NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F097963

Metagenome / Metatranscriptome Family F097963

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F097963
Family Type Metagenome / Metatranscriptome
Number of Sequences 104
Average Sequence Length 44 residues
Representative Sequence MVLSFVATNIQLGLLLHAGVVMTALKLSAALSTCDRAMKAACSA
Number of Associated Samples 89
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 91.35 %
% of genes near scaffold ends (potentially truncated) 84.62 %
% of genes from short scaffolds (< 2000 bps) 76.92 %
Associated GOLD sequencing projects 86
AlphaFold2 3D model prediction Yes
3D model pTM-score0.52

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.192 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(25.000 % of family members)
Environment Ontology (ENVO) Unclassified
(31.731 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(66.346 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: Yes Secondary Structure distribution: α-helix: 58.33%    β-sheet: 0.00%    Coil/Unstructured: 41.67%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.52
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF02525Flavodoxin_2 5.77
PF07366SnoaL 4.81
PF00578AhpC-TSA 3.85
PF00106adh_short 2.88
PF03625DUF302 1.92
PF00873ACR_tran 1.92
PF13426PAS_9 1.92
PF03284PHZA_PHZB 1.92
PF01522Polysacc_deac_1 1.92
PF08837DUF1810 1.92
PF00486Trans_reg_C 1.92
PF02954HTH_8 1.92
PF01553Acyltransferase 1.92
PF02518HATPase_c 1.92
PF08447PAS_3 1.92
PF00072Response_reg 0.96
PF09678Caa3_CtaG 0.96
PF13561adh_short_C2 0.96
PF03479PCC 0.96
PF05368NmrA 0.96
PF10415FumaraseC_C 0.96
PF03551PadR 0.96
PF08281Sigma70_r4_2 0.96
PF12695Abhydrolase_5 0.96
PF01042Ribonuc_L-PSP 0.96
PF00903Glyoxalase 0.96
PF01243Putative_PNPOx 0.96
PF07992Pyr_redox_2 0.96
PF08818DUF1801 0.96
PF09407AbiEi_1 0.96
PF05167DUF711 0.96
PF02656DUF202 0.96
PF13416SBP_bac_8 0.96
PF01053Cys_Met_Meta_PP 0.96
PF00210Ferritin 0.96
PF02687FtsX 0.96
PF12697Abhydrolase_6 0.96
PF00009GTP_EFTU 0.96
PF00723Glyco_hydro_15 0.96
PF10518TAT_signal 0.96
PF07732Cu-oxidase_3 0.96
PF04295GD_AH_C 0.96
PF00561Abhydrolase_1 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG0726Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 familyCell wall/membrane/envelope biogenesis [M] 1.92
COG3439Uncharacterized conserved protein, DUF302 familyFunction unknown [S] 1.92
COG5579Uncharacterized conserved protein, DUF1810 familyFunction unknown [S] 1.92
COG0075Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucGAmino acid transport and metabolism [E] 0.96
COG01567-keto-8-aminopelargonate synthetase or related enzymeCoenzyme transport and metabolism [H] 0.96
COG0251Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 familyDefense mechanisms [V] 0.96
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 0.96
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 0.96
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 0.96
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 0.96
COG1661Predicted DNA-binding protein with PD1-like DNA-binding motif, PPC/DUF296 domainGeneral function prediction only [R] 0.96
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.96
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.96
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.96
COG1921Seryl-tRNA(Sec) selenium transferaseTranslation, ribosomal structure and biogenesis [J] 0.96
COG1982Arginine/lysine/ornithine decarboxylaseAmino acid transport and metabolism [E] 0.96
COG2008Threonine aldolaseAmino acid transport and metabolism [E] 0.96
COG2132Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA)Cell cycle control, cell division, chromosome partitioning [D] 0.96
COG2149Uncharacterized membrane protein YidH, DUF202 familyFunction unknown [S] 0.96
