Basic Information | |
---|---|
Family ID | F098146 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 104 |
Average Sequence Length | 50 residues |
Representative Sequence | MPNDNNRVLTRRGARQLSQDEIEQTAGAGATLLSVIVTNTAGNPDQRLDS |
Number of Associated Samples | 74 |
Number of Associated Scaffolds | 104 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 92.31 % |
% of genes near scaffold ends (potentially truncated) | 11.54 % |
% of genes from short scaffolds (< 2000 bps) | 80.77 % |
Associated GOLD sequencing projects | 58 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.26 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (79.808 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (26.923 % of family members) |
Environment Ontology (ENVO) | Unclassified (38.462 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (54.808 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 14.10% β-sheet: 10.26% Coil/Unstructured: 75.64% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 104 Family Scaffolds |
---|---|---|
PF00025 | Arf | 4.81 |
PF10431 | ClpB_D2-small | 3.85 |
PF03738 | GSP_synth | 0.96 |
PF01063 | Aminotran_4 | 0.96 |
PF13519 | VWA_2 | 0.96 |
PF05164 | ZapA | 0.96 |
PF13200 | DUF4015 | 0.96 |
PF00238 | Ribosomal_L14 | 0.96 |
COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
---|---|---|---|
COG1100 | GTPase SAR1 family domain | General function prediction only [R] | 4.81 |
COG0115 | Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase | Amino acid transport and metabolism [E] | 1.92 |
COG0093 | Ribosomal protein L14 | Translation, ribosomal structure and biogenesis [J] | 0.96 |
COG0754 | Glutathionylspermidine synthase, CHAP domain | Amino acid transport and metabolism [E] | 0.96 |
COG3027 | Cell division protein ZapA, inhibits GTPase activity of FtsZ | Cell cycle control, cell division, chromosome partitioning [D] | 0.96 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 79.81 % |
All Organisms | root | All Organisms | 20.19 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459013|GO6OHWN02I01XA | Not Available | 520 | Open in IMG/M |
2199352024|deeps_contig13596.9018 | Not Available | 699 | Open in IMG/M |
3300003321|soilH1_10154086 | Not Available | 1634 | Open in IMG/M |
3300003571|Ga0007419J51692_1097792 | Not Available | 514 | Open in IMG/M |
3300004479|Ga0062595_100650139 | Not Available | 834 | Open in IMG/M |
3300004799|Ga0058863_11892290 | Not Available | 613 | Open in IMG/M |
3300004800|Ga0058861_10167818 | Not Available | 590 | Open in IMG/M |
3300004800|Ga0058861_11942440 | Not Available | 897 | Open in IMG/M |
3300004800|Ga0058861_11954636 | Not Available | 870 | Open in IMG/M |
3300004803|Ga0058862_10215731 | Not Available | 639 | Open in IMG/M |
3300005434|Ga0070709_10010433 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 5147 | Open in IMG/M |
3300005434|Ga0070709_10042530 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 2806 | Open in IMG/M |
3300005434|Ga0070709_10059204 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 2431 | Open in IMG/M |
3300005434|Ga0070709_10897485 | Not Available | 701 | Open in IMG/M |
3300005435|Ga0070714_100603067 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1055 | Open in IMG/M |
3300005435|Ga0070714_100841484 | Not Available | 890 | Open in IMG/M |
