NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F098139

Metagenome / Metatranscriptome Family F098139

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F098139
Family Type Metagenome / Metatranscriptome
Number of Sequences 104
Average Sequence Length 40 residues
Representative Sequence MKLALIKFLSAATIVCAADVPITQDELVRRTQELYDA
Number of Associated Samples 90
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 5.77 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 93.27 %
Associated GOLD sequencing projects 89
AlphaFold2 3D model prediction Yes
3D model pTM-score0.33

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.192 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(19.231 % of family members)
Environment Ontology (ENVO) Unclassified
(26.923 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(63.462 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 47.69%    β-sheet: 0.00%    Coil/Unstructured: 52.31%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.33
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF00856SET 7.69
PF07885Ion_trans_2 4.81
PF03466LysR_substrate 3.85
PF00126HTH_1 2.88
PF02754CCG 2.88
PF0563523S_rRNA_IVP 1.92
PF00248Aldo_ket_red 0.96
PF13387DUF4105 0.96
PF01134GIDA 0.96
PF08240ADH_N 0.96
PF12697Abhydrolase_6 0.96
PF00266Aminotran_5 0.96
PF00583Acetyltransf_1 0.96
PF07676PD40 0.96
PF14534DUF4440 0.96
PF01471PG_binding_1 0.96
PF12867DinB_2 0.96
PF09411PagL 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG0247Fe-S cluster-containing oxidoreductase, includes glycolate oxidase subunit GlcFEnergy production and conversion [C] 2.88
COG2048Heterodisulfide reductase, subunit BEnergy production and conversion [C] 2.88

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.19 %
UnclassifiedrootN/A4.81 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459013|GO6OHWN02JC4D7All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_100446332All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia657Open in IMG/M
3300000955|JGI1027J12803_101690002All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium518Open in IMG/M
3300002557|JGI25381J37097_1073229All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium557Open in IMG/M
3300004156|Ga0062589_101592869All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia647Open in IMG/M
3300004157|Ga0062590_102504320All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium547Open in IMG/M
3300005167|Ga0066672_10240132All Organisms → cellular organisms → Bacteria1164Open in IMG/M
3300005174|Ga0066680_10084987All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1914Open in IMG/M
3300005332|Ga0066388_106319140All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium598Open in IMG/M
3300005446|Ga0066686_10287160All Organisms → cellular organisms → Bacteria1116Open in IMG/M
3300005468|Ga0070707_101979865All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae550Open in IMG/M
3300005540|Ga0066697_10691878All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300005552|Ga0066701_10536376All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium720Open in IMG/M
3300005553|Ga0066695_10203694All Organisms → cellular organisms → Bacteria1242Open in IMG/M
3300005556|Ga0066707_10536125All Organisms → cellular organisms → Bacteria757Open in IMG/M
3300005556|Ga0066707_10543095All Organisms → cellular organisms → Bacteria750Open in IMG/M
3300005556|Ga0066707_10704013Not Available633Open in IMG/M
3300005556|Ga0066707_10897254All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium544Open in IMG/M
3300005575|Ga0066702_10085241All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1776Open in IMG/M
3300005598|Ga0066706_10390205All Organisms → cellular organisms → Bacteria1107Open in IMG/M