COG2721Altronate dehydrataseCarbohydrate transport and metabolism [G] 0.96
COG2848Uncharacterized conserved protein, UPF0210 familyCell cycle control, cell division, chromosome partitioning [D] 0.96
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 0.96
COG3387Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 familyCarbohydrate transport and metabolism [G] 0.96
COG4100Cystathionine beta-lyase family protein involved in aluminum resistanceInorganic ion transport and metabolism [P] 0.96
COG4430Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 familyFunction unknown [S] 0.96
COG5646Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis)Posttranslational modification, protein turnover, chaperones [O] 0.96
COG5649Uncharacterized conserved protein, DUF1801 domainFunction unknown [S] 0.96

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.19 %
UnclassifiedrootN/A4.81 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000559|F14TC_100154315All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300001083|JGI12678J13193_1001727All Organisms → cellular organisms → Bacteria1114Open in IMG/M
3300001159|JGI12650J13346_1008624All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300001174|JGI12679J13547_1001339All Organisms → cellular organisms → Bacteria1295Open in IMG/M
3300001593|JGI12635J15846_10029014All Organisms → cellular organisms → Bacteria4445Open in IMG/M
3300001593|JGI12635J15846_10377087All Organisms → cellular organisms → Bacteria862Open in IMG/M
3300004092|Ga0062389_102594582All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514674Open in IMG/M
3300004092|Ga0062389_102737799All Organisms → cellular organisms → Bacteria658Open in IMG/M
3300004092|Ga0062389_103403108All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300005167|Ga0066672_10050592All Organisms → cellular organisms → Bacteria2379Open in IMG/M
3300005176|Ga0066679_10482790All Organisms → cellular organisms → Bacteria809Open in IMG/M
3300005176|Ga0066679_11003895All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300005177|Ga0066690_10002606All Organisms → cellular organisms → Bacteria7479Open in IMG/M
3300005181|Ga0066678_10449223All Organisms → cellular organisms → Bacteria857Open in IMG/M
3300005294|Ga0065705_10169777All Organisms → cellular organisms → Bacteria1690Open in IMG/M
3300005450|Ga0066682_10907985All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514524Open in IMG/M
3300005544|Ga0070686_100768162All Organisms → cellular organisms → Bacteria774Open in IMG/M
3300005554|Ga0066661_10957343All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300005555|Ga0066692_10178289All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1319Open in IMG/M
3300005557|Ga0066704_10030020All Organisms → cellular organisms → Bacteria3306Open in IMG/M
3300005568|Ga0066703_10319097All Organisms → cellular organisms → Bacteria938Open in IMG/M
3300005569|Ga0066705_10038426All Organisms → cellular organisms → Bacteria2626Open in IMG/M
3300005598|Ga0066706_10930978All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300005712|Ga0070764_10265974All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514980Open in IMG/M
3300005764|Ga0066903_100192548All Organisms → cellular organisms → Bacteria3032Open in IMG/M
3300005921|Ga0070766_11043172Not Available563Open in IMG/M
3300005993|Ga0080027_10123424All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514982Open in IMG/M
3300006172|Ga0075018_10649295All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300006173|Ga0070716_100498625All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium898Open in IMG/M
3300006791|Ga0066653_10012687All Organisms → cellular organisms → Bacteria2975Open in IMG/M
3300006797|Ga0066659_10132525All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1746Open in IMG/M
