Basic Information | |
---|---|
Family ID | F097851 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 104 |
Average Sequence Length | 41 residues |
Representative Sequence | ALVMMALADVLTRLVVIYLRGHRLAAGPAAAAARIPAGVRA |
Number of Associated Samples | 91 |
Number of Associated Scaffolds | 104 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 8.65 % |
% of genes near scaffold ends (potentially truncated) | 85.58 % |
% of genes from short scaffolds (< 2000 bps) | 92.31 % |
Associated GOLD sequencing projects | 89 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.46 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (50.000 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (28.846 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.308 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.83% β-sheet: 0.00% Coil/Unstructured: 52.17% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 104 Family Scaffolds |
---|---|---|
PF07730 | HisKA_3 | 13.46 |
PF00239 | Resolvase | 3.85 |
PF02796 | HTH_7 | 2.88 |
PF00072 | Response_reg | 1.92 |
PF00196 | GerE | 1.92 |
PF12680 | SnoaL_2 | 1.92 |
PF01042 | Ribonuc_L-PSP | 1.92 |
PF01276 | OKR_DC_1 | 0.96 |
PF02861 | Clp_N | 0.96 |
PF00931 | NB-ARC | 0.96 |
PF13432 | TPR_16 | 0.96 |
PF13384 | HTH_23 | 0.96 |
PF03551 | PadR | 0.96 |
PF00211 | Guanylate_cyc | 0.96 |
PF00480 | ROK | 0.96 |
PF00155 | Aminotran_1_2 | 0.96 |
PF00144 | Beta-lactamase | 0.96 |
COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
---|---|---|---|
COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 13.46 |
COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 13.46 |
COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 13.46 |
COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 13.46 |
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 3.85 |
COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 3.85 |
COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 1.92 |
COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 1.92 |
COG0112 | Glycine/serine hydroxymethyltransferase | Amino acid transport and metabolism [E] | 0.96 |
COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.96 |
COG0542 | ATP-dependent Clp protease, ATP-binding subunit ClpA | Posttranslational modification, protein turnover, chaperones [O] | 0.96 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.96 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.96 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.96 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.96 |
COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.96 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.96 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.96 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 50.00 % |
Unclassified | root | N/A | 50.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300005181|Ga0066678_10951707 | Not Available | 559 | Open in IMG/M |
3300005332|Ga0066388_101311963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1249 | Open in IMG/M |
3300005334|Ga0068869_100067563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2638 | Open in IMG/M |
3300005406|Ga0070703_10109671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 986 | Open in IMG/M |
3300005436|Ga0070713_102419221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 508 | Open in IMG/M |