3300005435|Ga0070714_101186808 | Not Available | 744 | Open in IMG/M |
3300005436|Ga0070713_100054386 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 3321 | Open in IMG/M |
3300005436|Ga0070713_100448309 | Not Available | 1212 | Open in IMG/M |
3300005436|Ga0070713_100518002 | Not Available | 1127 | Open in IMG/M |
3300005437|Ga0070710_10267735 | Not Available | 1104 | Open in IMG/M |
3300005437|Ga0070710_10336917 | Not Available | 995 | Open in IMG/M |
3300005439|Ga0070711_100020723 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 4241 | Open in IMG/M |
3300005458|Ga0070681_10643541 | Not Available | 975 | Open in IMG/M |
3300005526|Ga0073909_10053559 | Not Available | 1473 | Open in IMG/M |
3300005530|Ga0070679_100266567 | Not Available | 1668 | Open in IMG/M |
3300005533|Ga0070734_10002034 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 26450 | Open in IMG/M |
3300005537|Ga0070730_10086483 | Not Available | 2189 | Open in IMG/M |
3300005542|Ga0070732_10052100 | Not Available | 2366 | Open in IMG/M |
3300005542|Ga0070732_10089591 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1805 | Open in IMG/M |
3300005542|Ga0070732_10325119 | Not Available | 924 | Open in IMG/M |
3300005547|Ga0070693_100915868 | Not Available | 658 | Open in IMG/M |
3300005563|Ga0068855_102381425 | Not Available | 529 | Open in IMG/M |
3300005614|Ga0068856_101445264 | Not Available | 702 | Open in IMG/M |
3300005764|Ga0066903_108954709 | Not Available | 507 | Open in IMG/M |
3300006028|Ga0070717_10121300 | Not Available | 2240 | Open in IMG/M |
3300006028|Ga0070717_10378838 | Not Available | 1268 | Open in IMG/M |
3300006028|Ga0070717_10428409 | Not Available | 1190 | Open in IMG/M |
3300006028|Ga0070717_10746829 | Not Available | 889 | Open in IMG/M |
3300006163|Ga0070715_10122214 | Not Available | 1243 | Open in IMG/M |
3300006173|Ga0070716_100897250 | Not Available | 694 | Open in IMG/M |
3300006175|Ga0070712_101656066 | Not Available | 560 | Open in IMG/M |
3300006755|Ga0079222_10192787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1216 | Open in IMG/M |
3300006755|Ga0079222_10928118 | Not Available | 735 | Open in IMG/M |
3300006806|Ga0079220_10978424 | Not Available | 668 | Open in IMG/M |
3300006806|Ga0079220_11330450 | Not Available | 604 | Open in IMG/M |
3300006954|Ga0079219_11172115 | Not Available | 661 | Open in IMG/M |
3300009093|Ga0105240_12376184 | Not Available | 549 | Open in IMG/M |
3300009098|Ga0105245_10027133 | All Organisms → cellular organisms → Bacteria | 5045 | Open in IMG/M |
3300009098|Ga0105245_10054369 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 3596 | Open in IMG/M |
3300009551|Ga0105238_10287133 | Not Available | 1627 | Open in IMG/M |
3300010358|Ga0126370_10162193 | Not Available | 1644 | Open in IMG/M |
3300010373|Ga0134128_10101026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 3280 | Open in IMG/M |
3300010376|Ga0126381_100213981 | Not Available | 2586 | Open in IMG/M |
3300010397|Ga0134124_11887871 | Not Available | 633 | Open in IMG/M |
3300010397|Ga0134124_11997101 | Not Available | 617 | Open in IMG/M |
3300010398|Ga0126383_10021754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4930 | Open in IMG/M |
3300011120|Ga0150983_12897141 | Not Available | 1061 | Open in IMG/M |
3300012955|Ga0164298_10731411 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 698 | Open in IMG/M |