3300006797|Ga0066659_10171223All Organisms → cellular organisms → Bacteria1563Open in IMG/M
3300006797|Ga0066659_11145399All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium650Open in IMG/M
3300006797|Ga0066659_11236190All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300006800|Ga0066660_11440373All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300006800|Ga0066660_11625583All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300007258|Ga0099793_10125634All Organisms → cellular organisms → Bacteria1203Open in IMG/M
3300009089|Ga0099828_10248170All Organisms → cellular organisms → Bacteria1596Open in IMG/M
3300009137|Ga0066709_101746313All Organisms → cellular organisms → Bacteria878Open in IMG/M
3300009610|Ga0105340_1261359All Organisms → cellular organisms → Bacteria → Acidobacteria745Open in IMG/M
3300012199|Ga0137383_10004102All Organisms → cellular organisms → Bacteria9228Open in IMG/M
3300012207|Ga0137381_10000209All Organisms → cellular organisms → Bacteria35875Open in IMG/M
3300012357|Ga0137384_10000308All Organisms → cellular organisms → Bacteria36078Open in IMG/M
3300012685|Ga0137397_10489546Not Available916Open in IMG/M
3300015053|Ga0137405_1335615All Organisms → cellular organisms → Bacteria4370Open in IMG/M
3300017659|Ga0134083_10295704All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300017998|Ga0187870_1187499Not Available734Open in IMG/M
3300018027|Ga0184605_10349668All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium667Open in IMG/M
3300018051|Ga0184620_10093900All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium916Open in IMG/M
3300018066|Ga0184617_1181899All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300018433|Ga0066667_10525727All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium978Open in IMG/M
3300018482|Ga0066669_11113638All Organisms → cellular organisms → Bacteria712Open in IMG/M
3300019879|Ga0193723_1047755All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin5141262Open in IMG/M
3300019879|Ga0193723_1073199Not Available987Open in IMG/M
3300019890|Ga0193728_1072356All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1636Open in IMG/M
3300019890|Ga0193728_1130495All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. dw_531128Open in IMG/M
3300020004|Ga0193755_1106057All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium886Open in IMG/M
3300020170|Ga0179594_10248130All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300020199|Ga0179592_10401160All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300020579|Ga0210407_10162702All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1724Open in IMG/M
3300020579|Ga0210407_10626363All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514837Open in IMG/M
3300021168|Ga0210406_10067313All Organisms → cellular organisms → Bacteria3088Open in IMG/M
3300021168|Ga0210406_11119635All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300021344|Ga0193719_10024854All Organisms → cellular organisms → Bacteria2568Open in IMG/M
3300021479|Ga0210410_10102891All Organisms → cellular organisms → Bacteria2522Open in IMG/M
3300021479|Ga0210410_11700390All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300023250|Ga0224544_1000864All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae4193Open in IMG/M
3300024227|Ga0228598_1043455All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514888Open in IMG/M
3300025453|Ga0208455_1076658All Organisms → cellular organisms → Bacteria666Open in IMG/M
3300025460|Ga0208562_1075224All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514689Open in IMG/M
3300025915|Ga0207693_10156625All Organisms → cellular organisms → Bacteria → Proteobacteria1792Open in IMG/M
3300025922|Ga0207646_10886390All Organisms → cellular organisms → Bacteria → Proteobacteria792Open in IMG/M