3300005764|Ga0066903_100535834All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2001Open in IMG/M
3300006028|Ga0070717_10080482All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2733Open in IMG/M
3300006163|Ga0070715_10212044All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium990Open in IMG/M
3300006791|Ga0066653_10265048All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium874Open in IMG/M
3300006844|Ga0075428_100801747All Organisms → cellular organisms → Bacteria1001Open in IMG/M
3300007076|Ga0075435_101281042All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300009093|Ga0105240_12566429All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia527Open in IMG/M
3300009148|Ga0105243_12272205All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300010322|Ga0134084_10213590All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300010326|Ga0134065_10095523All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium980Open in IMG/M
3300010333|Ga0134080_10325468All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300010359|Ga0126376_11380385All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300010359|Ga0126376_11576966All Organisms → cellular organisms → Bacteria688Open in IMG/M
3300010360|Ga0126372_11751774All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300010364|Ga0134066_10224621All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium636Open in IMG/M
3300010366|Ga0126379_10457830All Organisms → cellular organisms → Bacteria1338Open in IMG/M
3300010373|Ga0134128_10601396All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1224Open in IMG/M
3300010376|Ga0126381_100082264All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium4055Open in IMG/M
3300010376|Ga0126381_101120889All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1137Open in IMG/M
3300010376|Ga0126381_101462266All Organisms → cellular organisms → Bacteria988Open in IMG/M
3300010376|Ga0126381_102032277All Organisms → cellular organisms → Bacteria828Open in IMG/M
3300010398|Ga0126383_13078838All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300011444|Ga0137463_1165842All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium831Open in IMG/M
3300012198|Ga0137364_10858509All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300012198|Ga0137364_11179502All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium574Open in IMG/M
3300012199|Ga0137383_10315521All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1145Open in IMG/M
3300012202|Ga0137363_11753253All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium513Open in IMG/M
3300012206|Ga0137380_10226029Not Available1692Open in IMG/M
3300012207|Ga0137381_10180130All Organisms → cellular organisms → Bacteria1828Open in IMG/M
3300012208|Ga0137376_10057386All Organisms → cellular organisms → Bacteria3202Open in IMG/M
3300012208|Ga0137376_11468677All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300012210|Ga0137378_10468499All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1165Open in IMG/M
3300012349|Ga0137387_10918590Not Available632Open in IMG/M
3300012351|Ga0137386_11076253All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium569Open in IMG/M
3300012354|Ga0137366_10283546All Organisms → cellular organisms → Bacteria1222Open in IMG/M
3300012357|Ga0137384_10936992All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium697Open in IMG/M
3300012897|Ga0157285_10160650All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium676Open in IMG/M
3300012911|Ga0157301_10253612All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300012923|Ga0137359_10188028All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1845Open in IMG/M