3300012957|Ga0164303_10550143 | Not Available | 749 | Open in IMG/M |
3300012960|Ga0164301_10313928 | Not Available | 1061 | Open in IMG/M |
3300012984|Ga0164309_10932052 | Not Available | 710 | Open in IMG/M |
3300012986|Ga0164304_11787768 | Not Available | 514 | Open in IMG/M |
3300012987|Ga0164307_10045436 | Not Available | 2487 | Open in IMG/M |
3300012988|Ga0164306_10272096 | Not Available | 1224 | Open in IMG/M |
3300013306|Ga0163162_11192368 | Not Available | 864 | Open in IMG/M |
3300017936|Ga0187821_10349215 | Not Available | 596 | Open in IMG/M |
3300020070|Ga0206356_10069856 | Not Available | 1043 | Open in IMG/M |
3300020070|Ga0206356_11906538 | Not Available | 576 | Open in IMG/M |
3300020077|Ga0206351_10358498 | Not Available | 876 | Open in IMG/M |
3300020078|Ga0206352_11000315 | Not Available | 667 | Open in IMG/M |
3300020080|Ga0206350_11567414 | Not Available | 1070 | Open in IMG/M |
3300021560|Ga0126371_10220772 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1999 | Open in IMG/M |
3300021560|Ga0126371_12270835 | Not Available | 655 | Open in IMG/M |
3300025898|Ga0207692_10408738 | Not Available | 848 | Open in IMG/M |
3300025905|Ga0207685_10076657 | Not Available | 1371 | Open in IMG/M |
3300025912|Ga0207707_10116632 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 2333 | Open in IMG/M |
3300025912|Ga0207707_10564602 | Not Available | 966 | Open in IMG/M |
3300025915|Ga0207693_10077503 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2603 | Open in IMG/M |
3300025915|Ga0207693_10636231 | Not Available | 829 | Open in IMG/M |
3300025916|Ga0207663_10928385 | Not Available | 696 | Open in IMG/M |
3300025924|Ga0207694_10902776 | Not Available | 747 | Open in IMG/M |
3300025927|Ga0207687_10019755 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4465 | Open in IMG/M |
3300025928|Ga0207700_10002894 | All Organisms → cellular organisms → Bacteria | 9893 | Open in IMG/M |
3300025928|Ga0207700_10515373 | Not Available | 1059 | Open in IMG/M |
3300025928|Ga0207700_11422673 | Not Available | 616 | Open in IMG/M |
3300025928|Ga0207700_11778210 | Not Available | 542 | Open in IMG/M |
3300025929|Ga0207664_11771198 | Not Available | 540 | Open in IMG/M |
3300025939|Ga0207665_10571735 | Not Available | 880 | Open in IMG/M |
3300026078|Ga0207702_11403523 | Not Available | 692 | Open in IMG/M |
3300027376|Ga0209004_1096469 | Not Available | 501 | Open in IMG/M |
3300027826|Ga0209060_10003183 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 14044 | Open in IMG/M |
3300027842|Ga0209580_10061054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1774 | Open in IMG/M |
3300027842|Ga0209580_10083783 | Not Available | 1527 | Open in IMG/M |
3300027842|Ga0209580_10321643 | Not Available | 771 | Open in IMG/M |
3300027857|Ga0209166_10071488 | Not Available | 1975 | Open in IMG/M |
3300030847|Ga0075405_11732750 | Not Available | 681 | Open in IMG/M |
3300031231|Ga0170824_104333587 | Not Available | 625 | Open in IMG/M |
3300031231|Ga0170824_125182236 | Not Available | 1542 | Open in IMG/M |
3300031446|Ga0170820_17559459 | Not Available | 1212 | Open in IMG/M |
3300031474|Ga0170818_100391573 | Not Available | 604 | Open in IMG/M |
3300031474|Ga0170818_108215184 | Not Available | 575 | Open in IMG/M |