3300005444|Ga0070694_100817834 | Not Available | 765 | Open in IMG/M |
3300005458|Ga0070681_12047239 | Not Available | 501 | Open in IMG/M |
3300005518|Ga0070699_100214915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1712 | Open in IMG/M |
3300005534|Ga0070735_10808805 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300005534|Ga0070735_10921592 | Not Available | 513 | Open in IMG/M |
3300005537|Ga0070730_10753914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 615 | Open in IMG/M |
3300005576|Ga0066708_10674083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 657 | Open in IMG/M |
3300005617|Ga0068859_100194119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces mobaraensis | 2115 | Open in IMG/M |
3300006028|Ga0070717_10470793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1134 | Open in IMG/M |
3300006028|Ga0070717_11967954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 527 | Open in IMG/M |
3300006050|Ga0075028_100792105 | Not Available | 577 | Open in IMG/M |
3300006174|Ga0075014_100344356 | Not Available | 798 | Open in IMG/M |
3300009520|Ga0116214_1104545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium innocens | 1042 | Open in IMG/M |
3300009525|Ga0116220_10039780 | All Organisms → cellular organisms → Bacteria | 1945 | Open in IMG/M |
3300009525|Ga0116220_10503975 | Not Available | 549 | Open in IMG/M |
3300009624|Ga0116105_1202717 | Not Available | 548 | Open in IMG/M |
3300009643|Ga0116110_1277726 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300009700|Ga0116217_10460109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 802 | Open in IMG/M |
3300009764|Ga0116134_1139713 | Not Available | 859 | Open in IMG/M |
3300010303|Ga0134082_10483021 | Not Available | 539 | Open in IMG/M |
3300010379|Ga0136449_103317425 | Not Available | 618 | Open in IMG/M |
3300010401|Ga0134121_10530172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora | 1090 | Open in IMG/M |
3300010880|Ga0126350_12022787 | Not Available | 511 | Open in IMG/M |
3300010880|Ga0126350_12189505 | Not Available | 507 | Open in IMG/M |
3300012211|Ga0137377_11534712 | Not Available | 591 | Open in IMG/M |
3300013104|Ga0157370_11525219 | Not Available | 601 | Open in IMG/M |
3300013308|Ga0157375_11081203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 938 | Open in IMG/M |
3300014968|Ga0157379_10747375 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 920 | Open in IMG/M |
3300016341|Ga0182035_10608733 | Not Available | 945 | Open in IMG/M |
3300017654|Ga0134069_1171056 | Not Available | 732 | Open in IMG/M |
3300017932|Ga0187814_10081507 | Not Available | 1188 | Open in IMG/M |
3300017937|Ga0187809_10147479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 813 | Open in IMG/M |
3300017942|Ga0187808_10008757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3909 | Open in IMG/M |
3300017942|Ga0187808_10265773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 769 | Open in IMG/M |
3300017948|Ga0187847_10516572 | Not Available | 663 | Open in IMG/M |
3300017955|Ga0187817_10013895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4682 | Open in IMG/M |
3300017959|Ga0187779_10109296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 1673 | Open in IMG/M |