3300012925|Ga0137419_10919462All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300012927|Ga0137416_11481481All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia616Open in IMG/M
3300012929|Ga0137404_11585045All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300012957|Ga0164303_10152653Not Available1224Open in IMG/M
3300012957|Ga0164303_10615240All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium718Open in IMG/M
3300012960|Ga0164301_10213889All Organisms → cellular organisms → Bacteria1239Open in IMG/M
3300012960|Ga0164301_10521039All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium862Open in IMG/M
3300012971|Ga0126369_12049857All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp.660Open in IMG/M
3300012985|Ga0164308_10342421All Organisms → cellular organisms → Bacteria1203Open in IMG/M
3300012985|Ga0164308_11071157All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300012986|Ga0164304_11434851All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300012989|Ga0164305_10379723All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1075Open in IMG/M
3300014154|Ga0134075_10180236All Organisms → cellular organisms → Bacteria907Open in IMG/M
3300014154|Ga0134075_10332443All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium664Open in IMG/M
3300014166|Ga0134079_10381245All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300015200|Ga0173480_10050827All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1865Open in IMG/M
3300015359|Ga0134085_10034472All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1983Open in IMG/M
3300018072|Ga0184635_10151103All Organisms → cellular organisms → Bacteria927Open in IMG/M
3300018482|Ga0066669_11844546All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300019356|Ga0173481_10313702All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium734Open in IMG/M
3300019361|Ga0173482_10045849Not Available1398Open in IMG/M
3300019880|Ga0193712_1062718All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium812Open in IMG/M
3300019885|Ga0193747_1088436All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium758Open in IMG/M
3300021168|Ga0210406_10465181All Organisms → cellular organisms → Bacteria1005Open in IMG/M
3300022756|Ga0222622_10636597All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium772Open in IMG/M
3300025915|Ga0207693_10655133All Organisms → cellular organisms → Bacteria815Open in IMG/M
3300025933|Ga0207706_10060363All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Verrucomicrobium3339Open in IMG/M
3300025937|Ga0207669_10698321All Organisms → cellular organisms → Bacteria834Open in IMG/M
3300026078|Ga0207702_10032478All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia4356Open in IMG/M
3300026297|Ga0209237_1103855All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1239Open in IMG/M
3300026310|Ga0209239_1102975All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1208Open in IMG/M
3300026329|Ga0209375_1236230All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300026547|Ga0209156_10255242All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium811Open in IMG/M
3300027050|Ga0209325_1021971All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium748Open in IMG/M
3300027635|Ga0209625_1104576All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300027907|Ga0207428_10067780All Organisms → cellular organisms → Bacteria2809Open in IMG/M
3300028715|Ga0307313_10089518All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium930Open in IMG/M
3300028799|Ga0307284_10278352All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300028807|Ga0307305_10391039All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300028876|Ga0307286_10106885All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium986Open in IMG/M
