRWR |
Ga0318543_101597062 | 3300031777 | Soil | TQELINAMDDFKVPDREKAEVLAAFGAEKGEVTAGSQPGEVNWRRWR |
Ga0318508_10826243 | 3300031780 | Soil | RHTLDHFGVPEREKGEVLGAFGAERREVTAGSQPGAVNWRRWR |
Ga0318576_103023482 | 3300031796 | Soil | VPEREKAEVLAGFAGEKGEVTAGSQPGAVNWRRWR |
Ga0318565_106359951 | 3300031799 | Soil | DDFKVPEREKAEVLAAFGAEKGEVTAGSQPGAVNWRRWR |
Ga0318497_103083453 | 3300031805 | Soil | MDDFKVPDREKAEVLAAFGAEKGEVTAGSQSGEVNWRRWR |
Ga0318497_107520082 | 3300031805 | Soil | ELINAMDDFKVPDREKAEVLAAFGAEKGEVTAGSQPGEVNWRRWR |
Ga0318527_103200502 | 3300031859 | Soil | FKVPEREKAEVLAAFGGEKGEVSAGSQPGAVNWRRWR |
Ga0318495_100381164 | 3300031860 | Soil | FKVPEREKAEVLAAFGAEKGEVTASSQPGEVNWRRWR |
Ga0318536_100406853 | 3300031893 | Soil | INAMDDFKVPEREKAEVLAAFGAEKGEVTAGSQPGAVNWRRWR |
Ga0318522_103694482 | 3300031894 | Soil | KVPEREKAEVLAAFGAEKGEVTAGSQPGAVNWRRWR |
Ga0318551_105116352 | 3300031896 | Soil | DDFKVPEREKAEVLAAFGAEKGEVTAGSQSGEVNWRRWR |
Ga0318551_107056401 | 3300031896 | Soil | LDDFNVPEREKGEVLAGFAGEKGEVTAGSQPGAVNWRRWR |
Ga0307407_101550621 | 3300031903 | Rhizosphere | VPEREKGEVLAAFGGWKDEVTAGSKQGAVNWRRWR |
Ga0306921_111647362 | 3300031912 | Soil | NAMDDFKVPEREKAEVLAAFGAEKGEVTAGSQPGAVNWRRWR |
Ga0306921_115505561 | 3300031912 | Soil | LINAMDDFKVPEREKAEVLAAFGAEKGEVTAGSQPGAVNWRRWR |
Ga0306921_126026542 | 3300031912 | Soil | MDDFKVPEREKAEVLAAFGAEKGEVTAGSQPGAVNWRRWR |
Ga0310912_100650621 | 3300031941 | Soil | FKVPEREKAEVLAAFGAEKGEVTAGSQPGAVNWRRWR |
Ga0310910_104991632 | 3300031946 | Soil | DDFNVPEREKGEVLAGFAGEKGEVTAGSQPGAVNWRRWR |
Ga0306926_108153032 | 3300031954 | Soil | FEVPEREKAEVLAAFGAEKGEVTAGSEPGAVNWRRWR |
Ga0307416_1028562971 | 3300032002 | Rhizosphere | RTLDHFSVPEREKEEVLAAFNGWKEEVTAGSKPGAINWRRWR |
Ga0318507_102122252 | 3300032025 | Soil | VPEREKGEVLAAFAAEKGEVSAGSQPGAVNWRRWR |
Ga0318559_101667303 | 3300032039 | Soil | VPDREKAEVLAAFGAEKGEVTAGSQSGEVNWRRWR |
Ga0318556_106194031 | 3300032043 | Soil | ELINAMDDFKVPEREKAEVLAAFGAEKGEVTAGSEPGQVNWRRWR |
Ga0318558_106252842 | 3300032044 | Soil | STLDDFKVPEREKAEVLAAFGGEKGEVSAGSQPGAVNWRRWR |
Ga0318514_104055461 | 3300032066 | Soil | FKVPEREKAEVLAAFGAEKGEVTASSQPGEANWRRWR |
Ga0318524_107426493 | 3300032067 | Soil | TLDHFQVPEPEKGEVLGAFAGWRGEVTAGAEPGAVNWRRWR |
Ga0318525_102697831 | 3300032089 | Soil | DDFNVPEREKQEVLAAFADEEGEVSAGSPSGAVNWRRWS |
Ga0318518_105242861 | 3300032090 | Soil | DDFKVPEREKGEVLAAFAAEKGEVSAGSQPEAVNWRRWR |
Ga0318577_105025603 | 3300032091 | Soil | VPEPEKGEVLGAFAGWRGEVTAGAQPEAVNWRRWR |
Ga0310914_103843151 | 3300033289 | Soil | KVPEREKAEVLAAFGAEKGEVTAGSEPGAVNWRRWR |
⦗Top⦘ |