3300017973|Ga0187780_10735816 | Not Available | 712 | Open in IMG/M |
3300017973|Ga0187780_10772070 | Not Available | 695 | Open in IMG/M |
3300017973|Ga0187780_11293856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 536 | Open in IMG/M |
3300017974|Ga0187777_11294095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → unclassified Arthrobacter → Arthrobacter sp. AG258 | 535 | Open in IMG/M |
3300018017|Ga0187872_10112095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1349 | Open in IMG/M |
3300018086|Ga0187769_10350837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1106 | Open in IMG/M |
3300018089|Ga0187774_10869280 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300020579|Ga0210407_10162337 | All Organisms → cellular organisms → Bacteria | 1726 | Open in IMG/M |
3300020580|Ga0210403_10750653 | Not Available | 779 | Open in IMG/M |
3300021168|Ga0210406_11097244 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300021178|Ga0210408_10034589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3984 | Open in IMG/M |
3300021178|Ga0210408_10054224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 3132 | Open in IMG/M |
3300021377|Ga0213874_10299033 | Not Available | 605 | Open in IMG/M |
3300021403|Ga0210397_10005521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7690 | Open in IMG/M |
3300021445|Ga0182009_10854606 | Not Available | 500 | Open in IMG/M |
3300021479|Ga0210410_10928310 | Not Available | 758 | Open in IMG/M |
3300021479|Ga0210410_10998202 | Not Available | 726 | Open in IMG/M |
3300021860|Ga0213851_1028722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora | 1208 | Open in IMG/M |
3300025905|Ga0207685_10526224 | Not Available | 626 | Open in IMG/M |
3300025916|Ga0207663_11636820 | Not Available | 518 | Open in IMG/M |
3300025944|Ga0207661_11825456 | Not Available | 553 | Open in IMG/M |
3300026318|Ga0209471_1130171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora | 1062 | Open in IMG/M |
3300026551|Ga0209648_10167368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1717 | Open in IMG/M |
3300027748|Ga0209689_1301006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium | 622 | Open in IMG/M |
3300027826|Ga0209060_10458894 | Not Available | 579 | Open in IMG/M |
3300027884|Ga0209275_10604531 | Not Available | 629 | Open in IMG/M |
3300028784|Ga0307282_10350630 | Not Available | 713 | Open in IMG/M |
3300030494|Ga0310037_10293310 | Not Available | 695 | Open in IMG/M |
3300031680|Ga0318574_10171210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1240 | Open in IMG/M |
3300031718|Ga0307474_10892020 | Not Available | 704 | Open in IMG/M |
3300031719|Ga0306917_10503475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 951 | Open in IMG/M |
3300031720|Ga0307469_11818645 | Not Available | 589 | Open in IMG/M |
3300031751|Ga0318494_10670415 | Not Available | 607 | Open in IMG/M |
3300031770|Ga0318521_10436372 | Not Available | 783 | Open in IMG/M |
3300031778|Ga0318498_10451318 | Not Available | 569 | Open in IMG/M |
3300031797|Ga0318550_10483582 | Not Available | 598 | Open in IMG/M |
3300031798|Ga0318523_10515961 | Not Available | 591 | Open in IMG/M |
3300031805|Ga0318497_10384393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 785 | Open in IMG/M |
3300031819|Ga0318568_10258943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora | 1078 | Open in IMG/M |