3300028884|Ga0307308_10336434All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium723Open in IMG/M
3300030972|Ga0075400_11728070All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300031057|Ga0170834_103515445All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1097Open in IMG/M
3300031231|Ga0170824_104541943All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300031231|Ga0170824_124458570All Organisms → cellular organisms → Bacteria642Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil19.23%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil16.35%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil16.35%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil9.62%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil7.69%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.85%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.85%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.88%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.92%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.92%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.92%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.96%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.96%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.96%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.96%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.96%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459013Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cmEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300002557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cmEnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011444Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012897Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019880Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a1EnvironmentalOpen in IMG/M
3300019885Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2EnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026297Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026310Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300027050Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027635Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300030972Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB4 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
N57_015749802170459013Grass SoilMKLALIKFLSAATIVCAADIPITQDELVRRTQELY
INPhiseqgaiiFebDRAFT_10044633233300000364SoilMFRVMKLVLVIIFATTLAXAADXPXTXDXLVRXTXXLYXAVA
JGI1027J12803_10169000223300000955SoilMKLAFVASFFAATLACAMDVPITQDELVRRTQELY
JGI25381J37097_107322923300002557Grasslands SoilMKLLALIAFTSAATFACAVNIPLTQEELVRRTQELYDXVAXAN
Ga0062589_10159286913300004156SoilMKQLTLIKFLSAATLVCAADVPITQDELVRRTQELYDALV
Ga0062590_10250432023300004157SoilMKQLALIKFLFVATVVCAADVPITQDELVRRTQELYDSLVSGDQ
Ga0066672_1024013213300005167SoilMFSVMKLALVIIFATTFVHAADVPITQDEFIRRTQELYDAIVPGNQ
Ga0066680_1008498743300005174SoilMFSVMKLALVIIFTTTLAYAGDVPITQDELVHRTQELYDAIVPGNQ
Ga0066388_10631914013300005332Tropical Forest SoilMKQLALIKFLFAATIVCAADVPITQDELVRRTQELYDAVVPG
Ga0066686_1028716023300005446SoilMKLPLVTFFFAVTIACATDVPITQDELVHRTQELYDAIVPGNQA
Ga0070707_10197986523300005468Corn, Switchgrass And Miscanthus RhizosphereMKLAFTTFFLAVTITCAADVPITQDELVRRTQELYDAVVPG
Ga0066697_1069187823300005540SoilMFSVMKLVLVIFATTLAHTADAPIAQDELVRRTQELYDA
Ga0066701_1053637613300005552SoilMKLALVIIFTTTLAYTGDVPITQDELVRRTQELYDAIV
Ga0066695_1020369443300005553SoilMKLALVTFFSAVTLVSAADVPITQNELVRRTQELYDAI
Ga0066707_1053612513300005556SoilMKLALVIIFTTTLAYTGDVPITQDELVRRTQELYDAIVPG
Ga0066707_1054309523300005556SoilMKLALITFLSAVTLACAADVPITQDELVRRTQELY