3300031938|Ga0308175_101235000 | Not Available | 831 | Open in IMG/M |
3300031996|Ga0308176_10923121 | Not Available | 918 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 26.92% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 10.58% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.73% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.81% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 4.81% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.81% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 4.81% |
Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 4.81% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.85% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 3.85% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.88% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.88% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.88% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.92% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.92% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.96% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.96% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.96% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.96% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.96% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459013 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cm | Environmental | Open in IMG/M |
2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
3300003571 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Bulk_35 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300030847 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
N57_02275490 | 2170459013 | Grass Soil | MPNNNNRVLTRRGARQLSQDEIEQTTGAGATLLSVIMTNTAGNPDQRLDS |
deeps_01550260 | 2199352024 | Soil | MPNDSNRVLTRRGARQLTQNEIEQTTGAGATLLSVIVTNTGGNPDQRLDS |
soilH1_101540863 | 3300003321 | Sugarcane Root And Bulk Soil | MPNDNNRVLTRRGARQLTQNEIDQTAGAANTLLSVIVTNTAGNPDQRLDS* |
Ga0007419J51692_10977921 | 3300003571 | Avena Fatua Rhizosphere | MPNDNNRVLTRRGARQLSQNEIEQTAGAGATLLSVIVTNTAGNPDQRLDS* |
Ga0062595_1006501393 | 3300004479 | Soil | MPNDSNRVLTRKGARQLSPDEMEQTTGAGATLLSVIVTNTAGNPDQRLDS* |
Ga0058863_118922902 | 3300004799 | Host-Associated | MPNDSNRVLTRRGARQLSQNEIEQTAGRANTLLSMMLTNSAGHPDQRLDS* |
Ga0058861_101678181 | 3300004800 | Host-Associated | VPKDNDRVLTRRGARQLSPDEMEQTAGAGATLLSVIVTNTAGNPDQRLDT* |
Ga0058861_119424403 | 3300004800 | Host-Associated | MPNDSNRVLTRRGARQLSQNEIEQTAGGANTLLSMMLTNSAGHPDQRLDS* |
Ga0058861_119546363 | 3300004800 | Host-Associated | MPNNTNRVLTRRGARQLSQDEVEQTTGAAATLLSVIVTNTGGNPDQRLDS* |
Ga0058862_102157311 | 3300004803 | Host-Associated | RGARQLSPDEMEQTAGAGATLLSVIVTNTAGNPDQRLDT* |
Ga0070709_100104331 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MPNDSNRVLTRRGARQLSQDEIEQTSGAGATLLSVIVTNTAGNPDQKLD |
Ga0070709_100425302 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MPNDNNRVLTRRGARQLSQDEIEQTAGAGATLLSVIVTNTAGNPDQRLDS* |
Ga0070709_100592043 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MSNDSNRVLTRRGARQLSHDEMEQTAGGGATLLSVIVTNTNGNADQRLDS* |
Ga0070709_108974851 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MPNDNNRVLTRRGARQLSHDEMEQATGAAITLLSVIVTNTGGNPDQRLDT* |
Ga0070714_1006030673 | 3300005435 | Agricultural Soil | MPNDNNRVLTRRGARQISHDEMEQTAGGGATLLSVIVTNTNGNADQRLDS* |