3300031820|Ga0307473_10751984 | Not Available | 690 | Open in IMG/M |
3300031821|Ga0318567_10364941 | Not Available | 817 | Open in IMG/M |
3300031835|Ga0318517_10078798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1423 | Open in IMG/M |
3300031845|Ga0318511_10585212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 520 | Open in IMG/M |
3300031846|Ga0318512_10444850 | Not Available | 654 | Open in IMG/M |
3300031860|Ga0318495_10537734 | Not Available | 508 | Open in IMG/M |
3300031896|Ga0318551_10230647 | Not Available | 1031 | Open in IMG/M |
3300031897|Ga0318520_10318101 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
3300031945|Ga0310913_10518019 | Not Available | 847 | Open in IMG/M |
3300032001|Ga0306922_10310403 | Not Available | 1694 | Open in IMG/M |
3300032001|Ga0306922_10366335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1545 | Open in IMG/M |
3300032065|Ga0318513_10004481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4990 | Open in IMG/M |
3300032065|Ga0318513_10443150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 635 | Open in IMG/M |
3300032067|Ga0318524_10203224 | Not Available | 1013 | Open in IMG/M |
3300032089|Ga0318525_10162572 | Not Available | 1147 | Open in IMG/M |
3300032089|Ga0318525_10247259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 917 | Open in IMG/M |
3300032091|Ga0318577_10225488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 897 | Open in IMG/M |
3300032160|Ga0311301_11974981 | Not Available | 683 | Open in IMG/M |
3300032160|Ga0311301_12275340 | Not Available | 618 | Open in IMG/M |
3300032174|Ga0307470_10197504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1282 | Open in IMG/M |
3300032783|Ga0335079_10467505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1350 | Open in IMG/M |
3300033158|Ga0335077_11009195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 829 | Open in IMG/M |
3300034817|Ga0373948_0114965 | Not Available | 646 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 28.85% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 7.69% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.69% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.73% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.81% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.85% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.85% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.88% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.92% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.92% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.92% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.92% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.92% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.92% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.96% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.96% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.96% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.96% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.96% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.96% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.96% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.96% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0066678_109517072 | 3300005181 | Soil | AWVAALVMMALADALTRLVVVYLRGRRLTAGLAAARLPVPAGARA* |