3300026023|Ga0207677_10215390All Organisms → cellular organisms → Bacteria → Acidobacteria1537Open in IMG/M
3300026300|Ga0209027_1071013All Organisms → cellular organisms → Bacteria1291Open in IMG/M
3300026300|Ga0209027_1234955All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300026331|Ga0209267_1002461All Organisms → cellular organisms → Bacteria11929Open in IMG/M
3300026332|Ga0209803_1004323All Organisms → cellular organisms → Bacteria8328Open in IMG/M
3300026538|Ga0209056_10060916All Organisms → cellular organisms → Bacteria3302Open in IMG/M
3300026547|Ga0209156_10029627All Organisms → cellular organisms → Bacteria3125Open in IMG/M
3300026548|Ga0209161_10105608All Organisms → cellular organisms → Bacteria → Proteobacteria1690Open in IMG/M
3300026551|Ga0209648_10483110All Organisms → cellular organisms → Bacteria → Proteobacteria735Open in IMG/M
3300026552|Ga0209577_10596246All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300026702|Ga0208708_101625All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300027439|Ga0209332_1001729All Organisms → cellular organisms → Bacteria4746Open in IMG/M
3300027537|Ga0209419_1037559All Organisms → cellular organisms → Bacteria925Open in IMG/M
3300027559|Ga0209222_1044987All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter modestus851Open in IMG/M
3300027575|Ga0209525_1076813All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium801Open in IMG/M
3300027591|Ga0209733_1089796All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300027648|Ga0209420_1121551All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300027678|Ga0209011_1137157All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300027748|Ga0209689_1022186All Organisms → cellular organisms → Bacteria3911Open in IMG/M
3300028047|Ga0209526_10023794All Organisms → cellular organisms → Bacteria4290Open in IMG/M
3300028047|Ga0209526_10556716All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300028784|Ga0307282_10373144All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium690Open in IMG/M
3300028882|Ga0302154_10306763All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium779Open in IMG/M
3300029951|Ga0311371_10261338All Organisms → cellular organisms → Bacteria → Acidobacteria2486Open in IMG/M
3300030057|Ga0302176_10334889Not Available609Open in IMG/M
3300030617|Ga0311356_10789531All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514902Open in IMG/M
3300030998|Ga0073996_12393598All Organisms → cellular organisms → Bacteria910Open in IMG/M
3300031028|Ga0302180_10083945All Organisms → cellular organisms → Bacteria1848Open in IMG/M
3300031469|Ga0170819_11049608All Organisms → cellular organisms → Bacteria873Open in IMG/M
3300031912|Ga0306921_11542374All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium724Open in IMG/M
3300032001|Ga0306922_11158573All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium capsulatum789Open in IMG/M
3300032180|Ga0307471_100187922All Organisms → cellular organisms → Bacteria2048Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil25.00%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil13.46%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.73%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil5.77%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa3.85%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.88%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.88%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.88%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.92%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.92%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.92%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.96%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.96%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