Ga0070714_1008414843 | 3300005435 | Agricultural Soil | MPNHNNRVLTRRGARQLSQDEIQQTAGAGATLLSVIMTTTASGSSDQKLDS* |
Ga0070714_1011868081 | 3300005435 | Agricultural Soil | MPNDNNRVLTRRGARQLSQDEIEQTAGAGATLLSVIVTNTAGNPDQKLDS* |
Ga0070713_1000543861 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MSNDSNRVLTRTGARQLSQNEIEQTAGAGATLLSVIMTTTTSGSSDQKLDS* |
Ga0070713_1004483091 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MPNDNRVLTRRGARQLSQDEIEQTTGAGATLLSVIMTTTTSGSSDQKLDS* |
Ga0070713_1005180024 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MPNDSNRVLTRRGARQLSQDEIEQTTGAGATLLSVIMTTTTSGSSDQKLDS* |
Ga0070710_102677352 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MPNDNNRVLTRRGARQLSQGEIEQTAGAGATLLSVIVTNTAGNPDQKLDS* |
Ga0070710_103369174 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MSNDNNRVLTRRGARQLSQNEMEQINGAGATLLSVIVTNVGGTPDQRLDS* |
Ga0070711_1000207236 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MPNDNNRVLTRRGARQLSQDEIEQTAGAGATLLSVIVTHTAGNPDQRLDT* |
Ga0070681_106435413 | 3300005458 | Corn Rhizosphere | MPNQDGNRVLTRMGVRKLSQDEIEQTAGAAATLLSVIVTNTSGNPDQRLDS* |
Ga0073909_100535594 | 3300005526 | Surface Soil | MPNDSNRVLTRRGARQLSHDEMEQTAGAAITLLSVIVTNTSGNPDQRLDT* |
Ga0070679_1002665676 | 3300005530 | Corn Rhizosphere | VPKDNDRVLTRRGARQLSQDEMEQTAGAGATLLSVIVTNTAGNPDQRLDT* |
Ga0070734_1000203412 | 3300005533 | Surface Soil | MSNNENNRVLTRRGARQLSQDEIEQTSGAAATLLSVIMTTTSSGSSDQKLDS* |
Ga0070730_100864835 | 3300005537 | Surface Soil | MPNDNNRVLTRRGARQLSQDEIEQTAGAGATLLSVIITTQNGNRDQRLDS* |
Ga0070732_100521003 | 3300005542 | Surface Soil | MPNDSNRVLTRRGARQLSHDEVEQTAGAGATLLSVIVTNTAGNPDQRLDS* |
Ga0070732_100895913 | 3300005542 | Surface Soil | MPNDSNRVLTRRGARQLSQDEIEQTAGAANTLLSVIITNQNGNRDQRLDN* |
Ga0070732_103251193 | 3300005542 | Surface Soil | MPNDSNRVLTRRGARQLSQDEIEQTTGAGATLLSVIVTNTSGNPDQRLDT* |
Ga0070693_1009158681 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | KGARQLSPDEMEQTTGAGATLLSVIVTNTAGNPDQRLDS* |
Ga0068855_1023814252 | 3300005563 | Corn Rhizosphere | MPNDSNRVLTRRGARQLSQDEIEQTAGASATLLSVIVTNTAGNPDQRLDT* |
Ga0068856_1014452641 | 3300005614 | Corn Rhizosphere | MPNDSNRVLTRRGARQLSHDEMEQTAGAAITLLSVIVTNTSG |
Ga0066903_1089547092 | 3300005764 | Tropical Forest Soil | MSNDNNRVLTRRGARQLSHDEMEQTTGAAITLLSVILTNPAGTDHRLDS* |
Ga0070717_101213004 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MPNNNRVLTRRGARQLSQDEIDQAAGGVNTLLSVIITTQNGNRDQRLDS* |
Ga0070717_103788381 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MPNDSNRVLTRRGARQLSQDEIEQTAGAGATLLSVIVTNTAGNPDQRLDS* |
Ga0070717_104284094 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MPNDNNRVLTRRGARQLSQDEIEQTSGAGATLLSVIMTTTTSGSSDQKLDS* |
Ga0070717_107468292 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MSNDGNRVLTRRGARQLSQNEIEQTAGAGATLLSVIMTTTTSGSSDQKLDS* |
Ga0070715_101222142 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MPNDSNRVLTRRGARQLSKDEIEQTAGAGATLLSVIVTNTAGNPDQRLDS* |
Ga0070716_1008972503 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | TRRGARQLSQNEMEQISGAGATLLSVIVTNVGGTRDQRLDS* |
Ga0070712_1016560662 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MPNDSNRVLTRRGARQLSQDEIEQTSGAGATLLSVIVTNTAGNPDQKLDS* |
Ga0079222_101927873 | 3300006755 | Agricultural Soil | MPNDNNRVLTRRGARQLSHDEIEQTAGAGATLLSVIVTNTAGNPDQRLDS* |
Ga0079222_109281184 | 3300006755 | Agricultural Soil | MPNDNDRVLTRRGARQLSHDEMDQTTGAAITLLSVIVTNTGGNPDQRLDT* |