Ga0066388_1013119632 | 3300005332 | Tropical Forest Soil | AWVAALVMMALADVLTRLAVIWLRGRRLAAGPAAAARIPAGAGA* |
Ga0068869_1000675631 | 3300005334 | Miscanthus Rhizosphere | AALIMMALADVLTRLVIIYLRGRRLANPAASVVRTPAGINA* |
Ga0070703_101096711 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | HHITGSAAWVAALIMMALADVLTRLVIIYLRGRRLANPAASVVRTPAGINA* |
Ga0070713_1024192211 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | WVAALVMMALADVLTRLAVIYLRGRRLAPVLAPAASRVTAGVRG* |
Ga0070694_1008178341 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | LIMMALADVLTRLVIIYLRGRRLAKPAASVVRTPAGINA* |
Ga0070681_120472391 | 3300005458 | Corn Rhizosphere | AALIMMALADVLTRLVIIYLRGRRLARPAATAVRTPAGIRA* |
Ga0070699_1002149151 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | WVAALVLMALADVLTRLVVIYLRGRRLAAGPAAPAAAVPAGARA* |
Ga0070735_108088052 | 3300005534 | Surface Soil | MMALADVLTRLAVVWLRGRRLAAGPAAAPALIPAGTHA* |
Ga0070735_109215922 | 3300005534 | Surface Soil | LADVLTRLVVIYLRGRRLAAASAPSVARIPAGVRG* |
Ga0070730_107539141 | 3300005537 | Surface Soil | IMMALADVLTRLAVIYLRGRALTGGPAPAAVRIPADARV* |
Ga0066708_106740832 | 3300005576 | Soil | AWVAALVMMALADVLTRLAVIYLRGRRLAAAPAAPAARIPAGVNG* |
Ga0068859_1001941191 | 3300005617 | Switchgrass Rhizosphere | AAWVAALIMMALADVLTRLVIIYLRGRRLANPAASVVRTPAGINA* |
Ga0070717_104707932 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | AWVAALVMMALADVLTRLALVWMRGRRLAAAPAAAPALIPAGTHA* |
Ga0070717_119679542 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LVMMALADVLTRLAVIYLRGRRLAARSAAAAAAVPAGART* |
Ga0075028_1007921052 | 3300006050 | Watersheds | MALADVLTRLVVIYLRGRRLAAGPAAPAAAVPAGARA* |
Ga0075014_1003443561 | 3300006174 | Watersheds | MMALADVLTRLVIIYLRGRRLATGSAATAARIPAGFGA* |
Ga0116214_11045451 | 3300009520 | Peatlands Soil | ALVMMALADVLTRLAVVWLRGRRLSAAPAAAPALIPAGTRA* |
Ga0116220_100397804 | 3300009525 | Peatlands Soil | ALVMMALADVLTRLAIVYLRGRRLAAAPAAAPATAPATATRKEP* |
Ga0116220_105039752 | 3300009525 | Peatlands Soil | AAWVAALVMMALADVLTRLIVIYLRGHRLTPASAVTEARIPAGVRA* |
Ga0116105_12027172 | 3300009624 | Peatland | ALADVLTRLVVIYLRGRRLAAAPAATAAGIPAGVRA* |
Ga0116110_12777262 | 3300009643 | Peatland | MMALADVLNRLVVVYLRGRRLAAGATATSALVPAGTRA* |
Ga0116217_104601092 | 3300009700 | Peatlands Soil | ALADVLTRLVIVYLRGRRLAAAPAAAPALIPADTHA* |
Ga0116134_11397132 | 3300009764 | Peatland | AWVAALVMMALADVLTRLAVVYLRGRRLATAPALIPAGARA* |
Ga0134082_104830211 | 3300010303 | Grasslands Soil | ALADVLTRLVIIYLRGRRLVGPAAIAIRTPADIRA* |
Ga0136449_1033174252 | 3300010379 | Peatlands Soil | VAALVMMALADVLTRLVVVYSRGRRLAAGPAPAPARIPAGSRG* |
Ga0134121_105301722 | 3300010401 | Terrestrial Soil | MMALADVLTRLVIIYLRGRRLAGPAATAVRTPAGIRA* |
Ga0126350_120227872 | 3300010880 | Boreal Forest Soil | LVMMALADVLTRLMVIYLRGRRLARGQAATAARIPAGVRA* |
Ga0126350_121895051 | 3300010880 | Boreal Forest Soil | ADVLTRLVVIYLRGRRLAAAPEVTAAGIRAGVRA* |
Ga0137377_115347121 | 3300012211 | Vadose Zone Soil | VAALVMMALADVLTRLMVIYMRGHRLAVGSAAATAAIPVGTRA* |
Ga0157370_115252192 | 3300013104 | Corn Rhizosphere | SAAWVAALIMMALADVLTRLVIIYLRGRRLAGPAAAAVRTPAGIRA* |
Ga0157375_110812031 | 3300013308 | Miscanthus Rhizosphere | TGSAAWVAALIMMALADVLTRLVIIYLRGRRLANPAASVVRTPAGINA* |