.96%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.96%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.96%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.96%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.96%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.96%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.96%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.96%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.96%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300001083Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1EnvironmentalOpen in IMG/M
3300001159Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2EnvironmentalOpen in IMG/M
3300001174Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005993Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300015053Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300017998Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150EnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018066Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300023250Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14EnvironmentalOpen in IMG/M
3300024227Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4Host-AssociatedOpen in IMG/M
3300025453Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025460Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026300Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026331Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes)EnvironmentalOpen in IMG/M
3300026332Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300026702Grasslands soil microbial communities from Kansas, USA, that are Nitrogen fertilized - NN593 (SPAdes)EnvironmentalOpen in IMG/M
3300027439Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027537Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027559Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027575Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027591Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027648Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027678Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027748Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028882Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3EnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030057Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030998Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-3A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031028Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F14TC_10015431513300000559SoilMVLSAAATNIQLGLLLHAAVVMTALKLSAKFNTCERAMKAACSADRSAAKYS
JGI12678J13193_100172713300001083Forest SoilMVLSAPATSAQLGLLLHAAVVMTALKLSAKFSTCDRAMKAACS
JGI12650J13346_100862423300001159Forest SoilMVLSFVATNIQLGLLFHAAVVMTALKLSAKLSTCDRAMKAA
JGI12679J13547_100133933300001174Forest SoilMVLSAPATSAQLGLLLHAAVVMTALKLSAKFSTCDRAMKAACSADR
JGI12635J15846_1002901423300001593Forest SoilMALSFAATNIQLGLLLHAGLVMAALKLSTKLSTCDRAMKPACSADRSAAKYS*
JGI12635J15846_1037708713300001593Forest SoilMVLSAPATSAQLGLLLHAAVVMTALKLSAKFSTCDR
Ga0062389_10259458213300004092Bog Forest SoilMVLSLPATNIQLGLLLHAGTVMTALKFSALFNTCDHAMKAA
Ga0062389_10273779913300004092Bog Forest SoilMVRSLPATNIQLGLLLHAAVVMTALKLSPKLKTCERAMKA
Ga0062389_10340310813300004092Bog Forest SoilLIVLSFPATSIQLGLPLQAGVVMTAWKLESLIHTCERAMKAACS
Ga0066672_1005059253300005167SoilMVLSFVATSIQLGLLLHAAVVMTALKLSARLSTCDRAMKAACSAERSA
Ga0066679_1048279023300005176SoilMALSFAGTSIQLGLLLHAAVLITALKFSATLSTCDRAMKAA
Ga0066679_1100389513300005176SoilMVLSFAATNIQLGLLLHAGVVMTALKLSAALSTCDRAMKAAC
Ga0066690_1000260653300005177SoilMVLSLSANIQLGLLLHAGVVMTALKLSAKLDTCDRAMKAACSADKSAAKYS*
Ga0066678_1044922323300005181SoilMVLSFVATNIQLGLFLQAGVVMIALKFSAAFSTCDRAIRAACS
Ga0065705_1016977723300005294Switchgrass RhizosphereMVLSFPATNIQLGLLLHAAVVITALKFSAALNTCDRAMKAACSADRSAAKYS*