Ga0079220_109784242 | 3300006806 | Agricultural Soil | MPNDNNRVLTRRGARQLSQDEIEQITGAGATLLSVIMTNVDGNPDQRHDT* |
Ga0079220_113304502 | 3300006806 | Agricultural Soil | MPNDSNRVLTRRGARQLSHDEMEQTTGASITLLSVIVTNTAGNPDQRLDT* |
Ga0079219_111721152 | 3300006954 | Agricultural Soil | MPNDNNRLLTRRGARQLSHAEMEHTAGGGATLLSVIVTNTNGNADQRLDS* |
Ga0105240_123761841 | 3300009093 | Corn Rhizosphere | KGDHMPNNSNRVLTRRGARQLSQDEVEQTTGAAATLLSVIVTNTGGNPDQRLDS* |
Ga0105245_100271334 | 3300009098 | Miscanthus Rhizosphere | MPNDSNRVLTRKGARQLSQDEIEQTAGAGATLLSVIVTNTAGNPDQRLDS* |
Ga0105245_100543695 | 3300009098 | Miscanthus Rhizosphere | MPNNSNRVLTRRGARQLSQDEVEQTTGAAATLLSVIVTNTGGNPDQRLDS* |
Ga0105238_102871333 | 3300009551 | Corn Rhizosphere | MPKDNDRVLTRRGARQLSQDEMEQTAGAGATLLSVIVTNTAGNPDQRLDT* |
Ga0126370_101621932 | 3300010358 | Tropical Forest Soil | MPNDNNRVLTRKGARHLSHDEMEQTTGAAITLLSVILTNPATDPDRRLDT* |
Ga0134128_101010264 | 3300010373 | Terrestrial Soil | MPNDNNRVLTRRGARQLSQDEIDQTAGGIPTLLSVIVTNTNGNPDQRLDS* |
Ga0126381_1002139814 | 3300010376 | Tropical Forest Soil | MPNDNNRVLTRRGARQLSHDEMEQTTGAAITLLSVILTNPASDLDRRLDT* |
Ga0134124_118878711 | 3300010397 | Terrestrial Soil | LSQDEIEQTAGAGATLLSVIVTNTAGNPNQRLDT* |
Ga0134124_119971013 | 3300010397 | Terrestrial Soil | MPNDSTRVLTRRGARQLSQDEIEQTAGAGATLLSVIVTNTAGNP |
Ga0126383_100217547 | 3300010398 | Tropical Forest Soil | MSNDSNRVLTRRGARQLTQNEIEQTAGAANTLLSVIITTQDGNRDQRLDN* |
Ga0150983_128971413 | 3300011120 | Forest Soil | MPNDTNRVLTRRGARQLSQDEIEQTTGAGATLLSVIVTHTAGNPDQRLDS* |
Ga0164298_107314111 | 3300012955 | Soil | NDSNRVLTRRGARQLSHDEMEQTAGGGATLLSVIVTNTNGNADQRLDS* |
Ga0164303_105501432 | 3300012957 | Soil | MPNDNNRVLTRRGARQLSHDEMEQTTGAAITLLSVILTNPASDPDRRLDT* |
Ga0164301_103139282 | 3300012960 | Soil | MPNDSNRVLTRRGARQLSQDEIEQTAGAGATLLSVIVTNTAGNPDQRLDT* |
Ga0164309_109320522 | 3300012984 | Soil | MPNDSNRVLTRRGARQLSQDEIEQTAGAGATLLSVIVINTAGNPDQRLDT* |
Ga0164304_117877681 | 3300012986 | Soil | MPNDSNRVLTRRGARQLSHDEIEQTAGAGATLLSVIVTNTAGNPDQRLDS* |
Ga0164307_100454367 | 3300012987 | Soil | MSNDSNRVLTRRGARQLSHDEMEQTAGGGATLLSVIVTNTAGNPDQRLDS* |
Ga0164306_102720964 | 3300012988 | Soil | MPNDSNRVLTRRGARQLFQDEIEQTAGAGATLLSVIVTNTAGNPDQRLDS* |
Ga0163162_111923681 | 3300013306 | Switchgrass Rhizosphere | MYAEPGNNRVLTRMGVRKLSQDEIEQTAGAAATLLSVIVTNTSGNPDQRLDS* |
Ga0187821_103492152 | 3300017936 | Freshwater Sediment | MPNDSNRVLTRRGARQLSQDEIEQTAGAANTLLSVIITNQNGNRDQRLDT |
Ga0206356_100698562 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | VPKDNDRVLTRRGARQLSPDEMEQTAGAGATLLSVIVTNTAGNPDQRLDT |
Ga0206356_119065382 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MPNNSNRVLTRRGARQLSQDEVEQTTGAAATLLSVIVTNTGGNPDQRLDS |
Ga0206351_103584982 | 3300020077 | Corn, Switchgrass And Miscanthus Rhizosphere | MPNDSNRVLTRRGARQLSQDEIEQTAGASATLLSVIVTNTAGNPDQRLDT |
Ga0206352_110003151 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | MPNNTNRVLTRRGARQLSQDEVEQTTGAAATLLSVIVTNTGGNPDQRLDS |
Ga0206350_115674146 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | RQLSPDEMEQTAGAGATLLSVIVTNTAGNPDQRLDT |
Ga0126371_102207725 | 3300021560 | Tropical Forest Soil | MPNDSNRVLTRRGARQLSHDEMEQTTGAAITLLSVILTNPAGTDHRLDS |
Ga0126371_122708352 | 3300021560 | Tropical Forest Soil | MPNDNNRVLTRRGARQLSHDEMEQTTGGAITLLSVILTNPASDPDRRLDT |