Ga0157379_107473752 | 3300014968 | Switchgrass Rhizosphere | AALIMMALADVLTRLVIVYLRGRRLAGPAATAVRTPAGINA* |
Ga0182035_106087333 | 3300016341 | Soil | AAWVAALVMMALADVLTRLVVIYLRGRRLAAGPAAAPVPAGARA |
Ga0134069_11710562 | 3300017654 | Grasslands Soil | VAALIMMALADVLTRLVIIYLRGRRLAGPAATAVRTPAGIHA |
Ga0187814_100815072 | 3300017932 | Freshwater Sediment | MMALTDVLTRLVVVYLRGRRLAAAPAATPAQVPAGTCA |
Ga0187809_101474792 | 3300017937 | Freshwater Sediment | WVAALVMMALADVLTRLAVIYLRGRRLAPAPTAARVLAGVRG |
Ga0187808_100087571 | 3300017942 | Freshwater Sediment | LADVLTRLAVVYLRGRRLAAGPRTQATPAAPAAATPVRVGAGA |
Ga0187808_102657731 | 3300017942 | Freshwater Sediment | MALADVLTRLVVVYLRGRRLTIAPAAAPALIPAGTHA |
Ga0187847_105165722 | 3300017948 | Peatland | MALADVLTRLVVIYLRGRRLAAAPAATAAGIPAGVRA |
Ga0187817_100138958 | 3300017955 | Freshwater Sediment | ALADVLTRLAVVYLRGRRLAAGPRTQATPAAPAAATPVRVGAGA |
Ga0187779_101092962 | 3300017959 | Tropical Peatland | VAALVMMALADVLTRLVVIYLRGHRLAAPAGTAARIAAGVRG |
Ga0187780_107358162 | 3300017973 | Tropical Peatland | ARSSHRTRLAVIYLRGRRLGAAPAATAARIPAGAGA |
Ga0187780_107720702 | 3300017973 | Tropical Peatland | MMALADVLTRLVVIYLRGHRLAAGPAGTAARIPAGVRG |
Ga0187780_112938561 | 3300017973 | Tropical Peatland | AVQRGAPDHRLAAWVAALVMMALADVLARLAVIYLRGRRPAASHAPAASAIPAGFRA |
Ga0187777_112940951 | 3300017974 | Tropical Peatland | LIMMALADVLTRLVIIYLRGRRLAGPAASAVRTPAGLGA |
Ga0187872_101120951 | 3300018017 | Peatland | MMALADVLTRLVVIYLRGRRLAAAPAATAAGIPAGVRA |
Ga0187769_103508371 | 3300018086 | Tropical Peatland | DVLTRLAVIYLRGRRLAAAPAAPATAVRIPAGARA |
Ga0187774_108692802 | 3300018089 | Tropical Peatland | MMALADVLTRLVIIYLRGRRLAGPAAATLRTPAGI |
Ga0210407_101623373 | 3300020579 | Soil | MALADVLTRLVVIYLRGRRLAAGPAAPAAAVPAGARA |
Ga0210403_107506532 | 3300020580 | Soil | ALVLMALADVLTRLVVIYLRGRRLAAGPAAPAAAVPAGARA |
Ga0210406_110972441 | 3300021168 | Soil | LMALADVLTRLVVIYLRGRRLAAGPAAPAAAVPAGARA |
Ga0210408_100345893 | 3300021178 | Soil | VLMALADVLTRLVVIYLRGRRLAAGPAAPAAAVPAGARA |
Ga0210408_100542243 | 3300021178 | Soil | MMALADVLTRLAMVYLRGRRLAARPAAAPALIPSVRA |
Ga0213874_102990332 | 3300021377 | Plant Roots | VMMALADVLTRLVVIYLRGRRLAAGPAASTAAVPADARA |
Ga0210397_1000552111 | 3300021403 | Soil | GSAAWVAALIMMALADVLTRLVIIYLRGRRLAGPAAAAVRTPAGIRA |
Ga0182009_108546062 | 3300021445 | Soil | TGSAAWVAALIMMALADVLTRLVIIYLRGRRAASPAASVVRSPVGINA |
Ga0210410_109283102 | 3300021479 | Soil | ASWVAALVLMALADVLTRLVVIYLRGRRLAAGPAAPAAAVPAGARA |
Ga0210410_109982021 | 3300021479 | Soil | AAWVAALVMMALADALTRLVVVYLRGRRLAAGPAAARLPVPTGARA |
Ga0213851_10287221 | 3300021860 | Watersheds | WVAALIMMALADVLTRLVVIYLRGHRLAVGPAPANARIPAGIGA |
Ga0207685_105262241 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | ALIMMALADVLTRLVIIYLRGRRLAGPAATAVRTPAGIRA |
Ga0207663_116368201 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VAALVMMALADVLTRLVIIYLRGRRLARPAATAARTPAGIRA |
Ga0207661_118254562 | 3300025944 | Corn Rhizosphere | LADVLTRLTVLFVRSRRLAAAPAAAVIPARTTSHA |
Ga0209471_11301712 | 3300026318 | Soil | SAAWVAALIMMALADVLTRLVIIYLRGRRLAGPAATAVRTPAGIHA |
Ga0209648_101673682 | 3300026551 | Grasslands Soil | MCNVAWMAALVMMALADVLTRLVVVYLRDRRLAAGPAAAPAPILAGTRA |
Ga0209689_13010063 | 3300027748 | Soil | VAALVMMALADVLTRLVVIYLRGRRLAAGSAATGTRIPAGFGA |
Ga0209060_104588942 | 3300027826 | Surface Soil | VAALVMMALADVLTRLIVIYLRGRRLAAAAPPTAARIPAGIRG |