Ga0066707_1070401313300005556SoilMKVALVTLCFGVTLACAEDVPITQDELVGRTQELY
Ga0066707_1089725423300005556SoilMKLALIKFLSVATIVCAADLPITQDELVRRTQELYDAVVPG
Ga0066702_1008524113300005575SoilMKFALTTFLFAVALARAADVPITQEELVRRTQELYDAIVPGN
Ga0066706_1039020513300005598SoilMFSVMKLVLVIFATTLAHTADAPIAQDELVRRTQELYDAIVPGNQ
Ga0066903_10053583413300005764Tropical Forest SoilMILVKQIAVIKFLSAAIIVCAADVPITQDDLVRRTQELYDAV
Ga0070717_1008048263300006028Corn, Switchgrass And Miscanthus RhizosphereMILMKQLVLIKFLSAATIVCAADVPITQDELVRRTQELYDA
Ga0070715_1021204413300006163Corn, Switchgrass And Miscanthus RhizosphereMKQLVLIKFLSAATIVCAADVPIAQDELVRRTQELYDALVPGN
Ga0066653_1026504813300006791SoilMKLALVTFFSTVTLACAADVPITQDELVRRTQELYDAIV
Ga0075428_10080174733300006844Populus RhizosphereMKLALISFLSAATVVCAADVPITQDELARRTQELY
Ga0075435_10128104213300007076Populus RhizosphereMKQLALIKFLSAATIVYAADVAITQDELVRRTQELYDAV
Ga0105240_1256642923300009093Corn RhizosphereMKQLMLIKFLSAATLVCAADVPITQDELVRRTQELYDALVSGNQ
Ga0105243_1227220523300009148Miscanthus RhizosphereMILMKRLMLIGFLSFATVVCAADVPITQDELIRRTQEL
Ga0134084_1021359023300010322Grasslands SoilMKLALIKFLSAATIVCAADVPITQDELVRRTQELYDAVVP
Ga0134065_1009552313300010326Grasslands SoilMKLLPVIIFATALAHAADAPITQDELVRRTQELYDA
Ga0134080_1032546813300010333Grasslands SoilMKQFALIKFLSAVTIVCAADVPITQDELVRRTQELYDS
Ga0126376_1138038523300010359Tropical Forest SoilMKRLMLIGFLSLATIVCAADAPITQNELIRRTQELYDSLVSGN
Ga0126376_1157696623300010359Tropical Forest SoilMKLALIQFLSAATIVCAADVPITQEELVRRTQELYDAVVPG
Ga0126372_1175177413300010360Tropical Forest SoilMKLQLVIFFSAVTIAYPTDVPITPDELVRRTQELYDAIVP
Ga0134066_1022462113300010364Grasslands SoilMKLALVTFFSAVTLACAADVPITQDELVRRTQELYDALVPGN
Ga0126379_1045783013300010366Tropical Forest SoilMKQLALIKFLCAATVVCAADVPITQDELVRRTQELYYSLVSGN
Ga0134128_1060139633300010373Terrestrial SoilMKQLALIKFLAAATIVCAADVPITQDELVRRTQELYDSLVSGD
Ga0126381_10008226413300010376Tropical Forest SoilMIAMKRFMLIGFLSLATVVCAEEVPISQDELIRRTQELYDS
Ga0126381_10112088913300010376Tropical Forest SoilMKQLALIAFTSVTTFACAANTAITEEELVRRTQELYDAVAS
Ga0126381_10146226613300010376Tropical Forest SoilMKHTLIIFLFAATIVCAADVPITQDELVRRTQELYD
Ga0126381_10203227713300010376Tropical Forest SoilMKRFMLIGFLSLATVVCAEEVPISQDELIRRTQELYDS
Ga0126383_1307883823300010398Tropical Forest SoilMKRLMLSGFLSLATVVCAADVAITQDELVRRTQELY
Ga0137463_116584223300011444SoilMKQLALIKFLSAATIVCAADVPIMQDELVRRTQELYDAV
Ga0137364_1085850923300012198Vadose Zone SoilMKLALVTFFFTATIACAAEVPITQDELVRRTQELYDALVPGNQ
Ga0137364_1117950213300012198Vadose Zone SoilMKLALVIIFTTTLAYAADVPITQDELVRRTQELYDAV
Ga0137383_1031552143300012199Vadose Zone SoilMKQLAFIKFLSAATIVCAADVPIMQDELVRRTQELYDAIVSG
Ga0137363_1175325313300012202Vadose Zone SoilMKQLAFINFLSAATIVCAADAPIAQDDLVRRTQELYDAV
Ga0137380_1022602913300012206Vadose Zone SoilMKLLFVIIFATKLTHAAAADLPITQQELVRRTQEL
Ga0137381_1018013013300012207Vadose Zone SoilMKQLALIKFLSAATIVCAADVPITQDELVRRTQELYDAVVP
Ga0137376_1005738613300012208Vadose Zone SoilMKQLALIKFLSAATILCAADVPITQDELVRRTQELYDAV
Ga0137376_1146867713300012208Vadose Zone SoilMKLALIKFLSAATIVCAADVPITQDELVRRTQELYDAVVS
Ga0137378_1046849933300012210Vadose Zone SoilMFSIMKLALVIIFATILVHAADLPITQDELVRRTQELYDAIVPGN
Ga0137387_1091859023300012349Vadose Zone SoilMKLLFVIIFATKLTHAAAADLPITQQELVRRTQELCDAIAPG
Ga0137386_1107625323300012351Vadose Zone SoilMKLVLIKFLSAATIVCAADIPITQDELVRRTQELYDAVVPG
Ga0137366_1028354633300012354Vadose Zone SoilMKQLALINFWSAATIVCAADVPITQDELVRRTQELYDAVV
Ga0137384_1093699213300012357Vadose Zone SoilMKQLAFIKFLSAATIVCAADVPITQDELVRRTQELYDAV
Ga0157285_1016065013300012897SoilMKQLALIKFLSAATIVCAADVPIAHDELVRRTQELYDAVV
Ga0157301_1025361213300012911SoilMKQLALIKFLSAATIVCAADVPIAHDELVRRTQELYDAVVPGNQ
Ga0137359_1018802813300012923Vadose Zone SoilMKLLALIAFTSAATLACAVNIPLTQEELVRRTQELYDAVAFANQA