Ga0066682_1090798523300005450SoilGLMVLSLSANIQLGLLLHAGVVMTALKLSAKLDTCDRAMKAACSADKSAAKYS*
Ga0070686_10076816223300005544Switchgrass RhizosphereMVRSAAATYIQLGLLLHAAVVMTALKLSAKFNLCERAIKAACSADRSA
Ga0066661_1095734313300005554SoilMVLSFVATNIQLGLLLHAGVVMTALKLSAKLSTCDRAMKA
Ga0066692_1017828913300005555SoilMVLSFVATNIQLGLLLHAGVVMTALKLSAALSTCDRAMKAACSA
Ga0066704_1003002023300005557SoilMVLSFVATNIQLGLLLHAAVVMTALKLSAKLSTCDRAMKAACSADRSAAKY
Ga0066703_1031909723300005568SoilMVLSFAATNIQLGLLRHAGVVMTALKLSAKLSTCDRAMKAACS
Ga0066705_1003842653300005569SoilMVLSFVATNIQLGLLLHAAVVMTALKLSAKLSTCDRAMK
Ga0066706_1093097823300005598SoilTNIQLGLLLHAGVVMTALKLSAKLSTCDRAMKAASTLYALHVL*
Ga0070764_1026597423300005712SoilMVLSLPATNIQLGLLLHAGVLMTALKLSAALSTCDRAMKA
Ga0066903_10019254823300005764Tropical Forest SoilMVLSFVATNIQLGVLLHAAVVMTALKLSAKLSTCDRAMKAACSAERSAAKYS*
Ga0070766_1104317213300005921SoilMVLSAPAINIQLGLIRHEAVVMTALKLSAALSTCVRAMKAACSADKS
Ga0080027_1012342423300005993Prmafrost SoilMVLSFAATNIQLGLLLHAGVVMTALKLSAALSTCDRAMKAA
Ga0075018_1064929523300006172WatershedsMVLSFVATNIQLGLVLHAAVVMTALKLSAALSTCDRAMKAAC
Ga0070716_10049862523300006173Corn, Switchgrass And Miscanthus RhizosphereATNIQLGLLLHAGVVMTALKLSAALSTCDRAMKAACSADRSAAKYS*
Ga0066653_1001268733300006791SoilMVLSFTATNIQLGLLLHAGVVITALKLSAALSTCDRATKAACSADKSAAKYS*
Ga0066659_1013252513300006797SoilMVLSFVATNIQLGLLLHAAVVMTALKLSAKFSTADRAMKASCSA
Ga0066659_1017122323300006797SoilMVLSFAATNIQLGLLLHAAALMTALKLSAALSTCDRAMEAACSADRSFAKYA*
Ga0066659_1114539923300006797SoilMVLSFVATNIQLGLLLHAAVVMTALKLSAALSTCD
Ga0066659_1123619023300006797SoilMVLSVAATSIQLGLFLHAAVVMTALKFSAALSTCDRAMNVACSADRSAA
Ga0066660_1144037323300006800SoilMVLSFTATNIQLGLLLHAGVVITALKLSAALSTCDRA
Ga0066660_1162558323300006800SoilMALSFVATNIQLGLVLHAGAVMAALKLSAKLSTCDRAMKEACSADR
Ga0099793_1012563433300007258Vadose Zone SoilATNIQLGLLLHAAVVMTALKLSAALNTCERDMNAACSADRLAAKYS*
Ga0099828_1024817013300009089Vadose Zone SoilMVLSAPATSIQLGLLLHAAAVMTALKLSAKLGTCDRAMKA
Ga0066709_10174631313300009137Grasslands SoilMVLSAAATNIQLGLLLHAGVVMTALKLSAALSTCDRAMKAA
Ga0105340_126135923300009610SoilMILSFVATAIQLGFVLHAAFAITAVKLSAKFRTCDLAMKEACSNDKSAAKYSWNCAGSR*
Ga0137383_1000410273300012199Vadose Zone SoilMVLSFPATNIQLGLLLHAGVVMTALKLSAKLSTCDHAMKAACSAERSAAKYS*
Ga0137381_1000020923300012207Vadose Zone SoilMVLSFPATNIQLGLLLHAGVVMTALKLSAKLSTCDHAMKTACSAERSAAKYS*
Ga0137384_10000308433300012357Vadose Zone SoilNIQLGLLLHAGVVMTALKLSAKLSTCDHAMKAACSAERSAAKYS*
Ga0137397_1048954623300012685Vadose Zone SoilMVLSFAATNIQLDLLLHAGVVMTALKLVAAMSTCELAMKAACSA*
Ga0137405_133561553300015053Vadose Zone SoilMVLSFVATNIQLGLLLHAGVVITALKFSAALSTCDRAMKAACSAGRSAAKYS*
Ga0134083_1029570413300017659Grasslands SoilMVLSFVATNIQLGLHLHAGVVMTALKLSAALSTCDRAMKAACSADRSA
Ga0187870_118749913300017998PeatlandMVLSFVATNIQLGLLLQAGVVMTALKLATAFSTCDRAMKAACTEGRKTR
Ga0184605_1034966823300018027Groundwater SedimentMVLSFVGTNIQLGLLLHAGVVMTALKLSAALSTCDRAMKAACSADRSAAK
Ga0184620_1009390013300018051Groundwater SedimentMVLSFVATNIQLGLLLHAGVVMTALKLSAALSTCDRAMNAACSADKS
Ga0184617_118189923300018066Groundwater SedimentMVLSFVATNIQLGLLRHAGVVMTALKLSAALRTCDRAMKA
Ga0066667_1052572713300018433Grasslands SoilMVLSFVATNIQLGLLLHAGVVMTALKLSAALSTCDRAM
Ga0066669_1111363813300018482Grasslands SoilMVLSFVATNIQLGLVRHAGVVMTALKLSTKLSTFDRAMNPALSADRSATK
Ga0193723_104775523300019879SoilMVRSFVATNIQLGLLLHAAVVMTALKLSAKFNTCDRAM
Ga0193723_107319933300019879SoilMVLSFVATNIQLGLLLHAGVVMTPLKFAARIGTCECAAKAACLTGMSAA
Ga0193728_107235613300019890SoilMVLSFAATNTQLGLLLHAGVVMTALKLSAALSTCDRA
Ga0193728_113049513300019890SoilMVLSFAATNTQLGLLRHADMVMTALKLSAALSTCDRAMKAACSADKS
Ga0193755_110605713300020004SoilMVLSFVATNIQLGLLLHAGVVMTALKLSAALSTCDRA
Ga0179594_1024813013300020170Vadose Zone SoilMVLSFVATNIQLGLLLHAAVVMTALKLSARLSTWD
Ga0179592_1040116013300020199Vadose Zone SoilMVLSAPATNAQLGLVLHAAVVITALKLSAKLGTCARAMKAANFADNFK