Ga0209275_106045312 | 3300027884 | Soil | MMALADVLTRLVVIYLRGRRLAAAPAAAAAGVPAGVRG |
Ga0307282_103506302 | 3300028784 | Soil | ALVMMALADVLTRLVVIYLRGHRLAAAPAGTAARIPAGVRG |
Ga0310037_102933102 | 3300030494 | Peatlands Soil | ALVMMALADVLTRLAVVWLRGRRLAAGPAAAPALIPAGTHA |
Ga0318574_101712101 | 3300031680 | Soil | AALVMMALADVLSRLVVIHLRGRRLAAAVTTARAAIPAGLSA |
Ga0307474_108920201 | 3300031718 | Hardwood Forest Soil | WVAALIMMALADVLTRLVIIYLRGRRLAGPAATAVRTPAGIRA |
Ga0306917_105034751 | 3300031719 | Soil | VAALVMMALADVLTRLVVIYLRGHRLAAGPAAAAARIPAGVRA |
Ga0307469_118186452 | 3300031720 | Hardwood Forest Soil | HITGSAAWVAALIMMALADVLTRLVIIYLRGRRLAGPAATAVRTPAGIRA |
Ga0318494_106704151 | 3300031751 | Soil | ITGSAAWVAALIMMALADVLTRLAVIYLRGHRLAPGAAAARAPIPAGTGA |
Ga0318521_104363721 | 3300031770 | Soil | ALVMMALADVLTRLVVIYLRGHRLAAGPAAAAARIPAGVRA |
Ga0318498_104513181 | 3300031778 | Soil | AAWVAALVMMALADVLTRLVIIYLRGRRLAGGRAAVRAAIPVGISA |
Ga0318550_104835822 | 3300031797 | Soil | SAAWVAALVMMALADVLTRLVIIYLRGRRLAGGRAAVRAAIPVGISA |
Ga0318523_105159612 | 3300031798 | Soil | HITGSAGWVAALVMMALADVLTRLVVIYLRGHRLATGQAAAARISAGVRA |
Ga0318497_103843931 | 3300031805 | Soil | ALADVLTRLVVIYLRGRRLAAGPAVPAAAVPAGARA |
Ga0318568_102589432 | 3300031819 | Soil | TAWVAALVMMALADVLTRLAVIYLRGRRVAAGRSANTAAVPAVINA |
Ga0307473_107519841 | 3300031820 | Hardwood Forest Soil | HHITGSAAWVAALIMMALADVLTRLVIIYLRGRRLAGPAATAVRTPAGIHA |
Ga0318567_103649411 | 3300031821 | Soil | LVMMALADVLTRLVVIYLRGHRLAAGPAAAAARIPAGVRA |
Ga0318517_100787982 | 3300031835 | Soil | VMMALADVLSRLVVIHLRGRRLAAAVTTARAAIPAGLSA |
Ga0318511_105852122 | 3300031845 | Soil | LMALADVLTRLVVIYLRGRRLAAGPAVPAAAVPAGARA |
Ga0318512_104448502 | 3300031846 | Soil | ALADVLTRLAVIYLRGRRLAAGPAAPAAAVPAGARA |
Ga0318495_105377341 | 3300031860 | Soil | GSTAWVAALVMMALADVLTRLAVIYLRGRRVAAGRSANTAAVTAVINA |
Ga0318551_102306472 | 3300031896 | Soil | VMMALADVLTRLVVIYLRGHRLATGQAAAARISAGVRA |
Ga0318520_103181012 | 3300031897 | Soil | VMMALADVPTRLVVIYLRGRRLAAGSAASTAAVPAGARA |
Ga0310913_105180193 | 3300031945 | Soil | VMMALADVLTRLVIIYLRGRRLASPPASAVRTPAGIGA |
Ga0306922_103104031 | 3300032001 | Soil | LVMMALADVLTRLAVIYLRGRRLAAGPAATAARIPAGAGA |
Ga0306922_103663351 | 3300032001 | Soil | AWVAALVMMALADVLTRLAVIWLRGRRLAAAPAAPARIPAAARA |
Ga0318513_100044811 | 3300032065 | Soil | LADVLARLVIIYLRGRRLAGGRAAVRAAIPVGISA |
Ga0318513_104431501 | 3300032065 | Soil | AWVAALVLMALADVLTRLVVIYLRGRRLAAGPAVPAAAVPAGARA |
Ga0318524_102032241 | 3300032067 | Soil | AWIAALVMMALADVLTRLVVIYLRGRRLAAGPAAPAAAVPADTRA |
Ga0318525_101625721 | 3300032089 | Soil | MMALADVLTRLVVIYLRGRRLAAAPAAAARIPAAARA |
Ga0318525_102472591 | 3300032089 | Soil | MALADVLTRLVVIYLRGRRLTAAPAAIAARIPAGAGA |
Ga0318577_102254881 | 3300032091 | Soil | MALADVLTRLAVIYLRGRRLAAAPAAPARIPAAARA |
Ga0311301_119749812 | 3300032160 | Peatlands Soil | MMALADVLNRLVVVYLRGRRLAAGATATSALVPAGTRA |
Ga0311301_122753401 | 3300032160 | Peatlands Soil | VAALVMMALADVLTRLVVVYSRGRRLAAGPAPAPARIPAGSRG |
Ga0307470_101975042 | 3300032174 | Hardwood Forest Soil | HHVTGSAAWVAALIMMALADVLTRLVIIYLRGRRLAGPAAAAVRTPAGIRA |
Ga0335079_104675053 | 3300032783 | Soil | MMALADVLTRLVVIYLRGRRLAADSAATTAAVPAGARA |
Ga0335077_110091952 | 3300033158 | Soil | ATWVAALVLMALADVLTRLVVIYLRDRRLAAAPAAPAAVVPAGAHA |
Ga0373948_0114965_539_646 | 3300034817 | Rhizosphere Soil | ALADVLTRLVIIYLRGRRLANPAASVVRTPAGINA |
⦗Top⦘ |