Ga0207692_104087383 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MPNDNNRVLTRRGARQLSQGEIEQTAGAGATLLSVIVTNTAGNPDQKLDS |
Ga0207685_100766574 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MPNDSNRVLTRRGARQLSKDEIEQTAGAGATLLSVIVTNTAGNPDQKLDS |
Ga0207707_101166321 | 3300025912 | Corn Rhizosphere | MPNDSNRVLTRRGARQLSQNEIEQTAGRANTLLSMMLTNSAGHPDQRLDS |
Ga0207707_105646022 | 3300025912 | Corn Rhizosphere | MPNQDGNRVLTRMGVRKLSQDEIEQTAGAAATLLSVIVTNTSGNPDQRLDS |
Ga0207693_100775035 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MPNDNNRVLTRRGARQLSQDEIEQTAGAGATLLSVIVTHTAGNPDQRLDT |
Ga0207693_106362312 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MPNDSNRVLTRRGARQLSQDEIEQTSGAGATLLSVIVTNTAGNPDQKLDS |
Ga0207663_109283851 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | DNNRVLTRRGARQLSQDEIEQTAGAGATLLSVIVTNTAGNPDQRLDS |
Ga0207694_109027762 | 3300025924 | Corn Rhizosphere | MPKDNDRVLTRRGARQLSQDEMEQTAGAGATLLSVIVTNTAGNPDQRLDT |
Ga0207687_100197555 | 3300025927 | Miscanthus Rhizosphere | MPNDSNRVLTRKGARQLSQDEIEQTAGAGATLLSVIVTNTAGNPDQRLDS |
Ga0207700_1000289410 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MSNDSNRVLTRTGARQLSQNEIEQTAGAGATLLSVIMTTTTSGSSDQKLDS |
Ga0207700_105153731 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MPNHNNRVLTRRGARQLSQDEIQQTAGAGATLLSVIMTTTASGSSDQKLDS |
Ga0207700_114226732 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MPNDNNRVLTRRGARQLSQDEIEQTSGAGATLLSVIMTTTASGSSDQKLDS |
Ga0207700_117782101 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MPNDSNRVLTRRGARQLSQDEIEQTTGAGATLLSVIMTTTTSGSSDQKLDS |
Ga0207664_117711983 | 3300025929 | Agricultural Soil | MSNDSNRVLTRRGARQLSQDEIQQTAGAGATLLSVIMTTTASGSSD |
Ga0207665_105717353 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MPNDSNRVLTRRGARQLSKDEMEQTTGAGATLLSVIVTNTAGNPDQRLDT |
Ga0207702_114035231 | 3300026078 | Corn Rhizosphere | MPNDSNRVLTRRGARQLSHDEMEQTAGAAITLLSVIVTNTSGNPDQRLDT |
Ga0209004_10964692 | 3300027376 | Forest Soil | MPNDNNRVLTRRGARQLSQDEIDQTAGGINTLLSVIITTQNGNRDQRLDS |
Ga0209060_1000318313 | 3300027826 | Surface Soil | MSNNENNRVLTRRGARQLSQDEIEQTSGAAATLLSVIMTTTSSGSSDQKLDS |
Ga0209580_100610543 | 3300027842 | Surface Soil | MPNDSNRVLTRRGARQLSQDEIEQTAGAANTLLSVIITNQNGNRDQRLDN |
Ga0209580_100837833 | 3300027842 | Surface Soil | MPNDSNRVLTRRGARQLSHDEVEQTAGAGATLLSVIVTNTAGNPDQRLDS |
Ga0209580_103216431 | 3300027842 | Surface Soil | MPNDSNRVLTRRGARQLSQDEIEQTTGAGATLLSVIVTNTSGNPDQRLDT |
Ga0209166_100714883 | 3300027857 | Surface Soil | MPNDNNRVLTRRGARQLSQDEIEQTAGAGATLLSVIITTQNGNRDQRLDS |
Ga0075405_117327501 | 3300030847 | Soil | MPNDNNRVLTRRGARQLSQDEIEQTSGAANTLLSVIITNQNGNRDQRLDN |
Ga0170824_1043335873 | 3300031231 | Forest Soil | MPNDNNRVLTRRGARQLSQDEIEQTAGAANTLLSVIITSQNGNRDQRLDN |
Ga0170824_1251822361 | 3300031231 | Forest Soil | MANNTNRVLTRRGARQLSQDEIEQTAGAGATLLSVIVTHTAGNPDQRLDT |
Ga0170820_175594594 | 3300031446 | Forest Soil | MPNHNNRVLTRRGARQLSQDEIEQTSGAANTLLSVIMTNTAGNPDQRLDS |
Ga0170818_1003915731 | 3300031474 | Forest Soil | MPNNNNRVLTRRGARQLSQDEIEQTSGAANTLLSVIITNQNGNRDQRLDN |
Ga0170818_1082151843 | 3300031474 | Forest Soil | MEKAEKGDHMANNTNRVLTRRGARQLSQDEIEQTAGAGATLLSVIVTHTAGNPDQRLDT |
Ga0308175_1012350001 | 3300031938 | Soil | VPKDNNRVLTRRGARQLSQDEMEQTAGAGATLLSVIVTNTAGNPDQMLDT |
Ga0308176_109231213 | 3300031996 | Soil | VPKDNNRVLTRRGARQLSQDEMEQTAGAGATLLSVIVTNTAGNPDQRLDT |
⦗Top⦘ |