Ga0210407_1016270213300020579SoilMVLSFAATNIQRGLLRHAGVAMIALRLSAALGTSLP
Ga0210407_1062636313300020579SoilIQLGLLLHAGVVITALKLSAALGTCDRAMKEACSADKSAAKHS
Ga0210406_1006731353300021168SoilMALSFVDTTIQLGLLLHAAAVMTALKLSAKFNTCDR
Ga0210406_1111963513300021168SoilMVLSAPATSTQVGLLLHAATVITALKLPAALKTCDRAMKAA
Ga0193719_1002485443300021344SoilMVLSFVATNIQLGLLLHAGVVMTALKLSAKLNTCDRAMK
Ga0210410_1010289133300021479SoilMVLSFAATNIQLGLLLHAGVVMTALKLSAALGTCDRAMKAACSTDRSAAK
Ga0210410_1170039023300021479SoilMVLSAPATNIQLGLLLHAAVVMTALKLSAKLSTCERAMKAACSTDIVGRLR
Ga0224544_100086463300023250SoilMVLSLPATNIQLGLLLHAAVVMTALKLSAKLSTCDRAIKAAC
Ga0228598_104345533300024227RhizosphereQLGLLLHAAVVMTALKLSAKLSTCDRAMKAACSADKSAAKYS
Ga0208455_107665813300025453PeatlandMVLSFVATNIQLGLLLQAGVVMTALKLATAFSTCDRAMKAACTEG
Ga0208562_107522433300025460PeatlandMVLSLPATNIQLGLLLHAGVVMTPLKFSALFITCD
Ga0207693_1015662513300025915Corn, Switchgrass And Miscanthus RhizosphereMVLSFVATNIQLGLLLHAAVVMTALKLSARLSTCDRA
Ga0207646_1088639013300025922Corn, Switchgrass And Miscanthus RhizosphereMVLSFAATNIQLGLLLHAGVVITALKLSAALSTCDRAMKAACSTGKSAAQY
Ga0207677_1021539013300026023Miscanthus RhizosphereMVLSFAATNIQLGLLRHAAVVMAALKLSAPLSTCD
Ga0209027_107101313300026300Grasslands SoilMVLSFVATSIQLGLLLHAAVVMTALKLSARLSTCDRAMKAA
Ga0209027_123495523300026300Grasslands SoilMVLSFVATNIQLGLLLHAAVVITALKLSAKLSTCDRAMN
Ga0209267_100246153300026331SoilMVLSLSANIQLGLLLHAGVVMTALKLSAKLDTCDRAMKAACSADKSAAKYS
Ga0209803_1004323113300026332SoilMVLSLSANIQLGLLLHAGVVMTALKLSAKLDTCDRAMKAACSADKS
Ga0209056_1006091633300026538SoilMVLSFTATNIQLGLLLHAGVVITALKLSAALSTCDRAMKAACSADKSAAKYS
Ga0209156_1002962733300026547SoilMVLSFAATNIQLGLLLHAGVVMTALKLSAALSTCDRAMKAACSADKSAAKYS
Ga0209161_1010560833300026548SoilMVLSFAATNIQLGLLLHAAALMTALKLSAALSTCDRAMEAACSAD
Ga0209648_1048311023300026551Grasslands SoilMVLSFVATNIQLGLLLHAAVVMTALKLSAALSTCDR
Ga0209577_1059624613300026552SoilMVLSAPATSIQLGLPLHAGVVMTALKLSVKLSTCDRAMKAACSADRS
Ga0208708_10162513300026702SoilGLIVLSFVATNIQLVLVLHAAVVMTALKLSARLSTCDRAMKAACAAGRSAAKYS
Ga0209332_100172933300027439Forest SoilMVLSLPATNIQLDLVLHAGVVIAALKLSALFSTCDRAMKAACSADRSAAKYS
Ga0209419_103755923300027537Forest SoilMVLSAPATSAQLGLLLHAAVVMTALKLSAKFSACDRAMKAACSA
Ga0209222_104498713300027559Forest SoilMVLSFAATTIQLGLLRHAGAVMVALKFTAALSTCDRAMK
Ga0209525_107681323300027575Forest SoilVLSDPATNIQLGLLFHAAVVITALKLPAKLNTCERAIKAARSADRSATKYS
Ga0209733_108979613300027591Forest SoilMALSFAATNIQLGLVLHAAVEMVALKLSARLSTCDRAIKAACS
Ga0209420_112155113300027648Forest SoilMVLSLPATNIQLGLLLHAAVVMTALKLSALFSTWDRAMKAA
Ga0209011_113715713300027678Forest SoilMVLSAPATNAQLGLVLHAAVVITALKLSAKLGTCDRAMKA
Ga0209689_102218613300027748SoilMVLSFVATNIQLGLLLHAGAVMTALKLSARLSTCDRAMKAA
Ga0209526_1002379413300028047Forest SoilMVLSFAATNTQLGLLRHAAVVMTALKLSARLSTCERAMKAACSADRS
Ga0209526_1055671613300028047Forest SoilMVLSAAATNIQLGLPRHAAVVMTALKLSAKLGTCDRAIKAAC
Ga0307282_1037314423300028784SoilMVLSFAATNIQLGLLLHAAVVMTALKLSAALSTCDRAVK
Ga0302154_1030676313300028882BogMALSLPAISAQLGLLLHAAVVMTALKLLAAFITCDRAMKAAWSA
Ga0311371_1026133813300029951PalsaVVLSLAATNSQLGLLLHAGVMITALKLSAPVSTCDRA
Ga0302176_1033488913300030057PalsaVVLSLAATNSQLGLLLHAGVMITALKLSAPVSTCDPAMKAAALKIGR
Ga0311356_1078953113300030617PalsaMVLSLPATNIQLGLLLHAAVVMTALKLSAKLSTCDRAMNAACSAGR
Ga0073996_1239359813300030998SoilMVLSFVATNIQLGLFLHAGVVMTALKLSAKLSTCDRAMKAACSADRSAAK
Ga0302180_1008394523300031028PalsaMVLSFPATSIQLGLLLHAGAVMTALKLSEAFSTCDRAIKAACS
Ga0170819_1104960823300031469Forest SoilMVLSFVATNIQLGLLLHAGVVMTALKLSAKLNTCDRA
Ga0306921_1154237423300031912SoilMVLSLAATNIQLGLLLHAGLVMTALKLAAALSTCDRAMKAACS
Ga0306922_1115857313300032001SoilMVLSFVATNIQLGLLLHAGLVMTALKLAAALSTCDRAMKAACSAGRS
Ga0307471_10018792233300032180Hardwood Forest SoilMVLSAPATNIQLGLLLHAAAVMTALKLSAKLSTCDRAIKAACSADR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.