Ga0137419_1091946213300012925Vadose Zone SoilMKLALIKFLSAATIVCAADVPITQNELVRRTQELYDAVVP
Ga0137416_1148148113300012927Vadose Zone SoilMKLPLVTFFSGVTIACATDVPITQDELVRRTQELYDA
Ga0137404_1158504513300012929Vadose Zone SoilMKLALVTFFSAVTLACAADVPITQDELVRRTQELYD
Ga0164303_1015265313300012957SoilLALIKFLFAATIVSAADVPITQDELLRRTQELYDSLVSGDQAP*
Ga0164303_1061524013300012957SoilMIFMKQLALIKFLSAATIVCAADVPITQDELVRRTQELYDALVPGNQGP
Ga0164301_1021388933300012960SoilMKFALITFLFAVTLACGADVQITPDELIRRTQELYDAIVPG
Ga0164301_1052103913300012960SoilMKLVLLGFLYLTTIACAGDVPITQEELIRRSQELYDSLVSGDQAP
Ga0126369_1204985723300012971Tropical Forest SoilMKQLALITFLSAGTIGCAADVPIVQDELVRRTQELYDA
Ga0164308_1034242113300012985SoilMKQLMLIKFLSAATIVCAADVPITQDELVRRTQELYDALVPGNQ
Ga0164308_1107115733300012985SoilMKLVLIKFLSAATIVCAADVPLTQDELVRRTQELYDALVPGN
Ga0164304_1143485113300012986SoilMKLVLIEFLSAATIVCAADVPITQDELIRRTQELYDSLVSG
Ga0164305_1037972333300012989SoilMKQLVLIKFLSAATIVCAADVPITQDELVRRTQELYDALVPG
Ga0134075_1018023623300014154Grasslands SoilMKLALVTFFYTVTLVFAADVPITQDELVRRTQELYD
Ga0134075_1033244313300014154Grasslands SoilMKLALVTFFSTVTLVYPADVRITQDELVRRTQELYD
Ga0134079_1038124523300014166Grasslands SoilMKLLALIAFTSAATFACAVNIPLTQEELVRRTQELYDAVASANQA
Ga0173480_1005082723300015200SoilMKQLTLIKFLSAATLVCAADVPITQDELVRRTQELYDALVSG
Ga0134085_1003447243300015359Grasslands SoilMKLALVIIFTTTLAYTGDVPITQDELVRRTQELYD
Ga0184635_1015110323300018072Groundwater SedimentMFSVMKLVLVIIFATALVHAADAPITQEELVRRTQEL
Ga0066669_1184454623300018482Grasslands SoilMILMKQLAFIKFLSAATIVCAADIPITQDELVRRTQELYDAVVPG
Ga0173481_1031370223300019356SoilMKQLALIKFLSAATIVCAADVPIAHDELVRRTQEL
Ga0173482_1004584913300019361SoilMKQLALITFLSAATIVCAADVPITHDELRRRTQELYD
Ga0193712_106271813300019880SoilMILMKQLALIKFLSAATIVCAADVPITQEELVRRTQELYDSL
Ga0193747_108843613300019885SoilMILMKQLVLIKFLSAATIVCAADVPITQDELIQRTQELYD
Ga0210406_1046518113300021168SoilMKLVLINFLSAATIVCAADVPLTQDELVRRTQELYDAVVP
Ga0222622_1063659713300022756Groundwater SedimentMKLVLITIFVTIFATTLAYAADAPITQDELVRRTQE
Ga0207693_1065513323300025915Corn, Switchgrass And Miscanthus RhizosphereMKQLALIKFLSAATIVCAAADIPITRDELVRRTQEL
Ga0207706_1006036333300025933Corn RhizosphereMKQLALITFLFAATIVCAADVPITQDELVRRTQELYDALVSG
Ga0207669_1069832113300025937Miscanthus RhizosphereMKLALIKFLSAATIVCAADVPITQDELVRRTQELYDALVSGN
Ga0207702_1003247853300026078Corn RhizosphereMKQLALITFLFAATIVCAADVPITQDELVRRTQELYDA
Ga0209237_110385513300026297Grasslands SoilMKLVPVIIFATTLAHAADVPITEDELVRRTQELCDAIAPGNQTP
Ga0209239_110297543300026310Grasslands SoilMKLALIKFLSAATIVCAADVPITQDELVRRTQELYDAVVPG
Ga0209375_123623023300026329SoilMKLALITFLSAVTLACAADVPITQDELVRRTQELYD
Ga0209156_1025524213300026547SoilMILMKQLVLIKFLSATTIVCAADVPITQDELVRRTQELY
Ga0209325_102197113300027050Forest SoilMKLALIKFLSAATIVCAADVPITQDELVRCTQELYDALVPGDQAP
Ga0209625_110457613300027635Forest SoilMKLPLVTFFSAVTIACATDVPITQDELVRRTQELYDAIVPG
Ga0207428_1006778013300027907Populus RhizosphereMKQLALISFLSAATVVCAADVPITQDELARRTQELYDSLVSGDR
Ga0307313_1008951813300028715SoilMKPALVTFFSVVTLACAADFPITQDELVHRTQELY
Ga0307284_1027835223300028799SoilMKFALTTFLFAVALAGAADVPITQEELVRRTQELYDAIVPGN
Ga0307305_1039103913300028807SoilMKQLALIKFLSAATIVCAADVPITQEELVRRTQELYDSL
Ga0307286_1010688513300028876SoilMKLALIKFLSAATIVCAADVPITQDELVRRTQELYDA
Ga0307308_1033643413300028884SoilMILMKQLALIKFLSAATIVCAADVPITQDELVRRTQELYDA
Ga0075400_1172807023300030972SoilMKLALIKFLSAATIVCAADVPITQDELIRRTQELY
Ga0170834_10351544533300031057Forest SoilMKLALVTFFYTVTLVYAADVPITQDELVRQTQELYDAVVPG
Ga0170824_10454194323300031231Forest SoilMFSLMKLVLVIIFATTLAHAADVPITQDELVRRTQEL
Ga0170824_12445857023300031231Forest SoilMFSVMKLVLVIIFATTLAHAADVPITQDELVRRTQELYDAIVPG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.